A0A060W1Y4_ONCMY Loading...

ATP synthase subunit g

AlphaFold DB (M4UZU2), UniProt , Accession A0A060W1Y4, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 103 aa.

						>A0A060W1Y4_ONCMY|A0A060W1Y4
MAQAVQKLVAKVPTLIGAAATYSKPRLATFWHYAKVELVPPSPAEIPQAIIGIKNIVTGVNSGRLGQTTVKDAFRNGLVCTEVLMWFYIGECIGKGGIVGYAV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.5	Low	79.3	Confident	200 Å²	200	115.6 Å²	115.6	99%	0.985	64%	0.635	S	S	*	*				0	-54.2	0	-63.9	-57.5	-87	0	0	112.8	Q3 A4 V5	M1-Q3 PolarHBondContact O-N 2.89Å; M1-A4 PolarHBondContact O-N 3.49Å; M1-V5 WeakPolarHBondContact O-CG2 3.4Å; M1-V5 PolarHBondContact O-N 3.17Å
2	A	72.6	Confident	80.2	Confident	80 Å²	80	111.5 Å²	111.5	66%	0.661	62%	0.615	S	S	*	*	H	α-helix	trans	-57.4	-45.2	-177.3	0	0	0	0	0	115.2	A4 V5 Q6	A2-A4 PolarHBondContact O-N 3.18Å; A2-V5 PolarHBondContact O-N 3.42Å; A2-Q6 WeakPolarHBondContact O-CB 3.47Å; A2-Q6 PolarHBondContact O-N 3.24Å
3	Q	75.8	Confident	81.1	Confident	145 Å²	145	109.7 Å²	109.7	68%	0.678	61%	0.612	S	S	*	*	H	α-helix	trans	-68.6	-30.5	179.7	-68.5	-175.5	-9.7	0	0	113.9	M1 K7	M1-Q3 PolarHBondContact O-N 2.89Å; Q3-K7 WeakPolarHBondContact O-CB 3.17Å; Q3-K7 VanDerWaalsContact O-CG 3.31Å; Q3-K7 WeakPolarHBondContact O-CG 3.45Å; Q3-K7 PolarHBondContact O-N 3.47Å
4	A	77.1	Confident	81.9	Confident	65 Å²	65	109.2 Å²	109.2	54%	0.537	61%	0.613	S	S	.	*	H	α-helix	trans	-71.3	-41.2	176.2	0	0	0	0	0	110.9	M1 A2 K7 L8	M1-A4 PolarHBondContact O-N 3.49Å; A2-A4 PolarHBondContact O-N 3.18Å; A4-K7 PolarHBondContact O-N 3.09Å; A4-L8 WeakPolarHBondContact O-CB 3.26Å; A4-L8 PolarHBondContact O-N 3.35Å
5	V	80.8	Confident	82.6	Confident	85 Å²	85	109.5 Å²	109.5	52%	0.515	61%	0.612	S	S	.	*	H	α-helix	trans	-62.5	-44.1	172	175.6	0	0	0	0	110.5	M1 A2 K7 L8 V9	M1-V5 WeakPolarHBondContact O-CG2 3.4Å; M1-V5 PolarHBondContact O-N 3.17Å; A2-V5 PolarHBondContact O-N 3.42Å; V5-K7 VanDerWaalsContact C-N 3.35Å; V5-K7 PolarHBondContact O-N 3.13Å; V5-L8 WeakPolarHBondContact O-CB 3.48Å; V5-L8 PolarHBondContact O-N 3.31Å; V5-L8 VanDerWaalsContact O-N 3.1Å; V5-V9 HydrophobicContact CG1-CG2 4.28Å; V5-V9 WeakPolarHBondContact O-CG2 3.41Å; V5-V9 PolarHBondContact O-N 3.1Å
6	Q	80.1	Confident	83.3	Confident	139 Å²	139	109.5 Å²	109.5	65%	0.65	61%	0.609	S	S	*	*	H	α-helix	trans	-63.1	-39.1	178.6	-160.4	172.6	6.7	0	0	112.5	A2 A10	A2-Q6 WeakPolarHBondContact O-CB 3.47Å; A2-Q6 PolarHBondContact O-N 3.24Å; Q6-A10 WeakPolarHBondContact O-CB 3.42Å; Q6-A10 PolarHBondContact O-N 3.07Å
7	K	82.8	Confident	83.9	Confident	147 Å²	147	105.2 Å²	105.2	64%	0.639	60%	0.595	S	S	*	*	H	α-helix	trans	-67.2	-33.3	172.3	-74.4	178.3	-177.6	-177.3	0	112.9	Q3 A4 V5 K11	Q3-K7 WeakPolarHBondContact O-CB 3.17Å; Q3-K7 VanDerWaalsContact O-CG 3.31Å; Q3-K7 WeakPolarHBondContact O-CG 3.45Å; Q3-K7 PolarHBondContact O-N 3.47Å; A4-K7 PolarHBondContact O-N 3.09Å; V5-K7 VanDerWaalsContact C-N 3.35Å; V5-K7 PolarHBondContact O-N 3.13Å; K7-K11 WeakPolarHBondContact O-CG 3.46Å; K7-K11 PolarHBondContact O-N 3.28Å
