A0A060KYT4_PANTA Loading...

Mitochondrial import receptor subunit TOM22 homolog

Central receptor component of the translocase of the outer membrane of mitochondria (TOM complex) responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with the peripheral receptor TOM20 functions as the transit peptide receptor and facilitates the movement of preproteins into the translocation pore. Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases.

AlphaFold DB (M3VZ70), UniProt , Accession A0A060KYT4, Species PANTA (Panthera tigris altaica, Siberian tiger), Gene TOMM22, Length 142 aa.

						>A0A060KYT4_PANTA|A0A060KYT4|TOMM22
MAAAAAAGGPGAPLSPDELLPKGDAEKTEEELEEEDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSVFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPGKL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.4	Very low	37.7	Very low	241 Å²	241	108.5 Å²	108.5	100%	1.187	84%	0.844	S	S	*	*				0	82.4	0	-158.4	165.9	-177.7	0	0	105.8
2	A	31.3	Very low	37.9	Very low	88 Å²	88	107.4 Å²	107.4	73%	0.727	84%	0.84	S	S	*	*				52.2	101.7	91.9	0	0	0	0	0	110.3
3	A	36.9	Very low	38.6	Very low	105 Å²	105	107.3 Å²	107.3	87%	0.868	83%	0.828	S	S	*	*				68.2	141.2	76.9	0	0	0	0	0	110.3
4	A	37.3	Very low	38.9	Very low	96 Å²	96	111.2 Å²	111.2	79%	0.793	83%	0.83	S	S	*	*			cis	-160.8	-178.9	7.8	0	0	0	0	0	104
5	A	37.3	Very low	39.5	Very low	88 Å²	88	111.9 Å²	111.9	73%	0.727	83%	0.831	S	S	*	*				176.8	135.4	56.3	0	0	0	0	0	106.6
6	A	41.3	Very low	40.4	Very low	99 Å²	99	111.4 Å²	111.4	82%	0.818	82%	0.822	S	S	*	*				97.4	141.9	98.1	0	0	0	0	0	111
7	A	41.7	Very low	40.5	Very low	99 Å²	99	113.2 Å²	113.2	82%	0.818	82%	0.818	S	S	*	*			cis	-170.1	161.6	6.2	0	0	0	0	0	109.9
8	G	33.5	Very low	40.7	Very low	83 Å²	83	116.6 Å²	116.6	86%	0.856	82%	0.817	S	S	*	*			trans	94.4	111.5	154.3	0	0	0	0	0	113.5
9	G	33.3	Very low	40.6	Very low	73 Å²	73	118.3 Å²	118.3	75%	0.753	82%	0.815	S	S	*	*			cis	136.2	169.3	35.3	0	0	0	0	0	108.2
10	P	43.7	Very low	40.9	Very low	141 Å²	141	120.8 Å²	120.8	92%	0.916	82%	0.819	S	S	*	*				-111.5	171.3	-126.5	38.8	-31.4	0	0	0	115.3
11	G	38.5	Very low	41.2	Very low	80 Å²	80	120.5 Å²	120.5	83%	0.825	82%	0.815	S	S	*	*			trans	160.3	87.1	161.5	0	0	0	0	0	116.4
12	A	40.3	Very low	41.2	Very low	96 Å²	96	118.6 Å²	118.6	79%	0.793	80%	0.8	S	S	*	*			trans	-65.6	-175.1	173.9	0	0	0	0	0	113.8
13	P	46	Very low	41.4	Very low	106 Å²	106	117.4 Å²	117.4	69%	0.688	80%	0.797	S	S	*	*			cis	-138	155.8	-1.2	25.4	-0.2	0	0	0	117.6
14	L	43.5	Very low	41.4	Very low	162 Å²	162	120.9 Å²	120.9	85%	0.848	80%	0.801	S	S	*	*				37.6	117.4	128.2	-46.5	166	0	0	0	119.9
15	S	48.1	Very low	41.7	Very low	122 Å²	122	121 Å²	121	85%	0.853	80%	0.802	S	S	*	*				-173.5	156.8	103.4	-99.6	0	0	0	0	112.2
16	P	53.8	Low	41.9	Very low	104 Å²	104	126 Å²	126	68%	0.675	81%	0.81	S	S	*	*			trans	-107.5	178.7	-155.6	37.8	-24	0	0	0	112.4
17	D	42	Very low	42	Very low	141 Å²	141	130.2 Å²	130.2	75%	0.754	81%	0.81	S	S	*	*			trans	106.9	126.1	165.8	-58	-56.2	0	0	0	116
18	E	44.5	Very low	41.8	Very low	174 Å²	174	131.5 Å²	131.5	81%	0.813	81%	0.808	S	S	*	*			trans	76.4	118.8	155.8	-48.8	-139.4	108	0	0	115.3
19	L	38.1	Very low	42.6	Very low	149 Å²	149	135.1 Å²	135.1	78%	0.78	80%	0.803	S	S	*	*			cis	-163.2	130.7	26.9	-85.6	114.3	0	0	0	108.1
20	L	45.8	Very low	43.2	Very low	168 Å²	168	139.6 Å²	139.6	88%	0.88	80%	0.804	S	S	*	*			trans	-135.6	149.2	145.7	-79.2	-173.8	0	0	0	105.2
21	P	48.8	Very low	43.3	Very low	115 Å²	115	141.5 Å²	141.5	75%	0.747	80%	0.801	S	S	*	*			cis	-153.6	172.1	38.4	42.6	-21.9	0	0	0	117.9
22	K	38.9	Very low	43.6	Very low	201 Å²	201	144.6 Å²	144.6	87%	0.874	80%	0.798	S	S	*	*			trans	90.2	113.7	134.5	-148.3	164.2	-176.6	170.3	0	120.3
23	G	36.3	Very low	43.9	Very low	64 Å²	64	148.6 Å²	148.6	66%	0.66	80%	0.8	S	S	*	*				96.2	83.2	118	0	0	0	0	0	117.1	A25	G23-A25 PolarHBondContact O-N 3.35Å
24	D	37	Very low	44.3	Very low	178 Å²	178	152.4 Å²	152.4	95%	0.952	81%	0.808	S	S	*	*			trans	-84.6	95.6	169.2	-55.7	-63.4	0	0	0	110.3
25	A	42.7	Very low	44.8	Very low	98 Å²	98	153.8 Å²	153.8	81%	0.81	81%	0.81	S	S	*	*			trans	-93.1	125.3	157.5	0	0	0	0	0	107.8	G23 K27	G23-A25 PolarHBondContact O-N 3.35Å; A25-K27 PolarHBondContact O-N 3.26Å
26	E	43.3	Very low	45.2	Very low	194 Å²	194	155.4 Å²	155.4	91%	0.907	81%	0.809	S	S	*	*			trans	-65.8	102.2	-175.3	-169.3	177.7	107.1	0	0	112	T28	E26-T28 PolarHBondContact O-N 2.98Å
27	K	41.6	Very low	45.2	Very low	186 Å²	186	156.6 Å²	156.6	81%	0.809	81%	0.81	S	S	*	*			trans	-6.3	105.9	151.5	-163.4	173.3	-176.7	-178.1	0	116.8	A25	A25-K27 PolarHBondContact O-N 3.26Å
28	T	37.5	Very low	45.9	Very low	126 Å²	126	159.7 Å²	159.7	77%	0.773	82%	0.82	S	S	*	*			trans	-94.6	111	144	-54.8	0	0	0	0	106.7	E26 E30	E26-T28 PolarHBondContact O-N 2.98Å; T28-E30 PolarHBondContact O-N 2.88Å
29	E	50.4	Low	46.2	Very low	160 Å²	160	158.6 Å²	158.6	75%	0.748	82%	0.815	S	S	*	*			trans	-33	94.5	158.4	53.1	-145.8	117.6	0	0	114.8
30	E	45.8	Very low	47.1	Very low	167 Å²	167	157.1 Å²	157.1	78%	0.78	81%	0.807	S	S	*	*			trans	-129.8	82.2	146.6	-76.3	-169.4	160.2	0	0	106.9	T28 L32	T28-E30 PolarHBondContact O-N 2.88Å; E30-L32 VanDerWaalsContact C-N 3.27Å; E30-L32 PolarHBondContact O-N 2.86Å; E30-L32 VanDerWaalsContact O-N 3.08Å
31	E	46.9	Very low	47.9	Very low	181 Å²	181	154.1 Å²	154.1	85%	0.846	79%	0.792	S	S	*	*			trans	-64.8	90.7	159.5	-157.1	174.7	130	0	0	106.4
32	L	44.4	Very low	48.5	Very low	145 Å²	145	154.2 Å²	154.2	76%	0.759	78%	0.783	S	S	*	*			trans	-116	90.3	162.9	-76.9	169.3	0	0	0	105.8	E30 E34	E30-L32 VanDerWaalsContact C-N 3.27Å; E30-L32 PolarHBondContact O-N 2.86Å; E30-L32 VanDerWaalsContact O-N 3.08Å; L32-E34 PolarHBondContact O-N 3.38Å; L32-E34 VanDerWaalsContact O-N 3.07Å
33	E	45.8	Very low	50.4	Low	180 Å²	180	146.8 Å²	146.8	84%	0.841	75%	0.754	S	S	*	*			trans	-17.1	100.3	166.1	-66.6	162.7	163.7	0	0	112.7
34	E	54.2	Low	52.3	Low	185 Å²	185	150.1 Å²	150.1	86%	0.864	76%	0.756	S	S	*	*			trans	-75.9	136	155	-89.4	-179.8	151.3	0	0	107.7	L32	L32-E34 PolarHBondContact O-N 3.38Å; L32-E34 VanDerWaalsContact O-N 3.07Å
35	E	54.5	Low	54.2	Low	191 Å²	191	145.6 Å²	145.6	89%	0.893	74%	0.738	S	S	*	*			trans	72.4	84.7	168	-63.6	-179.6	143.5	0	0	117.4
36	D	56.4	Low	55.8	Low	156 Å²	156	146.4 Å²	146.4	83%	0.834	73%	0.725	S	S	*	*			trans	-161.8	58.2	135.4	-145.7	14.8	0	0	0	114.6
37	D	55	Low	57.5	Low	129 Å²	129	143.2 Å²	143.2	69%	0.69	71%	0.705	S	S	*	*			trans	-131	31.8	174.9	-85.6	-22.5	0	0	0	112.6	E39 L40	D37-E39 PolarHBondContact O-N 3.41Å; D37-E39 VanDerWaalsContact O-N 3.14Å; D37-L40 PolarHBondContact O-N 2.87Å
38	E	56.7	Low	59.2	Low	207 Å²	207	139.9 Å²	139.9	97%	0.967	70%	0.695	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.4	2.7	165.1	-71.9	-176.3	156.8	0	0	112.5
