A0A059QAQ1_HUMAN Loading...

ATP synthase complex subunit 8

AlphaFold DB (Q5S8Z2), UniProt , Accession A0A059QAQ1, Species HUMAN (Homo sapiens, Human), Gene ATP8, Length 68 aa.

						>A0A059QAQ1_HUMAN|A0A059QAQ1|ATP8
MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPXPKPMKMKNYNKPWEPKWTKICSLHSLPPQS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.2	Low	74.5	Confident	192 Å²	192	117.9 Å²	117.9	95%	0.946	64%	0.642	S	S	*	*				0	129.7	0	-88.3	173.9	154.1	0	108.9	Q3 L4	M1-Q3 PolarHBondContact O-N 3.02Å; M1-L4 PolarHBondContact O-N 3.03Å; M1-L4 VanDerWaalsContact O-N 3.15Å
2	P	64.3	Low	75.5	Confident	111 Å²	111	117.2 Å²	117.2	72%	0.721	63%	0.633	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.9	3.2	-175.7	29.4	-35.8	0	0	115	N5	P2-N5 WeakPolarHBondContact CA-OD1 3.41Å; P2-N5 VanDerWaalsContact O-CG 3.23Å; P2-N5 PolarHBondContact O-ND2 2.86Å; P2-N5 PolarHBondContact O-OD1 3.49Å
3	Q	59.1	Low	76.7	Confident	157 Å²	157	113.5 Å²	113.5	73%	0.734	61%	0.612	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.4	-12.8	174.1	-67.4	172.8	-60.3	0	112.8	M1	M1-Q3 PolarHBondContact O-N 3.02Å
4	L	69.6	Low	77.9	Confident	149 Å²	149	111.8 Å²	111.8	78%	0.78	61%	0.607	S	S	*	*	S	Bend	trans	-91.2	-9.4	-175.9	-144.6	78.3	0	0	113.4	M1 T6	M1-L4 PolarHBondContact O-N 3.03Å; M1-L4 VanDerWaalsContact O-N 3.15Å; L4-T6 VanDerWaalsContact C-N 3.33Å; L4-T6 PolarHBondContact O-N 3.49Å
5	N	70.8	Confident	79	Confident	69 Å²	69	108.6 Å²	108.6	37%	0.369	59%	0.594	S	S	.	*			trans	-74.9	84.6	172.2	32.3	-65.2	0	0	109.3	P2 T7 V8	P2-N5 WeakPolarHBondContact CA-OD1 3.41Å; P2-N5 VanDerWaalsContact O-CG 3.23Å; P2-N5 PolarHBondContact O-ND2 2.86Å; P2-N5 PolarHBondContact O-OD1 3.49Å; N5-T7 PolarHBondContact O-N 3.44Å; N5-V8 WeakPolarHBondContact O-CG2 3.31Å
6	T	76.3	Confident	79.9	Confident	92 Å²	92	109.4 Å²	109.4	56%	0.564	59%	0.594	S	S	*	*	G	3₁₀ helix	trans	-70.3	-11.6	176.5	53.2	0	0	0	113.4	L4 V8 W9 P10	L4-T6 VanDerWaalsContact C-N 3.33Å; L4-T6 PolarHBondContact O-N 3.49Å; T6-V8 PolarHBondContact O-N 2.94Å; T6-W9 VanDerWaalsContact O-CB 3.32Å; T6-W9 WeakPolarHBondContact O-CB 3.34Å; T6-W9 PolarHBondContact O-N 3.04Å; T6-P10 WeakPolarHBondContact O-CD 3.33Å
7	T	81.3	Confident	80.9	Confident	121 Å²	121	109.4 Å²	109.4	74%	0.742	59%	0.593	S	S	*	*	G	3₁₀ helix	trans	-59.8	-26	179.7	9.6	0	0	0	113.9	N5	N5-T7 PolarHBondContact O-N 3.44Å
8	V	83.8	Confident	81.7	Confident	83 Å²	83	108.8 Å²	108.8	50%	0.503	59%	0.589	S	S	.	*	G	3₁₀ helix	trans	-91	-9.7	177.9	-71.2	0	0	0	113.6	N5 T6 T11 M12	N5-V8 WeakPolarHBondContact O-CG2 3.31Å; T6-V8 PolarHBondContact O-N 2.94Å; V8-T11 PolarHBondContact O-N 3.38Å; V8-M12 PolarHBondContact O-N 3.46Å; V8-M12 VanDerWaalsContact O-N 3.16Å
9	W	84.6	Confident	82.5	Confident	133 Å²	133	107.1 Å²	107.1	50%	0.504	58%	0.583	S	S	.	*	H	α-helix	trans	-64.6	-44.5	-176.1	-73.7	36.3	0	0	113.1	T6 T11 M12 I13	T6-W9 VanDerWaalsContact O-CB 3.32Å; T6-W9 WeakPolarHBondContact O-CB 3.34Å; T6-W9 PolarHBondContact O-N 3.04Å; W9-T11 VanDerWaalsContact C-N 3.32Å; W9-T11 PolarHBondContact O-N 3.17Å; W9-M12 PolarHBondContact O-N 3.33Å; W9-M12 VanDerWaalsContact O-N 3.11Å; W9-I13 HydrophobicContact CB-CD1 4.11Å; W9-I13 HydrophobicContact CE3-CD1 4.37Å; W9-I13 WeakPolarHBondContact O-CB 3.4Å; W9-I13 WeakPolarHBondContact O-CD1 3.18Å; W9-I13 WeakPolarHBondContact O-CG1 3.23Å; W9-I13 PolarHBondContact O-N 3.42Å