8	L	81.7	Confident	84.5	Confident	115 Å²	115	102.6 Å²	102.6	60%	0.602	59%	0.589	S	S	*	*	H	α-helix	trans	-70.8	-46.7	176	-170.3	74.5	0	0	0	111	A4 V5 A10 K11 V12	A4-L8 WeakPolarHBondContact O-CB 3.26Å; A4-L8 PolarHBondContact O-N 3.35Å; V5-L8 WeakPolarHBondContact O-CB 3.48Å; V5-L8 PolarHBondContact O-N 3.31Å; V5-L8 VanDerWaalsContact O-N 3.1Å; L8-A10 VanDerWaalsContact C-N 3.27Å; L8-A10 PolarHBondContact O-N 2.7Å; L8-K11 PolarHBondContact O-N 3.11Å; L8-V12 PolarHBondContact O-N 3.48Å
9	V	85.1	Confident	85.1	Confident	91 Å²	91	99.9 Å²	99.9	55%	0.552	58%	0.58	S	S	*	*	H	α-helix	trans	-57.9	-41.5	175.3	172.2	0	0	0	0	110.6	V5 K11 V12	V5-V9 HydrophobicContact CG1-CG2 4.28Å; V5-V9 WeakPolarHBondContact O-CG2 3.41Å; V5-V9 PolarHBondContact O-N 3.1Å; V9-K11 PolarHBondContact O-N 3.3Å; V9-V12 WeakPolarHBondContact O-CB 3.49Å; V9-V12 PolarHBondContact O-N 3.34Å; V9-V12 VanDerWaalsContact O-N 3.13Å
10	A	86.4	Confident	85.6	Confident	70 Å²	70	97.2 Å²	97.2	58%	0.579	57%	0.57	S	S	*	*	H	α-helix	trans	-62.4	-22.5	176.1	0	0	0	0	0	114.1	Q6 L8	Q6-A10 WeakPolarHBondContact O-CB 3.42Å; Q6-A10 PolarHBondContact O-N 3.07Å; L8-A10 VanDerWaalsContact C-N 3.27Å; L8-A10 PolarHBondContact O-N 2.7Å
11	K	89.8	Confident	86.1	Confident	135 Å²	135	97.6 Å²	97.6	59%	0.587	57%	0.574	S	S	*	*	H	α-helix	trans	-91	-12.3	177.2	-70.7	-176.1	176.8	-168.9	0	113.8	K7 L8 V9 T14 L15	K7-K11 WeakPolarHBondContact O-CG 3.46Å; K7-K11 PolarHBondContact O-N 3.28Å; L8-K11 PolarHBondContact O-N 3.11Å; V9-K11 PolarHBondContact O-N 3.3Å; K11-T14 WeakPolarHBondContact O-CB 3.41Å; K11-T14 PolarHBondContact O-N 2.96Å; K11-T14 VanDerWaalsContact O-N 3.16Å; K11-L15 WeakPolarHBondContact O-CG 3.38Å; K11-L15 PolarHBondContact O-N 2.98Å
12	V	90.2	Very high	87.8	Confident	66 Å²	66	94.9 Å²	94.9	40%	0.4	55%	0.554	S	S	.	*	H	α-helix	trans	-55.5	-45.9	179.2	172	0	0	0	0	112.2	L8 V9 T14 L15 I16	L8-V12 PolarHBondContact O-N 3.48Å; V9-V12 WeakPolarHBondContact O-CB 3.49Å; V9-V12 PolarHBondContact O-N 3.34Å; V9-V12 VanDerWaalsContact O-N 3.13Å; V12-T14 VanDerWaalsContact C-N 3.3Å; V12-T14 PolarHBondContact O-N 3.18Å; V12-L15 PolarHBondContact O-N 2.92Å; V12-I16 HydrophobicContact CG1-CD1 3.71Å; V12-I16 HydrophobicContact CG1-CG1 4.31Å; V12-I16 WeakPolarHBondContact O-CG1 3.38Å; V12-I16 PolarHBondContact O-N 2.94Å
13	P	91.6	Very high	89	Confident	88 Å²	88	93.4 Å²	93.4	57%	0.571	54%	0.538	S	S	*	.	H	α-helix	trans	-60.8	-38.6	177.9	-24.3	35.4	0	0	0	112.9	I16 G17	P13-I16 PolarHBondContact O-N 3.17Å; P13-G17 PolarHBondContact O-N 3.42Å
14	T	92.2	Very high	90	Very high	103 Å²	103	93.8 Å²	93.8	63%	0.632	54%	0.538	S	S	*	.	H	α-helix	trans	-65.2	-41.9	176.9	-47.6	0	0	0	0	111.5	K11 V12 G17 A18	K11-T14 WeakPolarHBondContact O-CB 3.41Å; K11-T14 PolarHBondContact O-N 2.96Å; K11-T14 VanDerWaalsContact O-N 3.16Å; V12-T14 VanDerWaalsContact C-N 3.3Å; V12-T14 PolarHBondContact O-N 3.18Å; T14-G17 PolarHBondContact O-N 3.35Å; T14-A18 WeakPolarHBondContact O-CB 3.5Å; T14-A18 PolarHBondContact O-N 3.48Å
15	L	92.8	Very high	90.9	Very high	114 Å²	114	94.1 Å²	94.1	60%	0.597	53%	0.534	S	S	*	.	H	α-helix	trans	-66.5	-40.8	177.4	-68.8	174.7	0	0	0	112.1	K11 V12 A18 A19	K11-L15 WeakPolarHBondContact O-CG 3.38Å; K11-L15 PolarHBondContact O-N 2.98Å; V12-L15 PolarHBondContact O-N 2.92Å; L15-A18 PolarHBondContact O-N 2.91Å; L15-A19 WeakPolarHBondContact O-CB 3.44Å; L15-A19 PolarHBondContact O-N 2.96Å