39	E	51.3	Low	61.1	Low	151 Å²	151	141.9 Å²	141.9	71%	0.706	69%	0.689	S	S	*	*	T	Hydrogen-bonded Turn	trans	-114.4	39.6	175.1	-151.3	174.4	-134.9	0	0	110.9	D37 D41	D37-E39 PolarHBondContact O-N 3.41Å; D37-E39 VanDerWaalsContact O-N 3.14Å; E39-D41 PolarHBondContact O-N 2.85Å
40	L	56.5	Low	62.5	Low	118 Å²	118	135.7 Å²	135.7	62%	0.618	67%	0.668	S	S	*	*			trans	-67.4	69.2	154.1	-77	174.6	0	0	0	108.8	D37 E42	D37-L40 PolarHBondContact O-N 2.87Å; L40-E42 PolarHBondContact O-N 3.11Å
41	D	62.2	Low	63.8	Low	105 Å²	105	132.1 Å²	132.1	56%	0.561	65%	0.654	S	S	*	*			trans	-51.4	104.3	171.6	-80.2	-26.8	0	0	0	109.4	E39 R47	E39-D41 PolarHBondContact O-N 2.85Å; D41-R47 PolarHBondContact O-NH2 3.07Å
42	E	60.4	Low	65.1	Low	117 Å²	117	125.1 Å²	125.1	55%	0.547	62%	0.623	S	S	.	*	S	Bend	trans	60.3	108.7	-171.8	-49.6	165.6	166	0	0	111.8	L40 L44 R47	L40-E42 PolarHBondContact O-N 3.11Å; E42-L44 PolarHBondContact O-N 3.38Å; E42-R47 HydrophobicContact CB-CG 4.11Å; E42-R47 IonicContact OE2-CZ 3.24Å; E42-R47 VanDerWaalsContact OE2-CZ 3.24Å; E42-R47 IonicContact OE2-NE 2.78Å; E42-R47 PolarHBondContact OE2-NE 3.43Å; E42-R47 IonicContact OE2-NH2 2.82Å; E42-R47 PolarHBondContact OE2-NH2 2.8Å
43	T	80.6	Confident	66.7	Low	45 Å²	45	125 Å²	125	28%	0.276	62%	0.619	S	S	.	*			trans	-55.7	139.5	-179.4	63.6	0	0	0	0	110.1	S45 E46 R47	T43-S45 WeakPolarHBondContact CB-OG 3.49Å; T43-S45 CarbonylContact O-C 3.48Å; T43-S45 PolarHBondContact O-N 3.41Å; T43-S45 PolarHBondContact OG1-OG 2.9Å; T43-E46 WeakPolarHBondContact CG2-OE1 3.06Å; T43-E46 WeakPolarHBondContact O-CA 3.31Å; T43-E46 WeakPolarHBondContact O-CB 3.32Å; T43-E46 PolarHBondContact O-N 3.46Å; T43-E46 WeakPolarHBondContact OG1-CB 3.38Å; T43-E46 WeakPolarHBondContact OG1-CG 3.02Å; T43-E46 PolarHBondContact OG1-N 3.11Å; T43-E46 PolarHBondContact OG1-OE1 2.98Å; T43-R47 PolarHBondContact O-N 2.88Å
44	L	75.6	Confident	68.2	Low	134 Å²	134	124.2 Å²	124.2	70%	0.702	62%	0.617	S	S	*	*	H	α-helix	trans	-52.7	-30.1	174.7	-70.8	178.5	0	0	0	110.9	E42 L48	E42-L44 PolarHBondContact O-N 3.38Å; L44-L48 WeakPolarHBondContact O-CB 3.36Å; L44-L48 PolarHBondContact O-N 2.66Å
45	S	75.8	Confident	69	Low	82 Å²	82	120.1 Å²	120.1	57%	0.573	60%	0.597	S	S	*	*	H	α-helix	trans	-61.2	-45.9	168.5	36.6	0	0	0	0	114.1	T43 L48 W49	T43-S45 WeakPolarHBondContact CB-OG 3.49Å; T43-S45 CarbonylContact O-C 3.48Å; T43-S45 PolarHBondContact O-N 3.41Å; T43-S45 PolarHBondContact OG1-OG 2.9Å; S45-L48 PolarHBondContact O-N 2.82Å; S45-W49 WeakPolarHBondContact O-CA 3.49Å; S45-W49 WeakPolarHBondContact O-CB 3.19Å; S45-W49 PolarHBondContact O-N 2.78Å
46	E	77.8	Confident	70	Confident	116 Å²	116	115 Å²	115	54%	0.542	58%	0.58	S	S	.	*	H	α-helix	trans	-64.6	-41.6	175.3	-79.7	156.1	-131.4	0	0	112.1	T43 W49 G50	T43-E46 WeakPolarHBondContact CG2-OE1 3.06Å; T43-E46 WeakPolarHBondContact O-CA 3.31Å; T43-E46 WeakPolarHBondContact O-CB 3.32Å; T43-E46 PolarHBondContact O-N 3.46Å; T43-E46 WeakPolarHBondContact OG1-CB 3.38Å; T43-E46 WeakPolarHBondContact OG1-CG 3.02Å; T43-E46 PolarHBondContact OG1-N 3.11Å; T43-E46 PolarHBondContact OG1-OE1 2.98Å; E46-W49 PolarHBondContact O-N 3.36Å; E46-G50 PolarHBondContact O-N 2.9Å
47	R	78.7	Confident	70.8	Confident	126 Å²	126	114.7 Å²	114.7	48%	0.475	57%	0.573	S	S	.	*	H	α-helix	trans	-65	-45.3	175.2	-71.2	-175.5	173.5	146.7	10.8	111.8	D41 E42 T43 W49 L51	D41-R47 PolarHBondContact O-NH2 3.07Å; E42-R47 HydrophobicContact CB-CG 4.11Å; E42-R47 IonicContact OE2-CZ 3.24Å; E42-R47 VanDerWaalsContact OE2-CZ 3.24Å; E42-R47 IonicContact OE2-NE 2.78Å; E42-R47 PolarHBondContact OE2-NE 3.43Å; E42-R47 IonicContact OE2-NH2 2.82Å; E42-R47 PolarHBondContact OE2-NH2 2.8Å; T43-R47 PolarHBondContact O-N 2.88Å; R47-W49 VanDerWaalsContact C-N 3.29Å; R47-W49 PolarHBondContact O-N 3.28Å; R47-L51 WeakPolarHBondContact O-CB 3.28Å; R47-L51 PolarHBondContact O-N 3.26Å
48	L	76.3	Confident	71.6	Confident	116 Å²	116	118.9 Å²	118.9	61%	0.607	58%	0.58	S	S	*	*	H	α-helix	trans	-64.6	-39.7	176.8	-154.4	75.8	0	0	0	110.2	L44 S45 T52	L44-L48 WeakPolarHBondContact O-CB 3.36Å; L44-L48 PolarHBondContact O-N 2.66Å; S45-L48 PolarHBondContact O-N 2.82Å; L48-T52 WeakPolarHBondContact O-CB 3.21Å; L48-T52 WeakPolarHBondContact O-CG2 3.32Å; L48-T52 PolarHBondContact O-N 3.27Å; L48-T52 PolarHBondContact O-OG1 2.97Å; L48-T52 VanDerWaalsContact O-OG1 3.07Å
49	W	78.3	Confident	72.5	Confident	168 Å²	168	112.6 Å²	112.6	64%	0.636	56%	0.555	S	S	*	*	H	α-helix	trans	-64.3	-50.9	176.9	-172.6	-99.6	0	0	0	111.8	S45 E46 R47 L51 T52 E53	S45-W49 WeakPolarHBondContact O-CA 3.49Å; S45-W49 WeakPolarHBondContact O-CB 3.19Å; S45-W49 PolarHBondContact O-N 2.78Å; E46-W49 PolarHBondContact O-N 3.36Å; R47-W49 VanDerWaalsContact C-N 3.29Å; R47-W49 PolarHBondContact O-N 3.28Å; W49-L51 VanDerWaalsContact C-N 3.35Å; W49-L51 PolarHBondContact O-N 2.87Å; W49-T52 WeakPolarHBondContact CA-OG1 3.43Å; W49-T52 CarbonylContact O-C 3.59Å; W49-T52 WeakPolarHBondContact O-CA 3.39Å; W49-T52 PolarHBondContact O-N 3.33Å; W49-T52 VanDerWaalsContact O-N 3.11Å; W49-T52 PolarHBondContact O-OG1 2.88Å; W49-E53 PolarHBondContact O-N 2.9Å
50	G	79.5	Confident	73.9	Confident	30 Å²	30	109.6 Å²	109.6	31%	0.309	54%	0.538	S	S	.	.	H	α-helix	trans	-62.8	-38.5	176.4	0	0	0	0	0	112.9	E46 T52 E53 M54	E46-G50 PolarHBondContact O-N 2.9Å; G50-T52 VanDerWaalsContact C-N 3.32Å; G50-T52 PolarHBondContact O-N 3.5Å; G50-E53 VanDerWaalsContact O-CB 3.28Å; G50-E53 WeakPolarHBondContact O-CB 3.32Å; G50-E53 PolarHBondContact O-N 2.75Å; G50-E53 VanDerWaalsContact O-N 3.11Å; G50-M54 PolarHBondContact O-N 3.36Å
51	L	74.1	Confident	74.9	Confident	93 Å²	93	108 Å²	108	49%	0.487	54%	0.536	S	S	.	.	H	α-helix	trans	-64.3	-39.3	173.5	-167.6	73.1	0	0	0	111.3	R47 W49 E53 M54 F55	R47-L51 WeakPolarHBondContact O-CB 3.28Å; R47-L51 PolarHBondContact O-N 3.26Å; W49-L51 VanDerWaalsContact C-N 3.35Å; W49-L51 PolarHBondContact O-N 2.87Å; L51-E53 PolarHBondContact O-N 2.88Å; L51-M54 PolarHBondContact O-N 2.67Å; L51-F55 HydrophobicContact CD1-CE2 4.31Å; L51-F55 HydrophobicContact CD2-CE2 4.03Å; L51-F55 HydrophobicContact CG-CD2 4.41Å; L51-F55 HydrophobicContact CG-CE2 3.65Å; L51-F55 HydrophobicContact CG-CZ 4.33Å; L51-F55 WeakPolarHBondContact O-CD2 3.43Å; L51-F55 WeakPolarHBondContact O-CE2 3.36Å
52	T	73.3	Confident	75.8	Confident	33 Å²	33	105.6 Å²	105.6	20%	0.202	53%	0.531	C	S	.	.	H	α-helix	trans	-71.6	-15.4	174.6	63.6	0	0	0	0	114.2	L48 W49 G50 R60	L48-T52 WeakPolarHBondContact O-CB 3.21Å; L48-T52 WeakPolarHBondContact O-CG2 3.32Å; L48-T52 PolarHBondContact O-N 3.27Å; L48-T52 PolarHBondContact O-OG1 2.97Å; L48-T52 VanDerWaalsContact O-OG1 3.07Å; W49-T52 WeakPolarHBondContact CA-OG1 3.43Å; W49-T52 CarbonylContact O-C 3.59Å; W49-T52 WeakPolarHBondContact O-CA 3.39Å; W49-T52 PolarHBondContact O-N 3.33Å; W49-T52 VanDerWaalsContact O-N 3.11Å; W49-T52 PolarHBondContact O-OG1 2.88Å; G50-T52 VanDerWaalsContact C-N 3.32Å; G50-T52 PolarHBondContact O-N 3.5Å; T52-R60 VanDerWaalsContact CB-NH2 3.27Å; T52-R60 VanDerWaalsContact O-CZ 3.29Å; T52-R60 PolarHBondContact O-NH1 3.13Å; T52-R60 PolarHBondContact OG1-NH2 2.77Å