10	P	86.9	Confident	83.2	Confident	80 Å²	80	107.1 Å²	107.1	52%	0.519	58%	0.581	S	S	.	*	H	α-helix	trans	-58	-45.9	177.4	-24.3	34.9	0	0	111.7	T6 M12 I13 T14	T6-P10 WeakPolarHBondContact O-CD 3.33Å; P10-M12 PolarHBondContact O-N 2.98Å; P10-I13 PolarHBondContact O-N 3.06Å; P10-T14 WeakPolarHBondContact O-CB 3.42Å; P10-T14 PolarHBondContact O-N 2.99Å; P10-T14 PolarHBondContact O-OG1 3.23Å
11	T	88.5	Confident	83.7	Confident	110 Å²	110	107.6 Å²	107.6	68%	0.675	58%	0.579	S	S	*	*	H	α-helix	trans	-61.3	-28.9	178.7	-46.9	0	0	0	112.8	V8 W9 P15	V8-T11 PolarHBondContact O-N 3.38Å; W9-T11 VanDerWaalsContact C-N 3.32Å; W9-T11 PolarHBondContact O-N 3.17Å; T11-P15 WeakPolarHBondContact O-CD 3.45Å; T11-P15 VanDerWaalsContact O-CG 3.3Å; T11-P15 WeakPolarHBondContact O-CG 3.3Å
12	M	86.8	Confident	85.7	Confident	109 Å²	109	103.3 Å²	103.3	54%	0.537	56%	0.559	S	S	.	*	H	α-helix	trans	-84.8	-38.5	176.4	-167.8	-178.3	76.9	0	112.8	V8 W9 P10 P15 M16	V8-M12 PolarHBondContact O-N 3.46Å; V8-M12 VanDerWaalsContact O-N 3.16Å; W9-M12 PolarHBondContact O-N 3.33Å; W9-M12 VanDerWaalsContact O-N 3.11Å; P10-M12 PolarHBondContact O-N 2.98Å; M12-P15 WeakPolarHBondContact O-CD 3.34Å; M12-P15 WeakPolarHBondContact O-CG 3.27Å; M12-M16 WeakPolarHBondContact O-CG 3.46Å
13	I	91.8	Very high	87.2	Confident	70 Å²	70	102.9 Å²	102.9	36%	0.359	55%	0.55	S	S	.	.	H	α-helix	trans	-75	-38.2	-176.1	-66.4	164.1	0	0	111.2	W9 P10 M16 L17	W9-I13 HydrophobicContact CB-CD1 4.11Å; W9-I13 HydrophobicContact CE3-CD1 4.37Å; W9-I13 WeakPolarHBondContact O-CB 3.4Å; W9-I13 WeakPolarHBondContact O-CD1 3.18Å; W9-I13 WeakPolarHBondContact O-CG1 3.23Å; W9-I13 PolarHBondContact O-N 3.42Å; P10-I13 PolarHBondContact O-N 3.06Å; I13-M16 WeakPolarHBondContact O-CB 3.27Å; I13-M16 PolarHBondContact O-N 3.2Å; I13-L17 HydrophobicContact CG2-CD1 3.69Å; I13-L17 HydrophobicContact CG2-CG 4.01Å; I13-L17 WeakPolarHBondContact O-CG 3.28Å; I13-L17 PolarHBondContact O-N 2.96Å
14	T	93.4	Very high	88.7	Confident	89 Å²	89	98.7 Å²	98.7	55%	0.546	54%	0.535	S	S	.	.	H	α-helix	trans	-55.5	-52.3	179	-59.8	0	0	0	113.8	P10 M16 L17 L18	P10-T14 WeakPolarHBondContact O-CB 3.42Å; P10-T14 PolarHBondContact O-N 2.99Å; P10-T14 PolarHBondContact O-OG1 3.23Å; T14-M16 VanDerWaalsContact C-N 3.31Å; T14-M16 PolarHBondContact O-N 3.06Å; T14-L17 PolarHBondContact O-N 2.98Å; T14-L18 WeakPolarHBondContact O-CB 3.47Å; T14-L18 PolarHBondContact O-N 2.94Å
15	P	94.3	Very high	89.8	Confident	64 Å²	64	96.3 Å²	96.3	42%	0.416	52%	0.52	S	S	.	.	H	α-helix	trans	-67.3	-31.5	178.7	26.3	-34.8	0	0	112.4	T11 M12 T19	T11-P15 WeakPolarHBondContact O-CD 3.45Å; T11-P15 VanDerWaalsContact O-CG 3.3Å; T11-P15 WeakPolarHBondContact O-CG 3.3Å; M12-P15 WeakPolarHBondContact O-CD 3.34Å; M12-P15 WeakPolarHBondContact O-CG 3.27Å; P15-T19 VanDerWaalsContact O-CB 3.32Å; P15-T19 WeakPolarHBondContact O-CB 3.48Å; P15-T19 PolarHBondContact O-N 3.48Å; P15-T19 PolarHBondContact O-OG1 3.04Å
16	M	93.7	Very high	90.6	Very high	121 Å²	121	97.9 Å²	97.9	60%	0.596	53%	0.527	S	S	*	.	H	α-helix	trans	-63.3	-49.1	174.4	-73.7	-177.5	148.3	0	111.5	M12 I13 T14 T19 L20	M12-M16 WeakPolarHBondContact O-CG 3.46Å; I13-M16 WeakPolarHBondContact O-CB 3.27Å; I13-M16 PolarHBondContact O-N 3.2Å; T14-M16 VanDerWaalsContact C-N 3.31Å; T14-M16 PolarHBondContact O-N 3.06Å; M16-T19 PolarHBondContact O-N 3.05Å; M16-L20 PolarHBondContact O-N 3.08Å