16	I	93.5	Very high	91.7	Very high	109 Å²	109	96.2 Å²	96.2	56%	0.559	53%	0.533	S	S	*	.	H	α-helix	trans	-62.8	-44.9	174.2	-66.5	168.6	0	0	0	110.3	V12 P13 A18 A19 A20	V12-I16 HydrophobicContact CG1-CD1 3.71Å; V12-I16 HydrophobicContact CG1-CG1 4.31Å; V12-I16 WeakPolarHBondContact O-CG1 3.38Å; V12-I16 PolarHBondContact O-N 2.94Å; P13-I16 PolarHBondContact O-N 3.17Å; I16-A18 VanDerWaalsContact C-N 3.33Å; I16-A18 PolarHBondContact O-N 3.45Å; I16-A19 PolarHBondContact O-N 3.01Å; I16-A20 WeakPolarHBondContact O-CB 3.46Å; I16-A20 PolarHBondContact O-N 2.91Å
17	G	94.1	Very high	92.5	Very high	36 Å²	36	94.8 Å²	94.8	37%	0.371	53%	0.529	S	S	.	.	H	α-helix	trans	-61.3	-40.2	176.8	0	0	0	0	0	112.8	P13 T14 T21	P13-G17 PolarHBondContact O-N 3.42Å; T14-G17 PolarHBondContact O-N 3.35Å; G17-T21 WeakPolarHBondContact O-CB 3.45Å; G17-T21 PolarHBondContact O-N 2.91Å; G17-T21 PolarHBondContact O-OG1 3.42Å
18	A	94.4	Very high	93.2	Very high	58 Å²	58	90.6 Å²	90.6	48%	0.479	52%	0.522	S	S	.	.	H	α-helix	trans	-65.7	-45.6	174.6	0	0	0	0	0	111.6	T14 L15 I16 A20 T21 Y22	T14-A18 WeakPolarHBondContact O-CB 3.5Å; T14-A18 PolarHBondContact O-N 3.48Å; L15-A18 PolarHBondContact O-N 2.91Å; I16-A18 VanDerWaalsContact C-N 3.33Å; I16-A18 PolarHBondContact O-N 3.45Å; A18-A20 PolarHBondContact O-N 3.38Å; A18-T21 PolarHBondContact O-N 3.42Å; A18-Y22 WeakPolarHBondContact O-CB 3.29Å; A18-Y22 PolarHBondContact O-N 2.95Å
19	A	95.2	Very high	93.9	Very high	52 Å²	52	89 Å²	89	43%	0.43	52%	0.517	S	S	.	.	H	α-helix	trans	-61.5	-42.7	176.9	0	0	0	0	0	111.8	L15 I16 Y22 S23	L15-A19 WeakPolarHBondContact O-CB 3.44Å; L15-A19 PolarHBondContact O-N 2.96Å; I16-A19 PolarHBondContact O-N 3.01Å; A19-Y22 PolarHBondContact O-N 3.19Å; A19-S23 VanDerWaalsContact O-CB 3.28Å; A19-S23 WeakPolarHBondContact O-CB 3.41Å; A19-S23 PolarHBondContact O-N 3.2Å; A19-S23 PolarHBondContact O-OG 2.82Å
20	A	95.2	Very high	94.4	Very high	46 Å²	46	90.2 Å²	90.2	38%	0.38	52%	0.516	S	S	.	.	H	α-helix	trans	-63.5	-44.8	176.6	0	0	0	0	0	111.7	I16 A18 Y22 S23 K24	I16-A20 WeakPolarHBondContact O-CB 3.46Å; I16-A20 PolarHBondContact O-N 2.91Å; A18-A20 PolarHBondContact O-N 3.38Å; A20-Y22 VanDerWaalsContact C-N 3.3Å; A20-Y22 PolarHBondContact O-N 3.49Å; A20-S23 PolarHBondContact O-N 3.05Å; A20-K24 WeakPolarHBondContact O-CB 3.44Å; A20-K24 WeakPolarHBondContact O-CG 3.5Å; A20-K24 PolarHBondContact O-N 3.42Å
21	T	96.4	Very high	94.9	Very high	106 Å²	106	94 Å²	94	65%	0.65	52%	0.515	S	S	*	.	H	α-helix	trans	-62.2	-39.2	177.3	-56.7	0	0	0	0	111.6	G17 A18 P25	G17-T21 WeakPolarHBondContact O-CB 3.45Å; G17-T21 PolarHBondContact O-N 2.91Å; G17-T21 PolarHBondContact O-OG1 3.42Å; A18-T21 PolarHBondContact O-N 3.42Å; T21-P25 WeakPolarHBondContact O-CD 3.47Å
22	Y	95.9	Very high	95.3	Very high	142 Å²	142	93.6 Å²	93.6	56%	0.557	52%	0.515	S	S	*	.	H	α-helix	trans	-70.9	-43.1	177.9	179.7	-93.8	0	0	0	113.1	A18 A19 A20 R26	A18-Y22 WeakPolarHBondContact O-CB 3.29Å; A18-Y22 PolarHBondContact O-N 2.95Å; A19-Y22 PolarHBondContact O-N 3.19Å; A20-Y22 VanDerWaalsContact C-N 3.3Å; A20-Y22 PolarHBondContact O-N 3.49Å; Y22-R26 VanDerWaalsContact CD2-NH1 3.28Å; Y22-R26 VanDerWaalsContact CZ-NE 3.34Å; Y22-R26 VanDerWaalsContact CZ-NH2 3.32Å; Y22-R26 PolarHBondContact O-NH1 3.37Å; Y22-R26 PolarHBondContact OH-NE 2.99Å; Y22-R26 PolarHBondContact OH-NH2 3.28Å