53	E	77.1	Confident	76.9	Confident	143 Å²	143	102.6 Å²	102.6	67%	0.668	53%	0.526	S	S	*	.	H	α-helix	trans	-78.4	-25	172.4	-153.1	167.9	-177.2	0	0	112.1	W49 G50 L51	W49-E53 PolarHBondContact O-N 2.9Å; G50-E53 VanDerWaalsContact O-CB 3.28Å; G50-E53 WeakPolarHBondContact O-CB 3.32Å; G50-E53 PolarHBondContact O-N 2.75Å; G50-E53 VanDerWaalsContact O-N 3.11Å; L51-E53 PolarHBondContact O-N 2.88Å
54	M	77.3	Confident	77	Confident	164 Å²	164	101.9 Å²	101.9	81%	0.808	53%	0.527	S	S	*	.	S	Bend	trans	-81.9	-12.4	171.8	-61.6	-171.5	92.7	0	0	113.7	G50 L51	G50-M54 PolarHBondContact O-N 3.36Å; L51-M54 PolarHBondContact O-N 2.67Å
55	F	71.6	Confident	77.5	Confident	99 Å²	99	98.2 Å²	98.2	43%	0.434	52%	0.516	S	S	.	.	S	Bend	trans	-97.9	135.7	-178	-69.3	-57.8	0	0	0	112.7	L51 V59	L51-F55 HydrophobicContact CD1-CE2 4.31Å; L51-F55 HydrophobicContact CD2-CE2 4.03Å; L51-F55 HydrophobicContact CG-CD2 4.41Å; L51-F55 HydrophobicContact CG-CE2 3.65Å; L51-F55 HydrophobicContact CG-CZ 4.33Å; L51-F55 WeakPolarHBondContact O-CD2 3.43Å; L51-F55 WeakPolarHBondContact O-CE2 3.36Å; F55-V59 HydrophobicContact CB-CB 4.5Å
56	P	75.3	Confident	78.1	Confident	82 Å²	82	98.6 Å²	98.6	53%	0.532	52%	0.515	S	S	.	.			trans	-66.6	149.9	179.7	24.6	-31.1	0	0	0	112.3	R58 V59	P56-R58 PolarHBondContact O-N 3.48Å; P56-V59 HydrophobicContact CG-CG2 3.99Å; P56-V59 PolarHBondContact O-N 2.99Å
57	E	74.2	Confident	78.7	Confident	150 Å²	150	99.6 Å²	99.6	70%	0.701	52%	0.518	S	S	*	.	H	α-helix	trans	-43.5	-35.2	179.2	-108.4	73.4	-157	0	0	114.3	V59 R60 S61	E57-V59 VanDerWaalsContact C-N 3.32Å; E57-V59 PolarHBondContact O-N 2.78Å; E57-R60 PolarHBondContact O-N 3.49Å; E57-S61 WeakPolarHBondContact O-CB 3.5Å; E57-S61 PolarHBondContact O-N 3.35Å
58	R	70.7	Confident	79.3	Confident	218 Å²	218	98.6 Å²	98.6	82%	0.823	52%	0.522	S	S	*	.	H	α-helix	trans	-64.1	-34.7	-178.8	-61.2	-166	-179.5	-163.2	1.2	112.9	P56 A62	P56-R58 PolarHBondContact O-N 3.48Å; R58-A62 VanDerWaalsContact O-CB 3.31Å; R58-A62 WeakPolarHBondContact O-CB 3.08Å; R58-A62 PolarHBondContact O-N 2.87Å
59	V	76.8	Confident	80	Confident	74 Å²	74	98.2 Å²	98.2	45%	0.448	52%	0.52	S	S	.	.	H	α-helix	trans	-75.4	-41.3	178.4	178.1	0	0	0	0	110.3	F55 P56 E57 A62 A63	F55-V59 HydrophobicContact CB-CB 4.5Å; P56-V59 HydrophobicContact CG-CG2 3.99Å; P56-V59 PolarHBondContact O-N 2.99Å; E57-V59 VanDerWaalsContact C-N 3.32Å; E57-V59 PolarHBondContact O-N 2.78Å; V59-A62 PolarHBondContact O-N 3.34Å; V59-A63 WeakPolarHBondContact O-CB 3.16Å; V59-A63 PolarHBondContact O-N 3.06Å
60	R	79.2	Confident	80.7	Confident	89 Å²	89	93.9 Å²	93.9	34%	0.336	52%	0.516	S	S	.	.	H	α-helix	trans	-61.2	-43.7	172.3	-99.6	176.8	169.2	160.9	-4.6	112.1	T52 E57 A63 G64	T52-R60 VanDerWaalsContact CB-NH2 3.27Å; T52-R60 VanDerWaalsContact O-CZ 3.29Å; T52-R60 PolarHBondContact O-NH1 3.13Å; T52-R60 PolarHBondContact OG1-NH2 2.77Å; E57-R60 PolarHBondContact O-N 3.49Å; R60-A63 PolarHBondContact O-N 2.76Å; R60-G64 PolarHBondContact O-N 2.98Å
61	S	78.1	Confident	81.5	Confident	85 Å²	85	95.1 Å²	95.1	59%	0.594	52%	0.517	S	S	*	.	H	α-helix	trans	-65.4	-40.1	176.8	-179.3	0	0	0	0	111.8	E57 G64 A65	E57-S61 WeakPolarHBondContact O-CB 3.5Å; E57-S61 PolarHBondContact O-N 3.35Å; S61-G64 PolarHBondContact O-N 3Å; S61-A65 VanDerWaalsContact O-CB 3.32Å; S61-A65 WeakPolarHBondContact O-CB 3.17Å; S61-A65 PolarHBondContact O-N 3.43Å
62	A	80.6	Confident	82.4	Confident	53 Å²	53	96.3 Å²	96.3	44%	0.438	52%	0.519	S	S	.	.	H	α-helix	trans	-64.8	-43.8	173.7	0	0	0	0	0	112	R58 V59 A65 T66	R58-A62 VanDerWaalsContact O-CB 3.31Å; R58-A62 WeakPolarHBondContact O-CB 3.08Å; R58-A62 PolarHBondContact O-N 2.87Å; V59-A62 PolarHBondContact O-N 3.34Å; A62-A65 PolarHBondContact O-N 3.14Å; A62-T66 WeakPolarHBondContact O-CG2 3.43Å; A62-T66 PolarHBondContact O-N 2.88Å; A62-T66 PolarHBondContact O-OG1 2.82Å
63	A	83.3	Confident	83.5	Confident	54 Å²	54	97.9 Å²	97.9	45%	0.446	53%	0.528	S	S	.	.	H	α-helix	trans	-61.1	-45.7	176.2	0	0	0	0	0	111.6	V59 R60 T66 F67	V59-A63 WeakPolarHBondContact O-CB 3.16Å; V59-A63 PolarHBondContact O-N 3.06Å; R60-A63 PolarHBondContact O-N 2.76Å; A63-T66 WeakPolarHBondContact CA-OG1 3.26Å; A63-T66 PolarHBondContact O-N 2.88Å; A63-T66 PolarHBondContact O-OG1 3.43Å; A63-F67 WeakPolarHBondContact O-CB 3.41Å; A63-F67 PolarHBondContact O-N 2.81Å
64	G	83.2	Confident	84.4	Confident	30 Å²	30	93.8 Å²	93.8	31%	0.309	52%	0.518	S	S	.	.	H	α-helix	trans	-58.7	-46.8	172.7	0	0	0	0	0	112.1	R60 S61 T66 F67 D68	R60-G64 PolarHBondContact O-N 2.98Å; S61-G64 PolarHBondContact O-N 3Å; G64-T66 VanDerWaalsContact C-N 3.33Å; G64-T66 PolarHBondContact O-N 3.35Å; G64-F67 WeakPolarHBondContact O-CB 3.46Å; G64-F67 PolarHBondContact O-N 3.42Å; G64-F67 VanDerWaalsContact O-N 3.13Å; G64-D68 WeakPolarHBondContact O-CB 3.46Å; G64-D68 VanDerWaalsContact O-CG 3.31Å; G64-D68 PolarHBondContact O-N 2.85Å
65	A	86.4	Confident	85.2	Confident	57 Å²	57	91.7 Å²	91.7	47%	0.471	51%	0.507	S	S	.	.	H	α-helix	trans	-62.3	-37.6	177.5	0	0	0	0	0	112.7	S61 A62 L69	S61-A65 VanDerWaalsContact O-CB 3.32Å; S61-A65 WeakPolarHBondContact O-CB 3.17Å; S61-A65 PolarHBondContact O-N 3.43Å; A62-A65 PolarHBondContact O-N 3.14Å; A65-L69 WeakPolarHBondContact O-CB 3.41Å; A65-L69 PolarHBondContact O-N 3.14Å
66	T	89.3	Confident	86.3	Confident	90 Å²	90	93.6 Å²	93.6	55%	0.552	52%	0.515	S	S	*	.	H	α-helix	trans	-70.3	-36.2	174.7	55.6	0	0	0	0	112.4	A62 A63 G64 S70	A62-T66 WeakPolarHBondContact O-CG2 3.43Å; A62-T66 PolarHBondContact O-N 2.88Å; A62-T66 PolarHBondContact O-OG1 2.82Å; A63-T66 WeakPolarHBondContact CA-OG1 3.26Å; A63-T66 PolarHBondContact O-N 2.88Å; A63-T66 PolarHBondContact O-OG1 3.43Å; G64-T66 VanDerWaalsContact C-N 3.33Å; G64-T66 PolarHBondContact O-N 3.35Å; T66-S70 WeakPolarHBondContact O-CB 3.41Å; T66-S70 PolarHBondContact O-N 3.19Å
67	F	90.4	Very high	87.2	Confident	137 Å²	137	95.7 Å²	95.7	60%	0.601	52%	0.519	S	S	*	.	H	α-helix	trans	-65.7	-47.9	174.7	-176.4	-97.5	0	0	0	110.8	A63 G64 L69 S70 V71	A63-F67 WeakPolarHBondContact O-CB 3.41Å; A63-F67 PolarHBondContact O-N 2.81Å; G64-F67 WeakPolarHBondContact O-CB 3.46Å; G64-F67 PolarHBondContact O-N 3.42Å; G64-F67 VanDerWaalsContact O-N 3.13Å; F67-L69 VanDerWaalsContact C-N 3.33Å; F67-L69 PolarHBondContact O-N 3.05Å; F67-S70 WeakPolarHBondContact O-CB 3.37Å; F67-S70 PolarHBondContact O-N 3.44Å; F67-S70 VanDerWaalsContact O-N 3.14Å; F67-V71 HydrophobicContact CD1-CG2 4.16Å; F67-V71 HydrophobicContact CE1-CG2 3.82Å; F67-V71 HydrophobicContact CZ-CG2 4.03Å; F67-V71 WeakPolarHBondContact O-CG2 3.22Å; F67-V71 PolarHBondContact O-N 2.93Å