17	L	96.2	Very high	91.1	Very high	109 Å²	109	100.9 Å²	100.9	57%	0.571	53%	0.533	S	S	*	.	H	α-helix	trans	-64.7	-41.6	177.1	-70.4	176.1	0	0	111.9	I13 T14 T19 L20 F21	I13-L17 HydrophobicContact CG2-CD1 3.69Å; I13-L17 HydrophobicContact CG2-CG 4.01Å; I13-L17 WeakPolarHBondContact O-CG 3.28Å; I13-L17 PolarHBondContact O-N 2.96Å; T14-L17 PolarHBondContact O-N 2.98Å; L17-T19 PolarHBondContact O-N 2.84Å; L17-L20 PolarHBondContact O-N 3.18Å; L17-F21 WeakPolarHBondContact O-CB 3.49Å; L17-F21 PolarHBondContact O-N 2.75Å
18	L	95.9	Very high	91.2	Very high	99 Å²	99	99.6 Å²	99.6	52%	0.518	52%	0.519	S	S	.	.	H	α-helix	trans	-62.1	-43.6	177.4	-177	62.7	0	0	111.4	T14 F21 L22	T14-L18 WeakPolarHBondContact O-CB 3.47Å; T14-L18 PolarHBondContact O-N 2.94Å; L18-F21 PolarHBondContact O-N 2.8Å; L18-L22 HydrophobicContact CD1-CD1 4.43Å; L18-L22 HydrophobicContact CD1-CG 4.49Å; L18-L22 HydrophobicContact CG-CD1 4.18Å; L18-L22 VanDerWaalsContact O-CG 3.28Å; L18-L22 WeakPolarHBondContact O-CG 3.5Å; L18-L22 PolarHBondContact O-N 2.8Å
19	T	96.1	Very high	91.3	Very high	77 Å²	77	102.1 Å²	102.1	47%	0.472	53%	0.529	S	S	.	.	H	α-helix	trans	-62.9	-46.4	177.4	-56.1	0	0	0	111.1	P15 M16 L17 F21 L22 I23	P15-T19 VanDerWaalsContact O-CB 3.32Å; P15-T19 WeakPolarHBondContact O-CB 3.48Å; P15-T19 PolarHBondContact O-N 3.48Å; P15-T19 PolarHBondContact O-OG1 3.04Å; M16-T19 PolarHBondContact O-N 3.05Å; L17-T19 PolarHBondContact O-N 2.84Å; T19-F21 VanDerWaalsContact C-N 3.32Å; T19-F21 PolarHBondContact O-N 2.94Å; T19-L22 PolarHBondContact O-N 2.76Å; T19-I23 HydrophobicContact CG2-CD1 3.89Å; T19-I23 VanDerWaalsContact O-CG1 3.31Å; T19-I23 WeakPolarHBondContact O-CG1 3.29Å; T19-I23 PolarHBondContact O-N 2.69Å
20	L	95.9	Very high	90.8	Very high	106 Å²	106	101 Å²	101	56%	0.555	53%	0.533	S	S	*	.	H	α-helix	trans	-62.2	-40.4	177.7	-177.5	61.7	0	0	112.1	M16 L17 T24	M16-L20 PolarHBondContact O-N 3.08Å; L17-L20 PolarHBondContact O-N 3.18Å; L20-T24 WeakPolarHBondContact O-CB 3.37Å; L20-T24 PolarHBondContact O-N 2.66Å; L20-T24 PolarHBondContact O-OG1 2.88Å
21	F	95.6	Very high	90.2	Very high	119 Å²	119	100.6 Å²	100.6	52%	0.522	53%	0.529	S	S	.	.	H	α-helix	trans	-61.7	-49.6	175.8	179	-106.2	0	0	111.3	L17 L18 T19 I23 T24 Q25	L17-F21 WeakPolarHBondContact O-CB 3.49Å; L17-F21 PolarHBondContact O-N 2.75Å; L18-F21 PolarHBondContact O-N 2.8Å; T19-F21 VanDerWaalsContact C-N 3.32Å; T19-F21 PolarHBondContact O-N 2.94Å; F21-I23 PolarHBondContact O-N 2.84Å; F21-T24 PolarHBondContact O-N 2.74Å; F21-Q25 HydrophobicContact CD1-CG 4.18Å; F21-Q25 HydrophobicContact CD2-CG 4.23Å; F21-Q25 HydrophobicContact CE1-CG 3.8Å; F21-Q25 HydrophobicContact CE2-CG 3.86Å; F21-Q25 HydrophobicContact CG-CG 4.38Å; F21-Q25 HydrophobicContact CZ-CG 3.63Å; F21-Q25 WeakPolarHBondContact O-CB 3.34Å; F21-Q25 VanDerWaalsContact O-CG 3.3Å; F21-Q25 WeakPolarHBondContact O-CG 3.45Å; F21-Q25 PolarHBondContact O-N 3.48Å
22	L	95.3	Very high	89.1	Confident	101 Å²	101	102.1 Å²	102.1	53%	0.529	53%	0.533	S	S	.	.	H	α-helix	trans	-61.5	-42.1	180	-70.2	171	0	0	112.6	L18 T19 Q25 L26	L18-L22 HydrophobicContact CD1-CD1 4.43Å; L18-L22 HydrophobicContact CD1-CG 4.49Å; L18-L22 HydrophobicContact CG-CD1 4.18Å; L18-L22 VanDerWaalsContact O-CG 3.28Å; L18-L22 WeakPolarHBondContact O-CG 3.5Å; L18-L22 PolarHBondContact O-N 2.8Å; T19-L22 PolarHBondContact O-N 2.76Å; L22-Q25 PolarHBondContact O-N 2.78Å; L22-L26 VanDerWaalsContact O-CB 3.29Å; L22-L26 WeakPolarHBondContact O-CB 3.27Å; L22-L26 PolarHBondContact O-N 2.85Å