23	S	97.1	Very high	95.6	Very high	49 Å²	49	97 Å²	97	34%	0.343	52%	0.521	S	S	.	.	H	α-helix	trans	-80.3	-33.1	-173	-63.6	0	0	0	0	113	A19 A20 R26 L27	A19-S23 VanDerWaalsContact O-CB 3.28Å; A19-S23 WeakPolarHBondContact O-CB 3.41Å; A19-S23 PolarHBondContact O-N 3.2Å; A19-S23 PolarHBondContact O-OG 2.82Å; A20-S23 PolarHBondContact O-N 3.05Å; S23-R26 PolarHBondContact O-N 3.16Å; S23-L27 WeakPolarHBondContact O-CG 3.43Å; S23-L27 PolarHBondContact O-N 3.4Å
24	K	97.1	Very high	95.7	Very high	154 Å²	154	93.4 Å²	93.4	67%	0.67	50%	0.5	S	S	*	.	H	α-helix	trans	-49.6	-56.4	-179	-91.8	-177.9	177	-176.7	0	114.5	A20 R26 L27 A28	A20-K24 WeakPolarHBondContact O-CB 3.44Å; A20-K24 WeakPolarHBondContact O-CG 3.5Å; A20-K24 PolarHBondContact O-N 3.42Å; K24-R26 VanDerWaalsContact C-N 3.29Å; K24-R26 PolarHBondContact O-N 3.25Å; K24-L27 PolarHBondContact O-N 3.08Å; K24-A28 WeakPolarHBondContact O-CB 3.42Å; K24-A28 PolarHBondContact O-N 3.23Å
25	P	97.5	Very high	95.9	Very high	71 Å²	71	94.3 Å²	94.3	46%	0.461	50%	0.495	S	S	.	.	H	α-helix	trans	-64.9	-33.9	-177.9	24.4	-33.7	0	0	0	112.4	T21 A28 T29	T21-P25 WeakPolarHBondContact O-CD 3.47Å; P25-A28 WeakPolarHBondContact O-CB 3.35Å; P25-A28 PolarHBondContact O-N 3.02Å; P25-T29 PolarHBondContact O-N 3.46Å; P25-T29 PolarHBondContact O-OG1 2.93Å
26	R	96.6	Very high	95.9	Very high	129 Å²	129	93.4 Å²	93.4	49%	0.487	49%	0.494	S	S	.	.	H	α-helix	trans	-68.2	-43.6	178.4	-68.8	173.2	172.2	71.8	5.9	112	Y22 S23 K24 A28 T29 F30	Y22-R26 VanDerWaalsContact CD2-NH1 3.28Å; Y22-R26 VanDerWaalsContact CZ-NE 3.34Å; Y22-R26 VanDerWaalsContact CZ-NH2 3.32Å; Y22-R26 PolarHBondContact O-NH1 3.37Å; Y22-R26 PolarHBondContact OH-NE 2.99Å; Y22-R26 PolarHBondContact OH-NH2 3.28Å; S23-R26 PolarHBondContact O-N 3.16Å; K24-R26 VanDerWaalsContact C-N 3.29Å; K24-R26 PolarHBondContact O-N 3.25Å; R26-A28 VanDerWaalsContact C-N 3.29Å; R26-A28 PolarHBondContact O-N 2.92Å; R26-T29 PolarHBondContact O-N 3.28Å; R26-F30 PolarHBondContact O-N 3.08Å
27	L	97	Very high	96	Very high	109 Å²	109	95.3 Å²	95.3	57%	0.571	50%	0.5	S	S	*	.	H	α-helix	trans	-66	-34.1	174.4	-68.6	176.9	0	0	0	111.5	S23 K24 F30 W31	S23-L27 WeakPolarHBondContact O-CG 3.43Å; S23-L27 PolarHBondContact O-N 3.4Å; K24-L27 PolarHBondContact O-N 3.08Å; L27-F30 PolarHBondContact O-N 3.06Å; L27-W31 WeakPolarHBondContact O-CB 3.35Å; L27-W31 PolarHBondContact O-N 3.27Å
28	A	97.2	Very high	96	Very high	60 Å²	60	98 Å²	98	50%	0.496	51%	0.505	S	S	.	.	H	α-helix	trans	-64.4	-44	173.8	0	0	0	0	0	111.9	K24 P25 R26 W31 H32	K24-A28 WeakPolarHBondContact O-CB 3.42Å; K24-A28 PolarHBondContact O-N 3.23Å; P25-A28 WeakPolarHBondContact O-CB 3.35Å; P25-A28 PolarHBondContact O-N 3.02Å; R26-A28 VanDerWaalsContact C-N 3.29Å; R26-A28 PolarHBondContact O-N 2.92Å; A28-W31 PolarHBondContact O-N 2.91Å; A28-H32 PolarHBondContact O-N 2.96Å