68	D	90.6	Very high	88.3	Confident	106 Å²	106	95.7 Å²	95.7	57%	0.567	51%	0.514	S	S	*	.	H	α-helix	trans	-61.8	-41.1	176.2	-69.8	-24.8	0	0	0	111.7	G64 V71 F72	G64-D68 WeakPolarHBondContact O-CB 3.46Å; G64-D68 VanDerWaalsContact O-CG 3.31Å; G64-D68 PolarHBondContact O-N 2.85Å; D68-V71 PolarHBondContact O-N 2.81Å; D68-F72 WeakPolarHBondContact O-CB 3.32Å; D68-F72 PolarHBondContact O-N 2.77Å
69	L	91.4	Very high	89.4	Confident	108 Å²	108	93.5 Å²	93.5	57%	0.565	51%	0.505	S	S	*	.	H	α-helix	trans	-61.9	-44	173.8	-179.8	65	0	0	0	111.2	A65 F67 F72 V73	A65-L69 WeakPolarHBondContact O-CB 3.41Å; A65-L69 PolarHBondContact O-N 3.14Å; F67-L69 VanDerWaalsContact C-N 3.33Å; F67-L69 PolarHBondContact O-N 3.05Å; L69-F72 PolarHBondContact O-N 2.82Å; L69-V73 HydrophobicContact CD1-CG2 4.35Å; L69-V73 WeakPolarHBondContact O-CB 3.31Å; L69-V73 VanDerWaalsContact O-CG2 3.26Å; L69-V73 WeakPolarHBondContact O-CG2 3.49Å; L69-V73 PolarHBondContact O-N 3.44Å
70	S	93.2	Very high	90.3	Very high	77 Å²	77	97 Å²	97	54%	0.538	52%	0.515	S	S	.	.	H	α-helix	trans	-61.2	-48	177	-174.2	0	0	0	0	111.1	T66 F67 F72 V73 A74	T66-S70 WeakPolarHBondContact O-CB 3.41Å; T66-S70 PolarHBondContact O-N 3.19Å; F67-S70 WeakPolarHBondContact O-CB 3.37Å; F67-S70 PolarHBondContact O-N 3.44Å; F67-S70 VanDerWaalsContact O-N 3.14Å; S70-F72 VanDerWaalsContact C-N 3.34Å; S70-F72 PolarHBondContact O-N 3.48Å; S70-V73 PolarHBondContact O-N 3.47Å; S70-A74 VanDerWaalsContact O-CB 3.32Å; S70-A74 WeakPolarHBondContact O-CB 3.35Å; S70-A74 PolarHBondContact O-N 3.38Å
71	V	94.9	Very high	91.1	Very high	56 Å²	56	96 Å²	96	34%	0.339	52%	0.521	S	S	.	.	H	α-helix	trans	-61.9	-42.3	176.7	173	0	0	0	0	110.9	F67 D68 A74 Q75	F67-V71 HydrophobicContact CD1-CG2 4.16Å; F67-V71 HydrophobicContact CE1-CG2 3.82Å; F67-V71 HydrophobicContact CZ-CG2 4.03Å; F67-V71 WeakPolarHBondContact O-CG2 3.22Å; F67-V71 PolarHBondContact O-N 2.93Å; D68-V71 PolarHBondContact O-N 2.81Å; V71-A74 PolarHBondContact O-N 2.84Å; V71-Q75 HydrophobicContact CG1-CG 4.42Å; V71-Q75 WeakPolarHBondContact O-CB 3.46Å; V71-Q75 WeakPolarHBondContact O-CG 3.18Å; V71-Q75 PolarHBondContact O-N 3.29Å
72	F	94.3	Very high	91.9	Very high	118 Å²	118	98.7 Å²	98.7	52%	0.518	52%	0.519	S	S	.	.	H	α-helix	trans	-62.4	-45.1	176.9	177.5	-98.8	0	0	0	112	D68 L69 S70 Q75 K76	D68-F72 WeakPolarHBondContact O-CB 3.32Å; D68-F72 PolarHBondContact O-N 2.77Å; L69-F72 PolarHBondContact O-N 2.82Å; S70-F72 VanDerWaalsContact C-N 3.34Å; S70-F72 PolarHBondContact O-N 3.48Å; F72-Q75 PolarHBondContact O-N 3.44Å; F72-K76 HydrophobicContact CE1-CD 4.17Å; F72-K76 HydrophobicContact CZ-CD 4.27Å; F72-K76 VanDerWaalsContact O-CB 3.31Å; F72-K76 WeakPolarHBondContact O-CB 3.38Å; F72-K76 PolarHBondContact O-N 3.07Å
73	V	95.3	Very high	92.7	Very high	66 Å²	66	98.4 Å²	98.4	40%	0.4	52%	0.516	S	S	.	.	H	α-helix	trans	-63.9	-45.8	176.5	170.6	0	0	0	0	110.5	L69 S70 Q75 K76 M77	L69-V73 HydrophobicContact CD1-CG2 4.35Å; L69-V73 WeakPolarHBondContact O-CB 3.31Å; L69-V73 VanDerWaalsContact O-CG2 3.26Å; L69-V73 WeakPolarHBondContact O-CG2 3.49Å; L69-V73 PolarHBondContact O-N 3.44Å; S70-V73 PolarHBondContact O-N 3.47Å; V73-Q75 PolarHBondContact O-N 2.85Å; V73-K76 PolarHBondContact O-N 3.08Å; V73-M77 HydrophobicContact CG1-CE 4.39Å; V73-M77 WeakPolarHBondContact O-CB 3.31Å; V73-M77 PolarHBondContact O-N 2.75Å
74	A	95.4	Very high	93.3	Very high	56 Å²	56	97.9 Å²	97.9	46%	0.463	51%	0.512	S	S	.	.	H	α-helix	trans	-60.2	-46	177.8	0	0	0	0	0	111.5	S70 V71 K76 M77 Y78	S70-A74 VanDerWaalsContact O-CB 3.32Å; S70-A74 WeakPolarHBondContact O-CB 3.35Å; S70-A74 PolarHBondContact O-N 3.38Å; V71-A74 PolarHBondContact O-N 2.84Å; A74-K76 VanDerWaalsContact C-N 3.33Å; A74-K76 PolarHBondContact O-N 3.41Å; A74-M77 PolarHBondContact O-N 2.78Å; A74-Y78 VanDerWaalsContact O-CB 3.31Å; A74-Y78 WeakPolarHBondContact O-CB 3.34Å; A74-Y78 PolarHBondContact O-N 3.37Å
75	Q	94.7	Very high	93.9	Very high	121 Å²	121	102.4 Å²	102.4	57%	0.565	53%	0.528	S	S	*	.	H	α-helix	trans	-61.7	-41.3	175.2	-77.9	-175.5	-13.2	0	0	111.9	V71 F72 V73 Y78 R79	V71-Q75 HydrophobicContact CG1-CG 4.42Å; V71-Q75 WeakPolarHBondContact O-CB 3.46Å; V71-Q75 WeakPolarHBondContact O-CG 3.18Å; V71-Q75 PolarHBondContact O-N 3.29Å; F72-Q75 PolarHBondContact O-N 3.44Å; V73-Q75 PolarHBondContact O-N 2.85Å; Q75-Y78 PolarHBondContact O-N 2.93Å; Q75-R79 WeakPolarHBondContact O-CB 3.32Å; Q75-R79 VanDerWaalsContact O-CG 3.3Å; Q75-R79 WeakPolarHBondContact O-CG 3.14Å; Q75-R79 PolarHBondContact O-N 3.48Å
76	K	94.7	Very high	94.4	Very high	138 Å²	138	108.8 Å²	108.8	60%	0.6	54%	0.54	S	S	*	.	H	α-helix	trans	-69	-42.2	179.9	-166.2	164.1	-178.5	173.1	0	111.9	F72 V73 A74 R79 F80	F72-K76 HydrophobicContact CE1-CD 4.17Å; F72-K76 HydrophobicContact CZ-CD 4.27Å; F72-K76 VanDerWaalsContact O-CB 3.31Å; F72-K76 WeakPolarHBondContact O-CB 3.38Å; F72-K76 PolarHBondContact O-N 3.07Å; V73-K76 PolarHBondContact O-N 3.08Å; A74-K76 VanDerWaalsContact C-N 3.33Å; A74-K76 PolarHBondContact O-N 3.41Å; K76-R79 PolarHBondContact O-N 2.76Å; K76-F80 VanDerWaalsContact O-CB 3.28Å; K76-F80 WeakPolarHBondContact O-CB 3.33Å; K76-F80 PolarHBondContact O-N 3.23Å
77	M	95.4	Very high	94.7	Very high	127 Å²	127	109.3 Å²	109.3	63%	0.626	54%	0.539	S	S	*	.	H	α-helix	trans	-60.9	-45.9	171.2	-87	-174.4	-177	0	0	111.1	V73 A74 R79 F80 S81	V73-M77 HydrophobicContact CG1-CE 4.39Å; V73-M77 WeakPolarHBondContact O-CB 3.31Å; V73-M77 PolarHBondContact O-N 2.75Å; A74-M77 PolarHBondContact O-N 2.78Å; M77-R79 PolarHBondContact O-N 3.46Å; M77-F80 PolarHBondContact O-N 2.89Å; M77-S81 WeakPolarHBondContact O-CB 3.38Å; M77-S81 PolarHBondContact O-N 3.42Å; M77-S81 PolarHBondContact O-OG 2.84Å; M77-S81 VanDerWaalsContact O-OG 3.05Å
78	Y	95.9	Very high	95	Very high	150 Å²	150	104.6 Å²	104.6	59%	0.588	53%	0.529	S	S	*	.	H	α-helix	trans	-59.5	-46.7	178.4	177.9	-100.7	0	0	0	111.9	A74 Q75 S81 R82	A74-Y78 VanDerWaalsContact O-CB 3.31Å; A74-Y78 WeakPolarHBondContact O-CB 3.34Å; A74-Y78 PolarHBondContact O-N 3.37Å; Q75-Y78 PolarHBondContact O-N 2.93Å; Y78-S81 PolarHBondContact O-N 3.45Å; Y78-R82 WeakPolarHBondContact O-CB 3.28Å; Y78-R82 PolarHBondContact O-N 3.05Å
79	R	94.1	Very high	95.3	Very high	172 Å²	172	103.3 Å²	103.3	65%	0.649	53%	0.525	S	S	*	.	H	α-helix	trans	-64.6	-40.5	177	-69.6	-175.1	79.3	106.4	2.3	112.1	Q75 K76 M77 A83	Q75-R79 WeakPolarHBondContact O-CB 3.32Å; Q75-R79 VanDerWaalsContact O-CG 3.3Å; Q75-R79 WeakPolarHBondContact O-CG 3.14Å; Q75-R79 PolarHBondContact O-N 3.48Å; K76-R79 PolarHBondContact O-N 2.76Å; M77-R79 PolarHBondContact O-N 3.46Å; R79-A83 WeakPolarHBondContact O-CB 3.5Å; R79-A83 PolarHBondContact O-N 3.11Å