23	I	94.8	Very high	87.8	Confident	103 Å²	103	104.9 Å²	104.9	53%	0.528	54%	0.539	S	S	.	.	H	α-helix	trans	-63	-43.8	176.7	-67.5	166.7	0	0	110.7	T19 F21 L26 K27	T19-I23 HydrophobicContact CG2-CD1 3.89Å; T19-I23 VanDerWaalsContact O-CG1 3.31Å; T19-I23 WeakPolarHBondContact O-CG1 3.29Å; T19-I23 PolarHBondContact O-N 2.69Å; F21-I23 PolarHBondContact O-N 2.84Å; I23-L26 PolarHBondContact O-N 2.59Å; I23-K27 WeakPolarHBondContact O-CB 3.46Å; I23-K27 PolarHBondContact O-N 2.92Å
24	T	91.9	Very high	86.3	Confident	69 Å²	69	109.3 Å²	109.3	42%	0.423	56%	0.558	S	S	.	*	H	α-helix	trans	-63.8	-46.6	178.5	-56.2	0	0	0	111.1	L20 F21 L26 K27 M28	L20-T24 WeakPolarHBondContact O-CB 3.37Å; L20-T24 PolarHBondContact O-N 2.66Å; L20-T24 PolarHBondContact O-OG1 2.88Å; F21-T24 PolarHBondContact O-N 2.74Å; T24-L26 PolarHBondContact O-N 2.95Å; T24-K27 PolarHBondContact O-N 2.94Å; T24-M28 HydrophobicContact CG2-CG 4.43Å; T24-M28 WeakPolarHBondContact O-CB 2.96Å; T24-M28 VanDerWaalsContact O-CG 3.27Å; T24-M28 WeakPolarHBondContact O-CG 3.34Å; T24-M28 PolarHBondContact O-N 2.88Å
25	Q	91.3	Very high	84.9	Confident	99 Å²	99	111.5 Å²	111.5	46%	0.463	57%	0.565	S	S	.	*	H	α-helix	trans	-60.7	-44	176.7	-72	-62.7	111.5	0	111.8	F21 L22 K27 M28 L29	F21-Q25 HydrophobicContact CD1-CG 4.18Å; F21-Q25 HydrophobicContact CD2-CG 4.23Å; F21-Q25 HydrophobicContact CE1-CG 3.8Å; F21-Q25 HydrophobicContact CE2-CG 3.86Å; F21-Q25 HydrophobicContact CG-CG 4.38Å; F21-Q25 HydrophobicContact CZ-CG 3.63Å; F21-Q25 WeakPolarHBondContact O-CB 3.34Å; F21-Q25 VanDerWaalsContact O-CG 3.3Å; F21-Q25 WeakPolarHBondContact O-CG 3.45Å; F21-Q25 PolarHBondContact O-N 3.48Å; L22-Q25 PolarHBondContact O-N 2.78Å; Q25-K27 VanDerWaalsContact C-N 3.33Å; Q25-K27 PolarHBondContact O-N 3.34Å; Q25-M28 PolarHBondContact O-N 2.75Å; Q25-L29 WeakPolarHBondContact O-CB 3.3Å; Q25-L29 PolarHBondContact O-N 3.36Å
26	L	89	Confident	83.5	Confident	101 Å²	101	113.4 Å²	113.4	53%	0.529	58%	0.578	S	S	.	*	H	α-helix	trans	-63.4	-40.4	177.8	-176.5	64.8	0	0	111.5	L22 I23 T24 L29 N30	L22-L26 VanDerWaalsContact O-CB 3.29Å; L22-L26 WeakPolarHBondContact O-CB 3.27Å; L22-L26 PolarHBondContact O-N 2.85Å; I23-L26 PolarHBondContact O-N 2.59Å; T24-L26 PolarHBondContact O-N 2.95Å; L26-L29 PolarHBondContact O-N 2.9Å; L26-N30 VanDerWaalsContact CD1-ND2 3.27Å; L26-N30 WeakPolarHBondContact CD1-ND2 3.46Å; L26-N30 WeakPolarHBondContact CG-ND2 3.32Å; L26-N30 WeakPolarHBondContact O-CB 3.41Å; L26-N30 PolarHBondContact O-N 3.47Å; L26-N30 PolarHBondContact O-ND2 3.44Å
27	K	85.2	Confident	82.2	Confident	156 Å²	156	112.8 Å²	112.8	68%	0.678	58%	0.583	S	S	*	*	H	α-helix	trans	-66.6	-43.3	176.6	-168.6	174.1	179.8	-171.2	111.3	I23 T24 Q25 L29 N30 T31	I23-K27 WeakPolarHBondContact O-CB 3.46Å; I23-K27 PolarHBondContact O-N 2.92Å; T24-K27 PolarHBondContact O-N 2.94Å; Q25-K27 VanDerWaalsContact C-N 3.33Å; Q25-K27 PolarHBondContact O-N 3.34Å; K27-L29 VanDerWaalsContact C-N 3.35Å; K27-N30 PolarHBondContact O-N 3.43Å; K27-T31 WeakPolarHBondContact O-CB 3.32Å; K27-T31 PolarHBondContact O-N 2.97Å; K27-T31 PolarHBondContact O-OG1 3.33Å
28	M	85.1	Confident	80.9	Confident	93 Å²	93	111 Å²	111	46%	0.458	58%	0.584	S	S	.	*	H	α-helix	trans	-64	-36.2	176.1	-72.7	-69.1	-69.8	0	112.8	T24 Q25 T31 Y33	T24-M28 HydrophobicContact CG2-CG 4.43Å; T24-M28 WeakPolarHBondContact O-CB 2.96Å; T24-M28 VanDerWaalsContact O-CG 3.27Å; T24-M28 WeakPolarHBondContact O-CG 3.34Å; T24-M28 PolarHBondContact O-N 2.88Å; Q25-M28 PolarHBondContact O-N 2.75Å; M28-T31 WeakPolarHBondContact CA-OG1 3.34Å; M28-T31 PolarHBondContact O-OG1 3.34Å; M28-Y33 HydrophobicContact CE-CE2 4.13Å