29	T	97.1	Very high	95.9	Very high	80 Å²	80	99.3 Å²	99.3	49%	0.491	51%	0.507	S	S	.	.	H	α-helix	trans	-62.9	-45.5	173.8	-57.1	0	0	0	0	111.7	P25 R26 W31 H32 Y33	P25-T29 PolarHBondContact O-N 3.46Å; P25-T29 PolarHBondContact O-OG1 2.93Å; R26-T29 PolarHBondContact O-N 3.28Å; T29-W31 VanDerWaalsContact C-N 3.32Å; T29-W31 PolarHBondContact O-N 3.39Å; T29-H32 WeakPolarHBondContact O-CB 3.44Å; T29-H32 PolarHBondContact O-N 3.48Å; T29-Y33 HydrophobicContact CG2-CD2 4.14Å; T29-Y33 HydrophobicContact CG2-CE2 3.76Å; T29-Y33 VanDerWaalsContact O-CD2 3.27Å; T29-Y33 WeakPolarHBondContact O-CD2 3.46Å; T29-Y33 PolarHBondContact O-N 3.31Å
30	F	96.3	Very high	95.8	Very high	118 Å²	118	102 Å²	102	52%	0.518	52%	0.52	S	S	.	.	H	α-helix	trans	-56.2	-48.3	174.4	168.2	-101.6	0	0	0	111.2	R26 L27 H32 Y33 A34	R26-F30 PolarHBondContact O-N 3.08Å; L27-F30 PolarHBondContact O-N 3.06Å; F30-H32 VanDerWaalsContact C-N 3.31Å; F30-H32 PolarHBondContact O-N 3.49Å; F30-Y33 PolarHBondContact O-N 3.41Å; F30-A34 HydrophobicContact CE1-CB 4.17Å; F30-A34 HydrophobicContact CE2-CB 4.34Å; F30-A34 HydrophobicContact CZ-CB 4.05Å; F30-A34 VanDerWaalsContact O-CB 3.26Å; F30-A34 WeakPolarHBondContact O-CB 3.45Å; F30-A34 PolarHBondContact O-N 3.36Å
31	W	97	Very high	95.7	Very high	149 Å²	149	104 Å²	104	56%	0.564	53%	0.53	S	S	*	.	H	α-helix	trans	-64.2	-35.1	-179	-173.4	-121.6	0	0	0	113.2	L27 A28 T29 K35	L27-W31 WeakPolarHBondContact O-CB 3.35Å; L27-W31 PolarHBondContact O-N 3.27Å; A28-W31 PolarHBondContact O-N 2.91Å; T29-W31 VanDerWaalsContact C-N 3.32Å; T29-W31 PolarHBondContact O-N 3.39Å; W31-K35 HydrophobicContact CD2-CD 4.46Å; W31-K35 HydrophobicContact CD2-CG 4.29Å; W31-K35 HydrophobicContact CZ2-CD 4.45Å; W31-K35 HydrophobicContact CZ2-CG 4.28Å; W31-K35 VanDerWaalsContact NE1-NZ 3.13Å; W31-K35 WeakPolarHBondContact O-CB 2.96Å; W31-K35 WeakPolarHBondContact O-CG 3.33Å; W31-K35 PolarHBondContact O-N 3.08Å
32	H	96.4	Very high	95.6	Very high	126 Å²	126	101.7 Å²	101.7	58%	0.583	52%	0.518	S	S	*	.	H	α-helix	trans	-57.8	-48.1	175.4	177.4	71.1	0	0	0	111.7	A28 T29 F30	A28-H32 PolarHBondContact O-N 2.96Å; T29-H32 WeakPolarHBondContact O-CB 3.44Å; T29-H32 PolarHBondContact O-N 3.48Å; F30-H32 VanDerWaalsContact C-N 3.31Å; F30-H32 PolarHBondContact O-N 3.49Å
33	Y	97.3	Very high	95.4	Very high	137 Å²	137	99.9 Å²	99.9	54%	0.537	52%	0.524	S	S	.	.	H	α-helix	trans	-77.7	-41.1	178.8	-65.1	-63.3	0	0	0	112.9	T29 F30 K35 V36 E37	T29-Y33 HydrophobicContact CG2-CD2 4.14Å; T29-Y33 HydrophobicContact CG2-CE2 3.76Å; T29-Y33 VanDerWaalsContact O-CD2 3.27Å; T29-Y33 WeakPolarHBondContact O-CD2 3.46Å; T29-Y33 PolarHBondContact O-N 3.31Å; F30-Y33 PolarHBondContact O-N 3.41Å; Y33-K35 PolarHBondContact O-N 3.22Å; Y33-K35 VanDerWaalsContact O-N 3.15Å; Y33-V36 WeakPolarHBondContact O-CG2 3.43Å; Y33-V36 PolarHBondContact O-N 3.15Å; Y33-E37 PolarHBondContact O-N 3.44Å
34	A	94.8	Very high	95.3	Very high	14 Å²	14	101.1 Å²	101.1	12%	0.116	54%	0.536	C	S	.	.	H	α-helix	trans	-58.1	-32.9	-179	0	0	0	0	0	112.5	F30 V36 L38	F30-A34 HydrophobicContact CE1-CB 4.17Å; F30-A34 HydrophobicContact CE2-CB 4.34Å; F30-A34 HydrophobicContact CZ-CB 4.05Å; F30-A34 VanDerWaalsContact O-CB 3.26Å; F30-A34 WeakPolarHBondContact O-CB 3.45Å; F30-A34 PolarHBondContact O-N 3.36Å; A34-V36 PolarHBondContact O-N 3.48Å; A34-L38 HydrophobicContact CB-CD1 4.03Å; A34-L38 WeakPolarHBondContact O-CB 3.48Å; A34-L38 PolarHBondContact O-N 2.99Å; A34-L38 VanDerWaalsContact O-N 3.09Å