80	F	95.7	Very high	95.5	Very high	146 Å²	146	100.8 Å²	100.8	64%	0.64	51%	0.514	S	S	*	.	H	α-helix	trans	-64.3	-50.3	176.2	177.5	-95.3	0	0	0	111.4	K76 M77 R82 A83 A84	K76-F80 VanDerWaalsContact O-CB 3.28Å; K76-F80 WeakPolarHBondContact O-CB 3.33Å; K76-F80 PolarHBondContact O-N 3.23Å; M77-F80 PolarHBondContact O-N 2.89Å; F80-R82 VanDerWaalsContact C-N 3.3Å; F80-R82 PolarHBondContact O-N 2.66Å; F80-A83 CarbonylContact O-C 3.52Å; F80-A83 PolarHBondContact O-N 3.03Å; F80-A83 VanDerWaalsContact O-N 3.11Å; F80-A84 HydrophobicContact CE1-CB 4.24Å; F80-A84 HydrophobicContact CZ-CB 4.48Å; F80-A84 VanDerWaalsContact O-CB 3.32Å; F80-A84 WeakPolarHBondContact O-CB 3.14Å; F80-A84 PolarHBondContact O-N 2.84Å
81	S	96.1	Very high	95.6	Very high	68 Å²	68	99.7 Å²	99.7	48%	0.476	51%	0.506	S	S	.	.	H	α-helix	trans	-58.1	-43.4	177.6	-65.5	0	0	0	0	111.2	M77 Y78 A83 A84 L85	M77-S81 WeakPolarHBondContact O-CB 3.38Å; M77-S81 PolarHBondContact O-N 3.42Å; M77-S81 PolarHBondContact O-OG 2.84Å; M77-S81 VanDerWaalsContact O-OG 3.05Å; Y78-S81 PolarHBondContact O-N 3.45Å; S81-A83 PolarHBondContact O-N 2.94Å; S81-A84 PolarHBondContact O-N 3.29Å; S81-L85 WeakPolarHBondContact O-CB 3.3Å; S81-L85 PolarHBondContact O-N 3.4Å
82	R	95.9	Very high	95.6	Very high	143 Å²	143	103.4 Å²	103.4	54%	0.54	52%	0.518	S	S	.	.	H	α-helix	trans	-62.1	-42.8	175.8	-169.3	174	74.1	175.5	6.1	112.2	Y78 F80 W86	Y78-R82 WeakPolarHBondContact O-CB 3.28Å; Y78-R82 PolarHBondContact O-N 3.05Å; F80-R82 VanDerWaalsContact C-N 3.3Å; F80-R82 PolarHBondContact O-N 2.66Å; R82-W86 WeakPolarHBondContact O-CB 3.42Å; R82-W86 PolarHBondContact O-N 3.44Å
83	A	95.6	Very high	95.6	Very high	46 Å²	46	103.1 Å²	103.1	38%	0.38	52%	0.52	S	S	.	.	H	α-helix	trans	-66.8	-46.6	176.9	0	0	0	0	0	111.8	R79 F80 S81 L85 W86 I87	R79-A83 WeakPolarHBondContact O-CB 3.5Å; R79-A83 PolarHBondContact O-N 3.11Å; F80-A83 CarbonylContact O-C 3.52Å; F80-A83 PolarHBondContact O-N 3.03Å; F80-A83 VanDerWaalsContact O-N 3.11Å; S81-A83 PolarHBondContact O-N 2.94Å; A83-L85 VanDerWaalsContact C-N 3.34Å; A83-L85 PolarHBondContact O-N 2.81Å; A83-W86 PolarHBondContact O-N 3Å; A83-I87 WeakPolarHBondContact O-CB 3.37Å; A83-I87 WeakPolarHBondContact O-CD1 3.44Å; A83-I87 WeakPolarHBondContact O-CG1 3.41Å; A83-I87 PolarHBondContact O-N 3.48Å
84	A	96.4	Very high	95.5	Very high	43 Å²	43	105.9 Å²	105.9	36%	0.355	53%	0.531	S	S	.	.	H	α-helix	trans	-63	-40.4	178.1	0	0	0	0	0	111.6	F80 S81 G88	F80-A84 HydrophobicContact CE1-CB 4.24Å; F80-A84 HydrophobicContact CZ-CB 4.48Å; F80-A84 VanDerWaalsContact O-CB 3.32Å; F80-A84 WeakPolarHBondContact O-CB 3.14Å; F80-A84 PolarHBondContact O-N 2.84Å; S81-A84 PolarHBondContact O-N 3.29Å; A84-G88 WeakPolarHBondContact O-CA 3.28Å; A84-G88 PolarHBondContact O-N 2.72Å
85	L	96.4	Very high	95.3	Very high	126 Å²	126	109 Å²	109	66%	0.66	54%	0.539	S	S	*	.	H	α-helix	trans	-66.3	-43.5	176.1	-161.7	76.7	0	0	0	110.7	S81 A83 T89	S81-L85 WeakPolarHBondContact O-CB 3.3Å; S81-L85 PolarHBondContact O-N 3.4Å; A83-L85 VanDerWaalsContact C-N 3.34Å; A83-L85 PolarHBondContact O-N 2.81Å; L85-T89 WeakPolarHBondContact O-CB 3.13Å; L85-T89 PolarHBondContact O-N 2.99Å; L85-T89 PolarHBondContact O-OG1 3.47Å
86	W	96.4	Very high	95.1	Very high	191 Å²	191	105.4 Å²	105.4	72%	0.723	53%	0.525	S	S	*	.	H	α-helix	trans	-63.2	-48.8	176.4	-172.6	-100.6	0	0	0	112.2	R82 A83 T89 T90	R82-W86 WeakPolarHBondContact O-CB 3.42Å; R82-W86 PolarHBondContact O-N 3.44Å; A83-W86 PolarHBondContact O-N 3Å; W86-T89 PolarHBondContact O-N 2.65Å; W86-T90 WeakPolarHBondContact O-CB 3.16Å; W86-T90 WeakPolarHBondContact O-CG2 3.36Å; W86-T90 PolarHBondContact O-N 3.49Å; W86-T90 PolarHBondContact O-OG1 3.2Å
87	I	96.5	Very high	94.7	Very high	101 Å²	101	102.4 Å²	102.4	52%	0.518	52%	0.515	S	S	.	.	H	α-helix	trans	-65.4	-44.5	178.7	-65.3	162.8	0	0	0	110.1	A83 T90 S91	A83-I87 WeakPolarHBondContact O-CB 3.37Å; A83-I87 WeakPolarHBondContact O-CD1 3.44Å; A83-I87 WeakPolarHBondContact O-CG1 3.41Å; A83-I87 PolarHBondContact O-N 3.48Å; I87-T90 WeakPolarHBondContact CA-OG1 3.19Å; I87-T90 PolarHBondContact O-N 2.8Å; I87-T90 PolarHBondContact O-OG1 3.49Å; I87-S91 WeakPolarHBondContact O-CB 3.34Å; I87-S91 PolarHBondContact O-N 2.81Å; I87-S91 PolarHBondContact O-OG 3.21Å
88	G	96.6	Very high	94.2	Very high	38 Å²	38	99.3 Å²	99.3	39%	0.392	51%	0.505	S	S	.	.	H	α-helix	trans	-63.5	-43.7	178.9	0	0	0	0	0	112	A84 F92	A84-G88 WeakPolarHBondContact O-CA 3.28Å; A84-G88 PolarHBondContact O-N 2.72Å; G88-F92 WeakPolarHBondContact O-CB 3.36Å; G88-F92 PolarHBondContact O-N 3.4Å
89	T	95.7	Very high	93.8	Very high	79 Å²	79	96.1 Å²	96.1	49%	0.485	50%	0.501	S	S	.	.	H	α-helix	trans	-65.6	-47.3	177.4	-57.3	0	0	0	0	111.1	L85 W86 F92 M93	L85-T89 WeakPolarHBondContact O-CB 3.13Å; L85-T89 PolarHBondContact O-N 2.99Å; L85-T89 PolarHBondContact O-OG1 3.47Å; W86-T89 PolarHBondContact O-N 2.65Å; T89-F92 PolarHBondContact O-N 3.41Å; T89-M93 VanDerWaalsContact O-CB 3.24Å; T89-M93 WeakPolarHBondContact O-CB 3.02Å; T89-M93 PolarHBondContact O-N 3Å
90	T	96.3	Very high	93.3	Very high	54 Å²	54	90.7 Å²	90.7	33%	0.331	49%	0.487	S	S	.	.	H	α-helix	trans	-65.6	-41.2	178.3	50.1	0	0	0	0	111.8	W86 I87 M93 I94	W86-T90 WeakPolarHBondContact O-CB 3.16Å; W86-T90 WeakPolarHBondContact O-CG2 3.36Å; W86-T90 PolarHBondContact O-N 3.49Å; W86-T90 PolarHBondContact O-OG1 3.2Å; I87-T90 WeakPolarHBondContact CA-OG1 3.19Å; I87-T90 PolarHBondContact O-N 2.8Å; I87-T90 PolarHBondContact O-OG1 3.49Å; T90-M93 PolarHBondContact O-N 3.05Å; T90-I94 VanDerWaalsContact O-CG1 3.28Å; T90-I94 WeakPolarHBondContact O-CG1 3.41Å; T90-I94 PolarHBondContact O-N 3.48Å
91	S	95.4	Very high	92.5	Very high	54 Å²	54	89.2 Å²	89.2	38%	0.378	48%	0.48	S	S	.	.	H	α-helix	trans	-64.3	-46.7	175.6	-57.5	0	0	0	0	111.4	I87 M93 I94 L95	I87-S91 WeakPolarHBondContact O-CB 3.34Å; I87-S91 PolarHBondContact O-N 2.81Å; I87-S91 PolarHBondContact O-OG 3.21Å; S91-M93 VanDerWaalsContact C-N 3.35Å; S91-M93 PolarHBondContact O-N 3.34Å; S91-I94 PolarHBondContact O-N 2.75Å; S91-L95 VanDerWaalsContact O-CG 3.31Å; S91-L95 WeakPolarHBondContact O-CG 3.41Å; S91-L95 PolarHBondContact O-N 2.82Å
92	F	94.8	Very high	92	Very high	134 Å²	134	92.2 Å²	92.2	59%	0.588	49%	0.487	S	S	*	.	H	α-helix	trans	-59.2	-47.5	175.5	177.5	-93.6	0	0	0	110.8	G88 T89 I94 L95 V96	G88-F92 WeakPolarHBondContact O-CB 3.36Å; G88-F92 PolarHBondContact O-N 3.4Å; T89-F92 PolarHBondContact O-N 3.41Å; F92-I94 PolarHBondContact O-N 3.41Å; F92-L95 PolarHBondContact O-N 3.29Å; F92-V96 HydrophobicContact CD1-CB 4.33Å; F92-V96 HydrophobicContact CD1-CG2 4.07Å; F92-V96 HydrophobicContact CD2-CG2 3.52Å; F92-V96 HydrophobicContact CE1-CB 3.98Å; F92-V96 HydrophobicContact CE1-CG1 4.04Å; F92-V96 HydrophobicContact CE1-CG2 3.82Å; F92-V96 HydrophobicContact CE2-CB 4.28Å; F92-V96 HydrophobicContact CE2-CG2 3.25Å; F92-V96 HydrophobicContact CG-CG2 3.93Å; F92-V96 HydrophobicContact CZ-CB 3.96Å; F92-V96 HydrophobicContact CZ-CG1 3.88Å; F92-V96 HydrophobicContact CZ-CG2 3.4Å; F92-V96 VanDerWaalsContact CZ-CG2 3.4Å; F92-V96 VanDerWaalsContact O-CB 3.28Å; F92-V96 WeakPolarHBondContact O-CB 3.39Å; F92-V96 VanDerWaalsContact O-CG2 3.28Å; F92-V96 WeakPolarHBondContact O-CG2 3.28Å; F92-V96 PolarHBondContact O-N 3.37Å