29	L	85.4	Confident	79.5	Confident	137 Å²	137	112.3 Å²	112.3	72%	0.717	60%	0.598	S	S	*	*	H	α-helix	trans	-71.8	-42.5	175.5	-176.3	66.8	0	0	112	Q25 L26 K27	Q25-L29 WeakPolarHBondContact O-CB 3.3Å; Q25-L29 PolarHBondContact O-N 3.36Å; L26-L29 PolarHBondContact O-N 2.9Å; K27-L29 VanDerWaalsContact C-N 3.35Å
30	N	74.6	Confident	78.3	Confident	108 Å²	108	117.7 Å²	117.7	58%	0.578	62%	0.615	S	S	*	*	H	α-helix	trans	-77.1	-23.3	179.7	-79	-64	0	0	113.4	L26 K27 N32	L26-N30 VanDerWaalsContact CD1-ND2 3.27Å; L26-N30 WeakPolarHBondContact CD1-ND2 3.46Å; L26-N30 WeakPolarHBondContact CG-ND2 3.32Å; L26-N30 WeakPolarHBondContact O-CB 3.41Å; L26-N30 PolarHBondContact O-N 3.47Å; L26-N30 PolarHBondContact O-ND2 3.44Å; K27-N30 PolarHBondContact O-N 3.43Å; N30-N32 PolarHBondContact O-N 3.46Å; N30-N32 PolarHBondContact O-ND2 2.87Å
31	T	73.8	Confident	76.8	Confident	73 Å²	73	118.4 Å²	118.4	45%	0.448	63%	0.626	S	S	.	*	S	Bend	trans	-71.4	85.1	161.4	26.6	0	0	0	107	K27 M28 Y33	K27-T31 WeakPolarHBondContact O-CB 3.32Å; K27-T31 PolarHBondContact O-N 2.97Å; K27-T31 PolarHBondContact O-OG1 3.33Å; M28-T31 WeakPolarHBondContact CA-OG1 3.34Å; M28-T31 PolarHBondContact O-OG1 3.34Å; T31-Y33 PolarHBondContact O-N 3.4Å
32	N	64.8	Low	75.4	Confident	142 Å²	142	121.4 Å²	121.4	76%	0.759	64%	0.644	S	S	*	*			trans	-54.6	97	159.9	-73.9	-89.3	0	0	105.5	N30 H34	N30-N32 PolarHBondContact O-N 3.46Å; N30-N32 PolarHBondContact O-ND2 2.87Å; N32-H34 PolarHBondContact O-N 2.96Å
33	Y	60	Low	73.8	Confident	167 Å²	167	126 Å²	126	66%	0.655	66%	0.66	S	S	*	*			trans	-49.2	115.8	164	-85.9	-94.2	0	0	104.5	M28 T31 L35	M28-Y33 HydrophobicContact CE-CE2 4.13Å; T31-Y33 PolarHBondContact O-N 3.4Å; Y33-L35 PolarHBondContact O-N 3.35Å
34	H	60.4	Low	72.3	Confident	163 Å²	163	129.2 Å²	129.2	76%	0.755	68%	0.675	S	S	*	*			trans	-55.3	103.4	168.2	-177.6	-75.5	0	0	104.2	N32 P36	N32-H34 PolarHBondContact O-N 2.96Å; H34-P36 VanDerWaalsContact O-N 3.11Å
35	L	64.6	Low	71	Confident	134 Å²	134	134.1 Å²	134.1	70%	0.702	69%	0.69	S	S	*	*	P	Polyproline II helix	trans	-48.9	128.6	178.1	-123.3	76.7	0	0	104.7	Y33	Y33-L35 PolarHBondContact O-N 3.35Å
36	P	63.9	Low	69.5	Low	105 Å²	105	135.7 Å²	135.7	68%	0.682	70%	0.701	S	S	*	*	P	Polyproline II helix	trans	-49.8	125.6	170.7	20.4	-29.8	0	0	105.5	H34 X38	H34-P36 VanDerWaalsContact O-N 3.11Å; P36-A38 PolarHBondContact O-N 3.37Å
37	P	65.7	Low	68.2	Low	108 Å²	108	139.5 Å²	139.5	70%	0.701	71%	0.71	S	S	*	*	P	Polyproline II helix	trans	-51.1	118.4	-168.8	17	-29.8	0	0	107.5
38	X	69.3	Low	67.2	Low	72 Å²	72	137.6 Å²	137.6	60%	0.595	71%	0.708	S	S	*	*	P	Polyproline II helix	trans	-50.9	133.8	179.9	0	0	0	0	107.5	P36 K40	P36-A38 PolarHBondContact O-N 3.37Å; A38-K40 PolarHBondContact O-N 3.49Å
39	P	67.8	Low	66.4	Low	126 Å²	126	140.2 Å²	140.2	82%	0.818	72%	0.716	S	S	*	*			trans	-54.9	112	179.8	20.2	-30	0	0	107.3
40	K	69	Low	65.4	Low	190 Å²	190	139.1 Å²	139.1	83%	0.826	72%	0.717	S	S	*	*			trans	-51	131.6	179.4	-72.8	175.3	179.6	173.8	106.5	X38 M42	A38-K40 PolarHBondContact O-N 3.49Å; K40-M42 VanDerWaalsContact C-N 3.35Å; K40-M42 PolarHBondContact O-N 2.9Å
41	P	66.1	Low	64.7	Low	121 Å²	121	140.3 Å²	140.3	79%	0.786	71%	0.714	S	S	*	*			trans	-55.3	109.2	172.6	21.9	-30.5	0	0	106	K43	P41-K43 VanDerWaalsContact C-N 3.26Å; P41-K43 PolarHBondContact O-N 2.82Å