35	K	94.6	Very high	95.1	Very high	121 Å²	121	98.9 Å²	98.9	53%	0.526	53%	0.529	S	S	.	.	H	α-helix	trans	-63.4	-24.3	177.7	-87.5	176.5	158	171.8	0	115	W31 Y33	W31-K35 HydrophobicContact CD2-CD 4.46Å; W31-K35 HydrophobicContact CD2-CG 4.29Å; W31-K35 HydrophobicContact CZ2-CD 4.45Å; W31-K35 HydrophobicContact CZ2-CG 4.28Å; W31-K35 VanDerWaalsContact NE1-NZ 3.13Å; W31-K35 WeakPolarHBondContact O-CB 2.96Å; W31-K35 WeakPolarHBondContact O-CG 3.33Å; W31-K35 PolarHBondContact O-N 3.08Å; Y33-K35 PolarHBondContact O-N 3.22Å; Y33-K35 VanDerWaalsContact O-N 3.15Å
36	V	94.4	Very high	95	Very high	95 Å²	95	99.9 Å²	99.9	58%	0.576	53%	0.529	S	S	*	.	H	α-helix	trans	-112.4	-34.3	-176.8	-60.2	0	0	0	0	112.1	Y33 A34	Y33-V36 WeakPolarHBondContact O-CG2 3.43Å; Y33-V36 PolarHBondContact O-N 3.15Å; A34-V36 PolarHBondContact O-N 3.48Å
37	E	94.1	Very high	95	Very high	149 Å²	149	97 Å²	97	70%	0.696	53%	0.527	S	S	*	.	H	α-helix	trans	-92	-27.3	-176.9	-58.2	-60.5	159.2	0	0	113.6	Y33	Y33-E37 PolarHBondContact O-N 3.44Å
38	L	93.7	Very high	95	Very high	92 Å²	92	98 Å²	98	48%	0.482	53%	0.529	S	S	.	.	S	Bend	trans	-112	12.1	-174.8	-57.6	178.6	0	0	0	113	A34 W86	A34-L38 HydrophobicContact CB-CD1 4.03Å; A34-L38 WeakPolarHBondContact O-CB 3.48Å; A34-L38 PolarHBondContact O-N 2.99Å; A34-L38 VanDerWaalsContact O-N 3.09Å; L38-W86 HydrophobicContact CD2-CZ2 4.09Å
39	V	93.9	Very high	94.9	Very high	86 Å²	86	98 Å²	98	52%	0.521	53%	0.529	S	S	.	.	S	Bend	trans	-78.4	142.4	176.1	67.4	0	0	0	0	109.6
40	P	92.6	Very high	94.8	Very high	108 Å²	108	98.2 Å²	98.2	70%	0.701	53%	0.526	S	S	*	.	P	Polyproline II helix	trans	-54.3	137.6	168.9	-25.7	34.9	0	0	0	110.5
41	P	92.6	Very high	94.8	Very high	89 Å²	89	96.3 Å²	96.3	58%	0.578	52%	0.52	S	S	*	.	P	Polyproline II helix	trans	-64	152.7	-178.4	27.7	-35.2	0	0	0	111.1	E45	P41-E45 VanDerWaalsContact CA-OE2 3.29Å; P41-E45 WeakPolarHBondContact CA-OE2 3.44Å; P41-E45 HydrophobicContact CB-CB 4.41Å; P41-E45 WeakPolarHBondContact CB-OE2 3.4Å
42	S	93.9	Very high	94.7	Very high	57 Å²	57	90.7 Å²	90.7	40%	0.399	51%	0.509	S	S	.	.	P	Polyproline II helix	trans	-65.6	144.3	168.4	166.1	0	0	0	0	110.2	A44 E45	S42-A44 PolarHBondContact O-N 3.34Å; S42-A44 PolarHBondContact OG-N 3.22Å; S42-E45 PolarHBondContact N-OE2 2.98Å; S42-E45 WeakPolarHBondContact O-CB 3.41Å; S42-E45 PolarHBondContact O-N 3.44Å
43	P	93.1	Very high	94.7	Very high	105 Å²	105	89.8 Å²	89.8	68%	0.682	51%	0.507	S	S	*	.	G	3₁₀ helix	trans	-53.1	-28	173.5	-27.7	35.5	0	0	0	114.1	E45 I46 P47	P43-E45 PolarHBondContact O-N 3.46Å; P43-I46 PolarHBondContact O-N 3.22Å; P43-P47 WeakPolarHBondContact O-CD 3.48Å
44	A	93.9	Very high	94.6	Very high	74 Å²	74	89.4 Å²	89.4	61%	0.612	51%	0.508	S	S	*	.	G	3₁₀ helix	trans	-69.1	-18.9	177.6	0	0	0	0	0	113.8	S42 P47	S42-A44 PolarHBondContact O-N 3.34Å; S42-A44 PolarHBondContact OG-N 3.22Å; A44-P47 WeakPolarHBondContact O-CD 3.41Å