93	M	93.9	Very high	91.4	Very high	113 Å²	113	89.2 Å²	89.2	56%	0.557	48%	0.484	S	S	*	.	H	α-helix	trans	-60.2	-44.7	-179.7	-170.4	-174.4	164.6	0	0	111.6	T89 T90 S91 L95 L97	T89-M93 VanDerWaalsContact O-CB 3.24Å; T89-M93 WeakPolarHBondContact O-CB 3.02Å; T89-M93 PolarHBondContact O-N 3Å; T90-M93 PolarHBondContact O-N 3.05Å; S91-M93 VanDerWaalsContact C-N 3.35Å; S91-M93 PolarHBondContact O-N 3.34Å; M93-L95 VanDerWaalsContact C-N 3.28Å; M93-L95 PolarHBondContact O-N 3.48Å; M93-L97 HydrophobicContact CE-CD1 3.46Å; M93-L97 VanDerWaalsContact CE-CD1 3.46Å; M93-L97 HydrophobicContact CG-CD1 3.88Å; M93-L97 WeakPolarHBondContact O-CB 3.27Å; M93-L97 PolarHBondContact O-N 2.99Å; M93-L97 VanDerWaalsContact O-N 3.09Å
94	I	93.5	Very high	90.5	Very high	124 Å²	124	91.4 Å²	91.4	64%	0.636	49%	0.486	S	S	*	.	H	α-helix	trans	-64.6	-32.8	179.9	-68.3	166.3	0	0	0	112.1	T90 S91 F92 P98	T90-I94 VanDerWaalsContact O-CG1 3.28Å; T90-I94 WeakPolarHBondContact O-CG1 3.41Å; T90-I94 PolarHBondContact O-N 3.48Å; S91-I94 PolarHBondContact O-N 2.75Å; F92-I94 PolarHBondContact O-N 3.41Å; I94-P98 WeakPolarHBondContact O-CD 3.28Å; I94-P98 VanDerWaalsContact O-CG 3.27Å; I94-P98 WeakPolarHBondContact O-CG 3.31Å
95	L	92.1	Very high	89.6	Confident	122 Å²	122	96.6 Å²	96.6	64%	0.639	50%	0.501	S	S	*	.	H	α-helix	trans	-87.4	-39	-177.2	-63.9	175.7	0	0	0	113	S91 F92 M93 V99	S91-L95 VanDerWaalsContact O-CG 3.31Å; S91-L95 WeakPolarHBondContact O-CG 3.41Å; S91-L95 PolarHBondContact O-N 2.82Å; F92-L95 PolarHBondContact O-N 3.29Å; M93-L95 VanDerWaalsContact C-N 3.28Å; M93-L95 PolarHBondContact O-N 3.48Å; L95-V99 WeakPolarHBondContact O-CG2 2.94Å
96	V	89.6	Confident	88.1	Confident	45 Å²	45	95.6 Å²	95.6	27%	0.273	50%	0.496	S	S	.	.	H	α-helix	trans	-82	-34.4	-174.7	173.7	0	0	0	0	111.8	F92 V99 V100	F92-V96 HydrophobicContact CD1-CB 4.33Å; F92-V96 HydrophobicContact CD1-CG2 4.07Å; F92-V96 HydrophobicContact CD2-CG2 3.52Å; F92-V96 HydrophobicContact CE1-CB 3.98Å; F92-V96 HydrophobicContact CE1-CG1 4.04Å; F92-V96 HydrophobicContact CE1-CG2 3.82Å; F92-V96 HydrophobicContact CE2-CB 4.28Å; F92-V96 HydrophobicContact CE2-CG2 3.25Å; F92-V96 HydrophobicContact CG-CG2 3.93Å; F92-V96 HydrophobicContact CZ-CB 3.96Å; F92-V96 HydrophobicContact CZ-CG1 3.88Å; F92-V96 HydrophobicContact CZ-CG2 3.4Å; F92-V96 VanDerWaalsContact CZ-CG2 3.4Å; F92-V96 VanDerWaalsContact O-CB 3.28Å; F92-V96 WeakPolarHBondContact O-CB 3.39Å; F92-V96 VanDerWaalsContact O-CG2 3.28Å; F92-V96 WeakPolarHBondContact O-CG2 3.28Å; F92-V96 PolarHBondContact O-N 3.37Å; V96-V99 PolarHBondContact O-N 3.11Å; V96-V99 VanDerWaalsContact O-N 3.11Å; V96-V100 HydrophobicContact CG1-CG2 3.65Å; V96-V100 WeakPolarHBondContact O-CG2 3.34Å; V96-V100 PolarHBondContact O-N 2.73Å
97	L	85.9	Confident	87.1	Confident	74 Å²	74	92 Å²	92	39%	0.387	49%	0.487	S	S	.	.	H	α-helix	trans	-61.9	-41.8	-176.7	-167.1	153.1	0	0	0	112.5	M93 F101	M93-L97 HydrophobicContact CE-CD1 3.46Å; M93-L97 VanDerWaalsContact CE-CD1 3.46Å; M93-L97 HydrophobicContact CG-CD1 3.88Å; M93-L97 WeakPolarHBondContact O-CB 3.27Å; M93-L97 PolarHBondContact O-N 2.99Å; M93-L97 VanDerWaalsContact O-N 3.09Å; L97-F101 HydrophobicContact CD2-CD2 3.76Å; L97-F101 HydrophobicContact CD2-CE2 3.37Å; L97-F101 HydrophobicContact CD2-CZ 4.5Å; L97-F101 HydrophobicContact CG-CD2 4.39Å; L97-F101 HydrophobicContact CG-CE2 3.98Å; L97-F101 WeakPolarHBondContact O-CD2 3.29Å; L97-F101 PolarHBondContact O-N 3.27Å; L97-F101 VanDerWaalsContact O-N 3.14Å
98	P	86.2	Confident	86	Confident	62 Å²	62	92.4 Å²	92.4	40%	0.403	49%	0.488	S	S	.	.	H	α-helix	trans	-61.8	-43.2	168.9	-23.4	34	0	0	0	113.8	I94 F101 E102	I94-P98 WeakPolarHBondContact O-CD 3.28Å; I94-P98 VanDerWaalsContact O-CG 3.27Å; I94-P98 WeakPolarHBondContact O-CG 3.31Å; P98-F101 PolarHBondContact O-N 3.03Å; P98-E102 WeakPolarHBondContact O-CG 3.5Å; P98-E102 PolarHBondContact O-N 3.12Å
99	V	86.1	Confident	85.1	Confident	83 Å²	83	95.8 Å²	95.8	50%	0.503	49%	0.494	S	S	.	.	H	α-helix	trans	-65.4	-43.8	-178	175.5	0	0	0	0	111.1	L95 V96 F101 E102 T103	L95-V99 WeakPolarHBondContact O-CG2 2.94Å; V96-V99 PolarHBondContact O-N 3.11Å; V96-V99 VanDerWaalsContact O-N 3.11Å; V99-F101 VanDerWaalsContact C-N 3.33Å; V99-F101 PolarHBondContact O-N 3.09Å; V99-E102 PolarHBondContact O-N 2.82Å; V99-T103 WeakPolarHBondContact O-CG2 3.12Å; V99-T103 PolarHBondContact O-N 2.84Å; V99-T103 PolarHBondContact O-OG1 2.94Å
100	V	84.2	Confident	84	Confident	59 Å²	59	98.5 Å²	98.5	36%	0.358	50%	0.501	S	S	.	.	H	α-helix	trans	-62.4	-44.3	176.6	174.2	0	0	0	0	109.9	V96 E102 T103 E104	V96-V100 HydrophobicContact CG1-CG2 3.65Å; V96-V100 WeakPolarHBondContact O-CG2 3.34Å; V96-V100 PolarHBondContact O-N 2.73Å; V100-E102 VanDerWaalsContact C-N 3.34Å; V100-E102 PolarHBondContact O-N 3.44Å; V100-T103 WeakPolarHBondContact CA-OG1 3.24Å; V100-T103 PolarHBondContact O-N 3.4Å; V100-T103 VanDerWaalsContact O-N 3.12Å; V100-T103 PolarHBondContact O-OG1 2.88Å; V100-E104 HydrophobicContact CG1-CG 4.21Å; V100-E104 WeakPolarHBondContact O-CG 3.46Å; V100-E104 PolarHBondContact O-N 3.29Å
101	F	80.1	Confident	82.8	Confident	114 Å²	114	100.7 Å²	100.7	50%	0.5	51%	0.507	S	S	.	.	H	α-helix	trans	-62.9	-38.1	176.6	-79.9	-49.1	0	0	0	113.6	L97 P98 V99 T103 K105	L97-F101 HydrophobicContact CD2-CD2 3.76Å; L97-F101 HydrophobicContact CD2-CE2 3.37Å; L97-F101 HydrophobicContact CD2-CZ 4.5Å; L97-F101 HydrophobicContact CG-CD2 4.39Å; L97-F101 HydrophobicContact CG-CE2 3.98Å; L97-F101 WeakPolarHBondContact O-CD2 3.29Å; L97-F101 PolarHBondContact O-N 3.27Å; L97-F101 VanDerWaalsContact O-N 3.14Å; P98-F101 PolarHBondContact O-N 3.03Å; V99-F101 VanDerWaalsContact C-N 3.33Å; V99-F101 PolarHBondContact O-N 3.09Å; F101-T103 VanDerWaalsContact C-N 3.34Å; F101-K105 WeakPolarHBondContact O-CB 3.32Å; F101-K105 WeakPolarHBondContact O-CG 3.49Å; F101-K105 PolarHBondContact O-N 3.49Å
102	E	84.1	Confident	81.9	Confident	132 Å²	132	103.5 Å²	103.5	62%	0.617	52%	0.515	S	S	*	.	H	α-helix	trans	-61.9	-44.1	172.8	-75.4	179.3	-168	0	0	111.1	P98 V99 V100 K105 L106	P98-E102 WeakPolarHBondContact O-CG 3.5Å; P98-E102 PolarHBondContact O-N 3.12Å; V99-E102 PolarHBondContact O-N 2.82Å; V100-E102 VanDerWaalsContact C-N 3.34Å; V100-E102 PolarHBondContact O-N 3.44Å; E102-K105 PolarHBondContact O-N 2.93Å; E102-L106 WeakPolarHBondContact O-CB 3.44Å; E102-L106 VanDerWaalsContact O-CG 3.29Å; E102-L106 WeakPolarHBondContact O-CG 3.18Å; E102-L106 PolarHBondContact O-N 3.14Å