42	M	65.8	Low	64.7	Low	182 Å²	182	141.8 Å²	141.8	90%	0.897	72%	0.716	S	S	*	*			trans	-63.5	100.7	178.3	-160.9	-177.6	-110.2	0	103.2	K40 M44	K40-M42 VanDerWaalsContact C-N 3.35Å; K40-M42 PolarHBondContact O-N 2.9Å; M42-M44 PolarHBondContact O-N 3.43Å
43	K	61.6	Low	65	Low	197 Å²	197	138.2 Å²	138.2	86%	0.857	70%	0.7	S	S	*	*			trans	-58.3	103.4	171.9	-71.7	-161.3	179.1	-173	103.9	P41 K45	P41-K43 VanDerWaalsContact C-N 3.26Å; P41-K43 PolarHBondContact O-N 2.82Å; K43-K45 PolarHBondContact O-N 2.89Å
44	M	63.7	Low	65.2	Low	171 Å²	171	135.3 Å²	135.3	84%	0.842	69%	0.691	S	S	*	*			trans	-64	87.4	174.9	-146.7	173.2	-169.4	0	104	M42 N46	M42-M44 PolarHBondContact O-N 3.43Å; M44-N46 VanDerWaalsContact C-N 3.29Å; M44-N46 PolarHBondContact O-N 3.06Å
45	K	63	Low	65.5	Low	171 Å²	171	134.4 Å²	134.4	74%	0.743	68%	0.681	S	S	*	*			trans	-64.4	106.5	169.6	-174.6	174.1	-179.9	178.3	101.9	K43 Y47	K43-K45 PolarHBondContact O-N 2.89Å; K45-Y47 PolarHBondContact O-N 2.89Å
46	N	61.8	Low	65.9	Low	132 Å²	132	131.8 Å²	131.8	71%	0.706	67%	0.67	S	S	*	*			trans	-54.6	92.1	170.5	-70.6	-51.5	0	0	105.6	M44 N48	M44-N46 VanDerWaalsContact C-N 3.29Å; M44-N46 PolarHBondContact O-N 3.06Å; N46-N48 PolarHBondContact O-N 3.25Å
47	Y	61.6	Low	66	Low	181 Å²	181	134.3 Å²	134.3	71%	0.71	67%	0.671	S	S	*	*			trans	-76.5	86.4	176.1	-139.2	-78.9	0	0	102	K45 K49	K45-Y47 PolarHBondContact O-N 2.89Å; Y47-K49 PolarHBondContact O-N 3.23Å
48	N	63.4	Low	66.1	Low	117 Å²	117	133.4 Å²	133.4	63%	0.626	66%	0.659	S	S	*	*			trans	-54.9	101.3	167.8	-74.4	-12.8	0	0	104.3	N46	N46-N48 PolarHBondContact O-N 3.25Å
49	K	67.4	Low	66.1	Low	148 Å²	148	133.4 Å²	133.4	64%	0.643	65%	0.654	S	S	*	*			trans	-56	136.4	179.2	-66.1	179	-176.8	176.5	104.4	Y47 W51 E52 P53	Y47-K49 PolarHBondContact O-N 3.23Å; K49-W51 PolarHBondContact O-N 2.96Å; K49-E52 WeakPolarHBondContact O-CB 3.44Å; K49-E52 PolarHBondContact O-N 3.04Å; K49-P53 VanDerWaalsContact O-CD 3.27Å; K49-P53 WeakPolarHBondContact O-CD 3.45Å
50	P	64.4	Low	66.3	Low	113 Å²	113	130.8 Å²	130.8	73%	0.734	64%	0.639	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55	-14	176.5	19.3	-30.5	0	0	112.8	P53	P50-P53 WeakPolarHBondContact O-CG 3.32Å
51	W	61.5	Low	66.3	Low	133 Å²	133	128.2 Å²	128.2	50%	0.504	63%	0.633	S	S	.	*	T	Hydrogen-bonded Turn	trans	-81	-26.7	173.4	-145.6	-138.7	0	0	116.3	K49 K54 W55	K49-W51 PolarHBondContact O-N 2.96Å; W51-K54 HydrophobicContact CD2-CB 4.5Å; W51-K54 HydrophobicContact CE3-CB 4.08Å; W51-K54 HydrophobicContact CE3-CD 3.96Å; W51-K54 HydrophobicContact CE3-CG 4.3Å; W51-K54 HydrophobicContact CH2-CD 3.61Å; W51-K54 HydrophobicContact CH2-CG 4.21Å; W51-K54 VanDerWaalsContact CH2-NZ 3.33Å; W51-K54 HydrophobicContact CZ2-CD 4.49Å; W51-K54 HydrophobicContact CZ3-CB 4.3Å; W51-K54 HydrophobicContact CZ3-CD 3.32Å; W51-K54 HydrophobicContact CZ3-CG 4.05Å; W51-K54 PolarHBondContact O-N 3.42Å; W51-W55 AromaticContact CD1-CD1 3.48Å; W51-W55 VanDerWaalsContact CD1-CD1 3.48Å; W51-W55 AromaticContact CD1-NE1 2.98Å; W51-W55 AromaticContact CE2-NE1 3.91Å; W51-W55 AromaticContact CG-CD1 3.94Å; W51-W55 AromaticContact CG-NE1 3.84Å; W51-W55 AromaticContact NE1-CD1 3.8Å; W51-W55 AromaticContact NE1-CE2 3.74Å; W51-W55 AromaticContact NE1-NE1 2.98Å; W51-W55 VanDerWaalsContact O-CD1 3.24Å; W51-W55 PolarHBondContact O-N 3.38Å