45	E	94.3	Very high	94.6	Very high	108 Å²	108	93.1 Å²	93.1	51%	0.505	53%	0.526	S	S	.	.	G	3₁₀ helix	trans	-86.8	-19.2	-179	-63	171.8	139.7	0	0	112	P41 S42 P43 Q48 A49	P41-E45 VanDerWaalsContact CA-OE2 3.29Å; P41-E45 WeakPolarHBondContact CA-OE2 3.44Å; P41-E45 HydrophobicContact CB-CB 4.41Å; P41-E45 WeakPolarHBondContact CB-OE2 3.4Å; S42-E45 PolarHBondContact N-OE2 2.98Å; S42-E45 WeakPolarHBondContact O-CB 3.41Å; S42-E45 PolarHBondContact O-N 3.44Å; P43-E45 PolarHBondContact O-N 3.46Å; E45-Q48 WeakPolarHBondContact O-CB 3.42Å; E45-Q48 PolarHBondContact O-N 3.47Å; E45-Q48 VanDerWaalsContact O-N 3.13Å; E45-A49 PolarHBondContact O-N 2.91Å
46	I	95.1	Very high	94.5	Very high	91 Å²	91	92.7 Å²	92.7	47%	0.467	53%	0.529	S	S	.	.	H	α-helix	trans	-59.6	-46.9	-178.9	-58.9	173.9	0	0	0	112.2	P43 Q48 A49 I50	P43-I46 PolarHBondContact O-N 3.22Å; I46-Q48 PolarHBondContact O-N 3.06Å; I46-A49 WeakPolarHBondContact O-CB 3.46Å; I46-A49 PolarHBondContact O-N 3.12Å; I46-I50 HydrophobicContact CG2-CD1 4.14Å; I46-I50 WeakPolarHBondContact O-CG1 3.37Å; I46-I50 PolarHBondContact O-N 2.91Å
47	P	96.6	Very high	94.5	Very high	68 Å²	68	91.8 Å²	91.8	44%	0.442	52%	0.523	S	S	.	.	H	α-helix	trans	-58.6	-35.8	176.4	-25.1	35.7	0	0	0	113.1	P43 A44 I50 I51	P43-P47 WeakPolarHBondContact O-CD 3.48Å; A44-P47 WeakPolarHBondContact O-CD 3.41Å; P47-I50 PolarHBondContact O-N 3.35Å; P47-I51 WeakPolarHBondContact O-CG1 3.45Å; P47-I51 PolarHBondContact O-N 3.46Å
48	Q	95.8	Very high	94.5	Very high	131 Å²	131	88.9 Å²	88.9	61%	0.612	52%	0.516	S	S	*	.	H	α-helix	trans	-68.9	-40.3	178.2	-60.3	-58.6	-20.5	0	0	111.6	E45 I46 I50 I51 G52	E45-Q48 WeakPolarHBondContact O-CB 3.42Å; E45-Q48 PolarHBondContact O-N 3.47Å; E45-Q48 VanDerWaalsContact O-N 3.13Å; I46-Q48 PolarHBondContact O-N 3.06Å; Q48-I50 VanDerWaalsContact C-N 3.32Å; Q48-I50 PolarHBondContact O-N 3.2Å; Q48-I51 PolarHBondContact O-N 3.43Å; Q48-G52 PolarHBondContact O-N 3.14Å
49	A	94.6	Very high	94.4	Very high	60 Å²	60	84.8 Å²	84.8	50%	0.496	50%	0.496	S	S	.	.	H	α-helix	trans	-59.8	-42.3	173.5	0	0	0	0	0	111.8	E45 I46 I51 G52 I53	E45-A49 PolarHBondContact O-N 2.91Å; I46-A49 WeakPolarHBondContact O-CB 3.46Å; I46-A49 PolarHBondContact O-N 3.12Å; A49-I51 PolarHBondContact O-N 3.44Å; A49-G52 PolarHBondContact O-N 3.49Å; A49-I53 WeakPolarHBondContact O-CG1 3.47Å; A49-I53 PolarHBondContact O-N 2.92Å
50	I	96.2	Very high	94.3	Very high	84 Å²	84	83.8 Å²	83.8	43%	0.431	49%	0.49	S	S	.	.	H	α-helix	trans	-62.4	-42.4	176.5	-65.8	168.2	0	0	0	111.3	I46 P47 Q48 G52 I53 K54	I46-I50 HydrophobicContact CG2-CD1 4.14Å; I46-I50 WeakPolarHBondContact O-CG1 3.37Å; I46-I50 PolarHBondContact O-N 2.91Å; P47-I50 PolarHBondContact O-N 3.35Å; Q48-I50 VanDerWaalsContact C-N 3.32Å; Q48-I50 PolarHBondContact O-N 3.2Å; I50-G52 VanDerWaalsContact C-N 3.32Å; I50-I53 PolarHBondContact O-N 3.07Å; I50-K54 WeakPolarHBondContact O-CG 3.47Å; I50-K54 PolarHBondContact O-N 3.07Å
51	I	96.8	Very high	94.3	Very high	78 Å²	78	84.8 Å²	84.8	40%	0.4	49%	0.489	S	S	.	.	H	α-helix	trans	-62	-42.3	175	-68.1	163.8	0	0	0	110.4	P47 Q48 A49 I53 K54 N55	P47-I51 WeakPolarHBondContact O-CG1 3.45Å; P47-I51 PolarHBondContact O-N 3.46Å; Q48-I51 PolarHBondContact O-N 3.43Å; A49-I51 PolarHBondContact O-N 3.44Å; I51-I53 PolarHBondContact O-N 3.43Å; I51-K54 PolarHBondContact O-N 3.24Å; I51-N55 PolarHBondContact O-N 3.31Å; I51-N55 PolarHBondContact O-ND2 3.26Å