103	T	83.9	Confident	81	Confident	79 Å²	79	101.8 Å²	101.8	49%	0.485	51%	0.508	S	S	.	.	H	α-helix	trans	-66.1	-40.4	178.2	59.2	0	0	0	0	113.3	V99 V100 F101 L106 Q107	V99-T103 WeakPolarHBondContact O-CG2 3.12Å; V99-T103 PolarHBondContact O-N 2.84Å; V99-T103 PolarHBondContact O-OG1 2.94Å; V100-T103 WeakPolarHBondContact CA-OG1 3.24Å; V100-T103 PolarHBondContact O-N 3.4Å; V100-T103 VanDerWaalsContact O-N 3.12Å; V100-T103 PolarHBondContact O-OG1 2.88Å; F101-T103 VanDerWaalsContact C-N 3.34Å; T103-L106 PolarHBondContact O-N 3.34Å; T103-Q107 WeakPolarHBondContact O-CB 3.42Å; T103-Q107 PolarHBondContact O-N 3Å
104	E	76.7	Confident	80.1	Confident	92 Å²	92	101.5 Å²	101.5	43%	0.43	51%	0.509	S	S	.	.	H	α-helix	trans	-70.1	-38.1	177	-72.1	-174.8	170.9	0	0	111.9	V100 Q107 M108	V100-E104 HydrophobicContact CG1-CG 4.21Å; V100-E104 WeakPolarHBondContact O-CG 3.46Å; V100-E104 PolarHBondContact O-N 3.29Å; E104-Q107 PolarHBondContact O-N 3.47Å; E104-M108 WeakPolarHBondContact O-CB 3.19Å; E104-M108 WeakPolarHBondContact O-CG 3.08Å; E104-M108 PolarHBondContact O-N 3.5Å
105	K	76.4	Confident	79.1	Confident	153 Å²	153	101 Å²	101	67%	0.665	50%	0.504	S	S	*	.	H	α-helix	trans	-62.3	-44.3	175.1	-79	-74.9	-172.2	175.5	0	111.4	F101 E102 Q107 M108 E109	F101-K105 WeakPolarHBondContact O-CB 3.32Å; F101-K105 WeakPolarHBondContact O-CG 3.49Å; F101-K105 PolarHBondContact O-N 3.49Å; E102-K105 PolarHBondContact O-N 2.93Å; K105-Q107 VanDerWaalsContact C-N 3.3Å; K105-Q107 PolarHBondContact O-N 3.26Å; K105-M108 PolarHBondContact O-N 2.84Å; K105-E109 PolarHBondContact O-N 3.32Å
106	L	66.4	Low	78.3	Confident	104 Å²	104	101.1 Å²	101.1	55%	0.545	50%	0.501	S	S	.	.	H	α-helix	trans	-63.5	-38.1	175.5	-72.1	171.8	0	0	0	111.7	E102 T103 E109 Q110	E102-L106 WeakPolarHBondContact O-CB 3.44Å; E102-L106 VanDerWaalsContact O-CG 3.29Å; E102-L106 WeakPolarHBondContact O-CG 3.18Å; E102-L106 PolarHBondContact O-N 3.14Å; T103-L106 PolarHBondContact O-N 3.34Å; L106-E109 PolarHBondContact O-N 2.85Å; L106-Q110 WeakPolarHBondContact O-CG 3.4Å; L106-Q110 PolarHBondContact O-N 3.48Å; L106-Q110 VanDerWaalsContact O-N 3.1Å
107	Q	74.5	Confident	77.2	Confident	116 Å²	116	107.1 Å²	107.1	54%	0.542	52%	0.518	S	S	.	.	H	α-helix	trans	-67.4	-40.8	176.7	-167.4	178.5	0.3	0	0	112.2	T103 E104 K105 Q110 Q111	T103-Q107 WeakPolarHBondContact O-CB 3.42Å; T103-Q107 PolarHBondContact O-N 3Å; E104-Q107 PolarHBondContact O-N 3.47Å; K105-Q107 VanDerWaalsContact C-N 3.3Å; K105-Q107 PolarHBondContact O-N 3.26Å; Q107-Q110 PolarHBondContact O-N 3.04Å; Q107-Q111 PolarHBondContact O-N 3.1Å
108	M	74.4	Confident	76.3	Confident	110 Å²	110	109.5 Å²	109.5	54%	0.542	53%	0.528	S	S	.	.	H	α-helix	trans	-64.3	-42.2	175.8	-72.7	-87.7	169.7	0	0	111.6	E104 K105 Q111 Q112	E104-M108 WeakPolarHBondContact O-CB 3.19Å; E104-M108 WeakPolarHBondContact O-CG 3.08Å; E104-M108 PolarHBondContact O-N 3.5Å; K105-M108 PolarHBondContact O-N 2.84Å; M108-Q111 PolarHBondContact O-N 2.88Å; M108-Q112 WeakPolarHBondContact O-CB 3.46Å; M108-Q112 WeakPolarHBondContact O-CG 3.37Å; M108-Q112 PolarHBondContact O-N 3.35Å
109	E	77.9	Confident	75.3	Confident	109 Å²	109	112.6 Å²	112.6	51%	0.509	54%	0.539	S	S	.	.	H	α-helix	trans	-65.6	-42.2	178.4	-168.9	175.8	178.2	0	0	111.6	K105 L106 Q111 Q112 Q113	K105-E109 PolarHBondContact O-N 3.32Å; L106-E109 PolarHBondContact O-N 2.85Å; E109-Q111 PolarHBondContact O-N 3.49Å; E109-Q112 PolarHBondContact O-N 2.98Å; E109-Q113 WeakPolarHBondContact O-CG 3.46Å; E109-Q113 PolarHBondContact O-N 3.34Å
110	Q	71.4	Confident	74.2	Confident	135 Å²	135	116 Å²	116	63%	0.631	55%	0.554	S	S	*	*	H	α-helix	trans	-62.9	-41.8	174.1	-74.6	-174.7	10.5	0	0	112.3	L106 Q107 Q113 L114	L106-Q110 WeakPolarHBondContact O-CG 3.4Å; L106-Q110 PolarHBondContact O-N 3.48Å; L106-Q110 VanDerWaalsContact O-N 3.1Å; Q107-Q110 PolarHBondContact O-N 3.04Å; Q110-Q113 PolarHBondContact O-N 2.88Å; Q110-L114 WeakPolarHBondContact O-CG 3.32Å; Q110-L114 PolarHBondContact O-N 3.21Å
111	Q	72.4	Confident	73.1	Confident	101 Å²	101	117.9 Å²	117.9	47%	0.472	56%	0.561	S	S	.	*	H	α-helix	trans	-64.8	-39.3	175.6	-83.5	-175.4	-27.7	0	0	112.4	Q107 M108 E109 L114 Q115	Q107-Q111 PolarHBondContact O-N 3.1Å; M108-Q111 PolarHBondContact O-N 2.88Å; E109-Q111 PolarHBondContact O-N 3.49Å; Q111-L114 PolarHBondContact O-N 3.37Å; Q111-Q115 WeakPolarHBondContact O-CG 3.34Å; Q111-Q115 PolarHBondContact O-N 2.85Å
112	Q	76.5	Confident	72.2	Confident	113 Å²	113	113.7 Å²	113.7	53%	0.528	55%	0.551	S	S	.	*	H	α-helix	trans	-66.9	-39	175.2	-74.9	-178.2	7.6	0	0	111.9	M108 E109 L114 Q115 Q116	M108-Q112 WeakPolarHBondContact O-CB 3.46Å; M108-Q112 WeakPolarHBondContact O-CG 3.37Å; M108-Q112 PolarHBondContact O-N 3.35Å; E109-Q112 PolarHBondContact O-N 2.98Å; Q112-L114 VanDerWaalsContact C-N 3.32Å; Q112-L114 PolarHBondContact O-N 2.83Å; Q112-Q115 PolarHBondContact O-N 3.33Å; Q112-Q116 WeakPolarHBondContact O-CB 3.39Å; Q112-Q116 WeakPolarHBondContact O-CG 3.45Å; Q112-Q116 PolarHBondContact O-N 2.96Å
113	Q	75.4	Confident	71	Confident	98 Å²	98	113.7 Å²	113.7	46%	0.458	56%	0.562	S	S	.	*	H	α-helix	trans	-63.3	-39.2	173.2	-73.8	-171.4	22.3	0	0	111.8	E109 Q110 Q116 R117	E109-Q113 WeakPolarHBondContact O-CG 3.46Å; E109-Q113 PolarHBondContact O-N 3.34Å; Q110-Q113 PolarHBondContact O-N 2.88Å; Q113-Q116 PolarHBondContact O-N 2.85Å; Q113-R117 WeakPolarHBondContact O-CB 3.36Å; Q113-R117 WeakPolarHBondContact O-CG 3.34Å; Q113-R117 PolarHBondContact O-N 3.48Å
114	L	74.6	Confident	69.4	Low	107 Å²	107	115.2 Å²	115.2	56%	0.56	57%	0.567	S	S	*	*	H	α-helix	trans	-66.3	-42.1	174.5	-72.7	172.3	0	0	0	112.1	Q110 Q111 Q112 R117 Q118	Q110-L114 WeakPolarHBondContact O-CG 3.32Å; Q110-L114 PolarHBondContact O-N 3.21Å; Q111-L114 PolarHBondContact O-N 3.37Å; Q112-L114 VanDerWaalsContact C-N 3.32Å; Q112-L114 PolarHBondContact O-N 2.83Å; L114-R117 PolarHBondContact O-N 3.47Å; L114-Q118 WeakPolarHBondContact O-CB 3.33Å; L114-Q118 VanDerWaalsContact O-CG 3.27Å; L114-Q118 WeakPolarHBondContact O-CG 3.07Å; L114-Q118 PolarHBondContact O-N 3.33Å
115	Q	73.3	Confident	68.4	Low	113 Å²	113	114.8 Å²	114.8	53%	0.528	57%	0.571	S	S	.	*	H	α-helix	trans	-65.8	-41.4	174	-76.3	-179.4	0.1	0	0	111.9	Q111 Q112 Q118 I119	Q111-Q115 WeakPolarHBondContact O-CG 3.34Å; Q111-Q115 PolarHBondContact O-N 2.85Å; Q112-Q115 PolarHBondContact O-N 3.33Å; Q115-Q118 CarbonylContact O-C 3.54Å; Q115-Q118 PolarHBondContact O-N 3.43Å; Q115-I119 VanDerWaalsContact O-CB 3.27Å; Q115-I119 WeakPolarHBondContact O-CB 3.27Å; Q115-I119 VanDerWaalsContact O-CG1 3.25Å; Q115-I119 WeakPolarHBondContact O-CG1 3.27Å; Q115-I119 PolarHBondContact O-N 3.31Å
116	Q	74.4	Confident	67.2	Low	124 Å²	124	111.2 Å²	111.2	58%	0.579	58%	0.578	S	S	*	*	H	α-helix	trans	-62.6	-43	173.8	-79.4	-176.3	4.2	0	0	111	Q112 Q113 Q118 I119 L120	Q112-Q116 WeakPolarHBondContact O-CB 3.39Å; Q112-Q116 WeakPolarHBondContact O-CG 3.45Å; Q112-Q116 PolarHBondContact O-N 2.96Å; Q113-Q116 PolarHBondContact O-N 2.85Å; Q116-Q118 VanDerWaalsContact C-N 3.33Å; Q116-Q118 PolarHBondContact O-N 2.89Å; Q116-I119 PolarHBondContact O-N 3.48Å; Q116-L120 WeakPolarHBondContact O-CB 3.11Å; Q116-L120 PolarHBondContact O-N 2.78Å