52	E	73.1	Confident	66.2	Low	105 Å²	105	130.5 Å²	130.5	49%	0.491	63%	0.633	S	S	.	*	H	α-helix	trans	-54.5	-54.1	175	-92.9	-118.1	105.2	0	113.1	K49 K54 W55 T56	K49-E52 WeakPolarHBondContact O-CB 3.44Å; K49-E52 PolarHBondContact O-N 3.04Å; E52-K54 PolarHBondContact O-N 2.81Å; E52-K54 VanDerWaalsContact O-N 3.08Å; E52-W55 PolarHBondContact O-N 3.4Å; E52-T56 PolarHBondContact O-N 3.04Å; E52-T56 PolarHBondContact O-OG1 3.18Å
53	P	71.2	Confident	66.1	Low	66 Å²	66	126.3 Å²	126.3	43%	0.429	62%	0.622	S	S	.	*	H	α-helix	trans	-64.7	-20.8	-178.7	24.3	-33	0	0	112.6	K49 P50 K57	K49-P53 VanDerWaalsContact O-CD 3.27Å; K49-P53 WeakPolarHBondContact O-CD 3.45Å; P50-P53 WeakPolarHBondContact O-CG 3.32Å; P53-K57 WeakPolarHBondContact O-CB 3.2Å; P53-K57 WeakPolarHBondContact O-CD 3.39Å; P53-K57 WeakPolarHBondContact O-CG 3.48Å; P53-K57 PolarHBondContact O-N 3.34Å
54	K	64.9	Low	66.1	Low	107 Å²	107	122.8 Å²	122.8	47%	0.465	61%	0.612	S	S	.	*	H	α-helix	trans	-77.4	-40	174	-173.9	146.8	160.5	-172.7	111.6	W51 E52 K57 I58	W51-K54 HydrophobicContact CD2-CB 4.5Å; W51-K54 HydrophobicContact CE3-CB 4.08Å; W51-K54 HydrophobicContact CE3-CD 3.96Å; W51-K54 HydrophobicContact CE3-CG 4.3Å; W51-K54 HydrophobicContact CH2-CD 3.61Å; W51-K54 HydrophobicContact CH2-CG 4.21Å; W51-K54 VanDerWaalsContact CH2-NZ 3.33Å; W51-K54 HydrophobicContact CZ2-CD 4.49Å; W51-K54 HydrophobicContact CZ3-CB 4.3Å; W51-K54 HydrophobicContact CZ3-CD 3.32Å; W51-K54 HydrophobicContact CZ3-CG 4.05Å; W51-K54 PolarHBondContact O-N 3.42Å; E52-K54 PolarHBondContact O-N 2.81Å; E52-K54 VanDerWaalsContact O-N 3.08Å; K54-K57 PolarHBondContact O-N 3.21Å; K54-I58 HydrophobicContact CG-CD1 4.02Å; K54-I58 WeakPolarHBondContact O-CD1 3.31Å; K54-I58 VanDerWaalsContact O-CG1 3.23Å; K54-I58 WeakPolarHBondContact O-CG1 3.32Å; K54-I58 PolarHBondContact O-N 3.11Å
55	W	66.1	Low	66.1	Low	143 Å²	143	119.4 Å²	119.4	54%	0.542	60%	0.602	S	S	.	*	H	α-helix	trans	-65.6	-46.3	172.8	-78.9	108.5	0	0	112.8	W51 E52 K57 I58 C59	W51-W55 AromaticContact CD1-CD1 3.48Å; W51-W55 VanDerWaalsContact CD1-CD1 3.48Å; W51-W55 AromaticContact CD1-NE1 2.98Å; W51-W55 AromaticContact CE2-NE1 3.91Å; W51-W55 AromaticContact CG-CD1 3.94Å; W51-W55 AromaticContact CG-NE1 3.84Å; W51-W55 AromaticContact NE1-CD1 3.8Å; W51-W55 AromaticContact NE1-CE2 3.74Å; W51-W55 AromaticContact NE1-NE1 2.98Å; W51-W55 VanDerWaalsContact O-CD1 3.24Å; W51-W55 PolarHBondContact O-N 3.38Å; E52-W55 PolarHBondContact O-N 3.4Å; W55-K57 VanDerWaalsContact C-N 3.26Å; W55-K57 PolarHBondContact O-N 3.39Å; W55-I58 PolarHBondContact O-N 3.42Å; W55-C59 PolarHBondContact O-N 2.92Å; W55-C59 PolarHBondContact O-SG 2.85Å
56	T	72.8	Confident	65.8	Low	79 Å²	79	117.2 Å²	117.2	49%	0.485	61%	0.606	S	S	.	*	H	α-helix	trans	-60.4	-39.3	177.5	-37	0	0	0	111.1	E52 S60	E52-T56 PolarHBondContact O-N 3.04Å; E52-T56 PolarHBondContact O-OG1 3.18Å; T56-S60 WeakPolarHBondContact O-CB 3.33Å; T56-S60 PolarHBondContact O-N 2.93Å; T56-S60 PolarHBondContact O-OG 3.24Å; T56-S60 VanDerWaalsContact O-OG 3.06Å
57	K	65.1	Low	65.9	Low	159 Å²	159	120.5 Å²	120.5	69%	0.691	62%	0.617	S	S	*	*	H	α-helix	trans	-64.6	-43.8	175.5	-80.9	176.7	-179.5	-178.6	113	P53 K54 W55 L61	P53-K57 WeakPolarHBondContact O-CB 3.2Å; P53-K57 WeakPolarHBondContact O-CD 3.39Å; P53-K57 WeakPolarHBondContact O-CG 3.48Å; P53-K57 PolarHBondContact O-N 3.34Å; K54-K57 PolarHBondContact O-N 3.21Å; W55-K57 VanDerWaalsContact C-N 3.26Å; W55-K57 PolarHBondContact O-N 3.39Å; K57-L61 VanDerWaalsContact O-CB 3.31Å; K57-L61 WeakPolarHBondContact O-CB 3.41Å; K57-L61 PolarHBondContact O-N 3.04Å
58	I	69.6	Low	65.2	Low	88 Å²	88	120.8 Å²	120.8	45%	0.451	65%	0.645	S	S	.	*	H	α-helix	trans	-66.6	-45.5	-179.2	-67	162.2	0	0	110.7	K54 W55 L61 H62	K54-I58 HydrophobicContact CG-CD1 4.02Å; K54-I58 WeakPolarHBondContact O-CD1 3.31Å; K54-I58 VanDerWaalsContact O-CG1 3.23Å; K54-I58 WeakPolarHBondContact O-CG1 3.32Å; K54-I58 PolarHBondContact O-N 3.11Å; W55-I58 PolarHBondContact O-N 3.42Å; I58-L61 PolarHBondContact O-N 3.16Å; I58-H62 WeakPolarHBondContact O-CB 3.1Å; I58-H62 PolarHBondContact O-N 3.41Å
59	C	68.7	Low	65.3	Low	72 Å²	72	121 Å²	121	49%	0.486	65%	0.646	S	S	.	*	H	α-helix	trans	-62	-48	176.7	-66.5	0	0	0	111.2	W55 L61 H62 S63	W55-C59 PolarHBondContact O-N 2.92Å; W55-C59 PolarHBondContact O-SG 2.85Å; C59-L61 VanDerWaalsContact C-N 3.33Å; C59-L61 PolarHBondContact O-N 2.96Å; C59-H62 PolarHBondContact O-N 3.22Å; C59-S63 PolarHBondContact O-N 2.69Å; C59-S63 PolarHBondContact O-OG 3.02Å
60	S	71.1	Confident	65.2	Low	72 Å²	72	119.5 Å²	119.5	50%	0.503	65%	0.646	S	S	.	*	H	α-helix	trans	-63.7	-35.8	178.9	-66.1	0	0	0	113.6	T56 H62 S63 L64	T56-S60 WeakPolarHBondContact O-CB 3.33Å; T56-S60 PolarHBondContact O-N 2.93Å; T56-S60 PolarHBondContact O-OG 3.24Å; T56-S60 VanDerWaalsContact O-OG 3.06Å; S60-H62 VanDerWaalsContact C-N 3.33Å; S60-S63 PolarHBondContact O-N 2.92Å; S60-L64 PolarHBondContact O-N 2.79Å
61	L	69.6	Low	65.3	Low	135 Å²	135	119.9 Å²	119.9	71%	0.707	64%	0.641	S	S	*	*	H	α-helix	trans	-66.3	-38.5	175.4	-161.4	95.3	0	0	111.4	K57 I58 C59 S63 L64	K57-L61 VanDerWaalsContact O-CB 3.31Å; K57-L61 WeakPolarHBondContact O-CB 3.41Å; K57-L61 PolarHBondContact O-N 3.04Å; I58-L61 PolarHBondContact O-N 3.16Å; C59-L61 VanDerWaalsContact C-N 3.33Å; C59-L61 PolarHBondContact O-N 2.96Å; L61-S63 VanDerWaalsContact C-N 3.35Å; L61-L64 PolarHBondContact O-N 3.15Å
62	H	65.1	Low	65.5	Low	170 Å²	170	119.1 Å²	119.1	79%	0.787	65%	0.649	S	S	*	*	H	α-helix	trans	-76.3	-23	179.2	-162.7	68.6	0	0	113.1	I58 C59 S60 L64	I58-H62 WeakPolarHBondContact O-CB 3.1Å; I58-H62 PolarHBondContact O-N 3.41Å; C59-H62 PolarHBondContact O-N 3.22Å; S60-H62 VanDerWaalsContact C-N 3.33Å; H62-L64 VanDerWaalsContact C-N 3.31Å
63	S	62.8	Low	65	Low	94 Å²	94	120 Å²	120	66%	0.657	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.7	-9.5	174.8	-55.1	0	0	0	113.9	C59 S60 L61	C59-S63 PolarHBondContact O-N 2.69Å; C59-S63 PolarHBondContact O-OG 3.02Å; S60-S63 PolarHBondContact O-N 2.92Å; L61-S63 VanDerWaalsContact C-N 3.35Å
64	L	62.4	Low	64.6	Low	122 Å²	122	123.6 Å²	123.6	64%	0.639	68%	0.675	S	S	*	*	S	Bend	trans	-72.8	125	173	-81	164	0	0	108.6	S60 L61 H62	S60-L64 PolarHBondContact O-N 2.79Å; L61-L64 PolarHBondContact O-N 3.15Å; H62-L64 VanDerWaalsContact C-N 3.31Å
65	P	62.9	Low	64.6	Low	100 Å²	100	124.8 Å²	124.8	65%	0.649	69%	0.69	S	S	*	*	P	Polyproline II helix	trans	-60.4	142.1	175.7	25.2	-31.6	0	0	108.9	Q67	P65-Q67 PolarHBondContact O-N 2.93Å
66	P	57.2	Low	64.5	Low	125 Å²	125	123.4 Å²	123.4	81%	0.812	70%	0.701	S	S	*	*	P	Polyproline II helix	trans	-55.8	118.9	175	22.7	-30.5	0	0	107.8	S68	P66-S68 PolarHBondContact O-N 3.05Å
67	Q	63.2	Low	63.8	Low	201 Å²	201	127.1 Å²	127.1	94%	0.939	72%	0.719	S	S	*	*			trans	-59.8	113.7	174.8	-89	-160.6	-55	0	108.1	P65	P65-Q67 PolarHBondContact O-N 2.93Å
68	S	47.9	Very low	63.7	Low	187 Å²	187	124.2 Å²	124.2	100%	1.308	72%	0.722	S	S	*	*			trans	-72.2	0	166.5	58.9	0	0	0	111.1	P66	P66-S68 PolarHBondContact O-N 3.05Å

Retrieved 68 of 68 residues in 55.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).