117	R	67.1	Low	66.3	Low	171 Å²	171	113 Å²	113	65%	0.645	59%	0.587	S	S	*	*	H	α-helix	trans	-59.7	-44.5	172.8	-70.6	-97	171.4	98.9	-0.7	110.6	Q113 L114 L121	Q113-R117 WeakPolarHBondContact O-CB 3.36Å; Q113-R117 WeakPolarHBondContact O-CG 3.34Å; Q113-R117 PolarHBondContact O-N 3.48Å; L114-R117 PolarHBondContact O-N 3.47Å; R117-L121 WeakPolarHBondContact O-CB 3.2Å; R117-L121 WeakPolarHBondContact O-CD1 3.25Å; R117-L121 WeakPolarHBondContact O-CG 3.34Å; R117-L121 PolarHBondContact O-N 3.25Å
118	Q	66.1	Low	65.2	Low	125 Å²	125	112.7 Å²	112.7	58%	0.584	60%	0.598	S	S	*	*	H	α-helix	trans	-71.5	-23.6	177.2	-72.1	174.5	8.2	0	0	114.1	L114 Q115 Q116 G122	L114-Q118 WeakPolarHBondContact O-CB 3.33Å; L114-Q118 VanDerWaalsContact O-CG 3.27Å; L114-Q118 WeakPolarHBondContact O-CG 3.07Å; L114-Q118 PolarHBondContact O-N 3.33Å; Q115-Q118 CarbonylContact O-C 3.54Å; Q115-Q118 PolarHBondContact O-N 3.43Å; Q116-Q118 VanDerWaalsContact C-N 3.33Å; Q116-Q118 PolarHBondContact O-N 2.89Å; Q118-G122 CarbonylContact O-C 3.05Å; Q118-G122 WeakPolarHBondContact O-CA 3.41Å; Q118-G122 PolarHBondContact O-N 2.75Å
119	I	66.4	Low	64.2	Low	126 Å²	126	111.2 Å²	111.2	65%	0.646	61%	0.611	S	S	*	*	H	α-helix	trans	-84.7	-42.5	175.8	-76.9	163.7	0	0	0	110.7	Q115 Q116 L121 G122	Q115-I119 VanDerWaalsContact O-CB 3.27Å; Q115-I119 WeakPolarHBondContact O-CB 3.27Å; Q115-I119 VanDerWaalsContact O-CG1 3.25Å; Q115-I119 WeakPolarHBondContact O-CG1 3.27Å; Q115-I119 PolarHBondContact O-N 3.31Å; Q116-I119 PolarHBondContact O-N 3.48Å; I119-L121 VanDerWaalsContact C-N 3.31Å; I119-G122 PolarHBondContact O-N 2.49Å; I119-G122 VanDerWaalsContact O-N 3.13Å
120	L	62.3	Low	63	Low	156 Å²	156	108.6 Å²	108.6	82%	0.817	61%	0.613	S	S	*	*	H	α-helix	trans	-68	-32.4	173.5	-113.4	75.7	0	0	0	112	Q116	Q116-L120 WeakPolarHBondContact O-CB 3.11Å; Q116-L120 PolarHBondContact O-N 2.78Å
121	L	61	Low	61.9	Low	97 Å²	97	109.8 Å²	109.8	51%	0.508	62%	0.62	S	S	.	*	S	Bend	trans	-90.1	-6.6	171.8	-63.3	162.6	0	0	0	111.4	R117 I119 T125	R117-L121 WeakPolarHBondContact O-CB 3.2Å; R117-L121 WeakPolarHBondContact O-CD1 3.25Å; R117-L121 WeakPolarHBondContact O-CG 3.34Å; R117-L121 PolarHBondContact O-N 3.25Å; I119-L121 VanDerWaalsContact C-N 3.31Å; L121-T125 VanDerWaalsContact C-OG1 3.29Å; L121-T125 WeakPolarHBondContact CA-OG1 3.07Å; L121-T125 WeakPolarHBondContact CB-OG1 2.99Å; L121-T125 WeakPolarHBondContact O-CB 3.37Å; L121-T125 WeakPolarHBondContact O-CG2 2.99Å; L121-T125 PolarHBondContact O-N 2.73Å; L121-T125 VanDerWaalsContact O-N 3.09Å; L121-T125 PolarHBondContact O-OG1 3.13Å
122	G	60.4	Low	60.8	Low	27 Å²	27	111.2 Å²	111.2	28%	0.278	64%	0.638	S	S	.	*	T	Hydrogen-bonded Turn	trans	54	160.3	-171.7	0	0	0	0	0	114.2	Q118 I119 N124	Q118-G122 CarbonylContact O-C 3.05Å; Q118-G122 WeakPolarHBondContact O-CA 3.41Å; Q118-G122 PolarHBondContact O-N 2.75Å; I119-G122 PolarHBondContact O-N 2.49Å; I119-G122 VanDerWaalsContact O-N 3.13Å; G122-N124 PolarHBondContact O-N 2.79Å
123	P	58.7	Low	59.9	Low	131 Å²	131	109 Å²	109	85%	0.851	65%	0.646	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.3	9.1	165.6	-23.6	33.7	0	0	0	115.1
124	N	52.1	Low	58.7	Low	111 Å²	111	109.1 Å²	109.1	59%	0.594	66%	0.663	S	S	*	*	T	Hydrogen-bonded Turn	trans	-139	-9	-169.8	-90.9	-71.9	0	0	0	116.7	G122 G126 L127 S128	G122-N124 PolarHBondContact O-N 2.79Å; N124-G126 VanDerWaalsContact C-N 3.32Å; N124-G126 PolarHBondContact O-N 2.86Å; N124-L127 PolarHBondContact O-N 3.09Å; N124-S128 PolarHBondContact O-N 3.38Å
125	T	53.9	Low	57.9	Low	84 Å²	84	111.8 Å²	111.8	52%	0.515	68%	0.678	S	S	.	*	T	Hydrogen-bonded Turn	trans	-81.1	-9.8	-179.7	71.5	0	0	0	0	114.5	L121	L121-T125 VanDerWaalsContact C-OG1 3.29Å; L121-T125 WeakPolarHBondContact CA-OG1 3.07Å; L121-T125 WeakPolarHBondContact CB-OG1 2.99Å; L121-T125 WeakPolarHBondContact O-CB 3.37Å; L121-T125 WeakPolarHBondContact O-CG2 2.99Å; L121-T125 PolarHBondContact O-N 2.73Å; L121-T125 VanDerWaalsContact O-N 3.09Å; L121-T125 PolarHBondContact O-OG1 3.13Å
126	G	51.2	Low	56.9	Low	78 Å²	78	112.4 Å²	112.4	80%	0.804	69%	0.691	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.9	-18.5	167.7	0	0	0	0	0	114.4	N124	N124-G126 VanDerWaalsContact C-N 3.32Å; N124-G126 PolarHBondContact O-N 2.86Å
127	L	49.4	Very low	56	Low	141 Å²	141	112.3 Å²	112.3	74%	0.738	71%	0.705	S	S	*	*	S	Bend	trans	-108.5	15.6	177.7	-156	75.3	0	0	0	112	N124	N124-L127 PolarHBondContact O-N 3.09Å
128	S	50.5	Low	55.4	Low	110 Å²	110	111.6 Å²	111.6	77%	0.769	71%	0.712	S	S	*	*	S	Bend	trans	-107.2	35.6	168.6	-153.3	0	0	0	0	110.9	N124	N124-S128 PolarHBondContact O-N 3.38Å
129	G	52.8	Low	55.2	Low	79 Å²	79	111.6 Å²	111.6	81%	0.814	72%	0.724	S	S	*	*	S	Bend	trans	-122.7	-9.8	174.7	0	0	0	0	0	114.4
130	G	53.8	Low	54.3	Low	53 Å²	53	109 Å²	109	55%	0.546	73%	0.728	S	S	.	*	S	Bend	trans	-171.8	113	-178.9	0	0	0	0	0	113.3
131	M	47.5	Very low	53.6	Low	161 Å²	161	111.3 Å²	111.3	79%	0.793	73%	0.732	S	S	*	*			trans	104.8	98	157.8	-149.4	61.2	59.9	0	0	117	G133	M131-G133 PolarHBondContact O-N 3.36Å
132	P	49.3	Very low	52.7	Low	130 Å²	130	118.7 Å²	118.7	84%	0.844	77%	0.77	S	S	*	*	S	Bend	trans	-77.7	107.8	160.2	31.5	-25.1	0	0	0	108.3
133	G	56.8	Low	52.3	Low	67 Å²	67	123.3 Å²	123.3	69%	0.691	79%	0.794	S	S	*	*			trans	136.1	81.1	165	0	0	0	0	0	114.8	M131	M131-G133 PolarHBondContact O-N 3.36Å
134	A	51.8	Low	52	Low	100 Å²	100	122.8 Å²	122.8	83%	0.826	79%	0.792	S	S	*	*			trans	-150.9	117.3	145.7	0	0	0	0	0	107.9
135	L	57.3	Low	52	Low	164 Å²	164	123.5 Å²	123.5	86%	0.859	80%	0.803	S	S	*	*			trans	-64	149.9	-175.8	-49.4	165.9	0	0	0	110.6	S137	L135-S137 PolarHBondContact O-N 3.24Å
136	P	52.9	Low	51.8	Low	126 Å²	126	125.8 Å²	125.8	82%	0.818	82%	0.819	S	S	*	*			trans	-73.5	109.8	165.3	29	-30.3	0	0	0	109.4	L138	P136-L138 PolarHBondContact O-N 3.38Å
137	S	54.4	Low	51.9	Low	122 Å²	122	128.8 Å²	128.8	85%	0.853	82%	0.82	S	S	*	*	P	Polyproline II helix	trans	-69.8	119.3	164.6	176.8	0	0	0	0	108.9	L135	L135-S137 PolarHBondContact O-N 3.24Å
138	L	55.2	Low	52.1	Low	155 Å²	155	128 Å²	128	81%	0.812	83%	0.826	S	S	*	*	P	Polyproline II helix	trans	-63.9	159	177.3	-80.1	162.3	0	0	0	113	P136	P136-L138 PolarHBondContact O-N 3.38Å
139	P	61.2	Low	52.2	Low	126 Å²	126	129.3 Å²	129.3	82%	0.818	83%	0.83	S	S	*	*	P	Polyproline II helix	trans	-83.1	143.8	-177	34.8	-33	0	0	0	111.7
140	G	47.9	Very low	52.1	Low	72 Å²	72	133.2 Å²	133.2	74%	0.742	83%	0.831	S	S	*	*			trans	-168.4	110.8	175.7	0	0	0	0	0	114.3
141	K	48	Very low	52	Low	204 Å²	204	139.8 Å²	139.8	89%	0.887	86%	0.855	S	S	*	*			trans	34.5	115.4	143	-85.7	160.1	158.8	178.3	0	118.3
142	L	41.4	Very low	52.4	Low	251 Å²	251	137.9 Å²	137.9	100%	1.314	86%	0.86	S	S	*	*				-176.2	0	104.4	-87.3	157.4	0	0	0	108.8

Retrieved 142 of 142 residues in 86.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).