52	G	94.6	Very high	94.3	Very high	32 Å²	32	84.7 Å²	84.7	33%	0.33	49%	0.491	S	S	.	.	H	α-helix	trans	-55.4	-47.8	174.4	0	0	0	0	0	112.7	Q48 A49 I50 K54 N55 I56	Q48-G52 PolarHBondContact O-N 3.14Å; A49-G52 PolarHBondContact O-N 3.49Å; I50-G52 VanDerWaalsContact C-N 3.32Å; G52-K54 PolarHBondContact O-N 3.08Å; G52-N55 PolarHBondContact O-N 3.18Å; G52-I56 WeakPolarHBondContact O-CG1 3.44Å; G52-I56 PolarHBondContact O-N 3.22Å; G52-I56 VanDerWaalsContact O-N 3.08Å
53	I	95.2	Very high	94.1	Very high	106 Å²	106	84.1 Å²	84.1	54%	0.544	49%	0.494	S	S	.	.	H	α-helix	trans	-60.1	-45.6	176.7	-65.8	165.8	0	0	0	111	A49 I50 I51 N55 I56 V57	A49-I53 WeakPolarHBondContact O-CG1 3.47Å; A49-I53 PolarHBondContact O-N 2.92Å; I50-I53 PolarHBondContact O-N 3.07Å; I51-I53 PolarHBondContact O-N 3.43Å; I53-N55 VanDerWaalsContact C-N 3.3Å; I53-N55 PolarHBondContact O-N 3.37Å; I53-I56 WeakPolarHBondContact O-CB 3.27Å; I53-I56 PolarHBondContact O-N 3.47Å; I53-I56 VanDerWaalsContact O-N 3.15Å; I53-V57 WeakPolarHBondContact O-CG2 3.37Å; I53-V57 PolarHBondContact O-N 3.15Å
54	K	96.6	Very high	93.9	Very high	130 Å²	130	85.4 Å²	85.4	57%	0.565	49%	0.485	S	S	*	.	H	α-helix	trans	-58.7	-41.5	177.1	-71.7	177.5	180	-179.2	0	112	I50 I51 G52 I56 V57 T58	I50-K54 WeakPolarHBondContact O-CG 3.47Å; I50-K54 PolarHBondContact O-N 3.07Å; I51-K54 PolarHBondContact O-N 3.24Å; G52-K54 PolarHBondContact O-N 3.08Å; K54-I56 VanDerWaalsContact C-N 3.31Å; K54-I56 PolarHBondContact O-N 2.93Å; K54-V57 PolarHBondContact O-N 3.41Å; K54-T58 PolarHBondContact O-N 3.46Å; K54-T58 PolarHBondContact O-OG1 2.95Å; K54-T58 VanDerWaalsContact O-OG1 3.08Å
55	N	94.6	Very high	93.5	Very high	91 Å²	91	87.3 Å²	87.3	49%	0.487	48%	0.484	S	S	.	.	H	α-helix	trans	-65.8	-33.9	178.2	-70.7	-21.1	0	0	0	112.9	I51 G52 I53 G59 R64	I51-N55 PolarHBondContact O-N 3.31Å; I51-N55 PolarHBondContact O-ND2 3.26Å; G52-N55 PolarHBondContact O-N 3.18Å; I53-N55 VanDerWaalsContact C-N 3.3Å; I53-N55 PolarHBondContact O-N 3.37Å; N55-G59 PolarHBondContact O-N 3.3Å; N55-R64 PolarHBondContact O-NH2 3.24Å
56	I	92.9	Very high	93.1	Very high	113 Å²	113	85.9 Å²	85.9	58%	0.579	50%	0.498	S	S	*	.	H	α-helix	trans	-63.5	-51.9	172.6	-66.9	167.1	0	0	0	109.3	G52 I53 K54 T58 G59 V60	G52-I56 WeakPolarHBondContact O-CG1 3.44Å; G52-I56 PolarHBondContact O-N 3.22Å; G52-I56 VanDerWaalsContact O-N 3.08Å; I53-I56 WeakPolarHBondContact O-CB 3.27Å; I53-I56 PolarHBondContact O-N 3.47Å; I53-I56 VanDerWaalsContact O-N 3.15Å; K54-I56 VanDerWaalsContact C-N 3.31Å; K54-I56 PolarHBondContact O-N 2.93Å; I56-T58 PolarHBondContact O-N 3.25Å; I56-G59 WeakPolarHBondContact O-CA 3.48Å; I56-G59 PolarHBondContact O-N 2.83Å; I56-G59 VanDerWaalsContact O-N 3.08Å; I56-V60 WeakPolarHBondContact O-CG2 3.35Å; I56-V60 PolarHBondContact O-N 3.1Å
57	V	94.3	Very high	92.9	Very high	76 Å²	76	89.2 Å²	89.2	46%	0.461	51%	0.512	S	S	.	.	H	α-helix	trans	-58	-48.1	179.9	174.6	0	0	0	0	111.6	I53 K54 G59 V60 N61	I53-V57 WeakPolarHBondContact O-CG2 3.37Å; I53-V57 PolarHBondContact O-N 3.15Å; K54-V57 PolarHBondContact O-N 3.41Å; V57-G59 VanDerWaalsContact C-N 3.29Å; V57-G59 PolarHBondContact O-N 3.4Å; V57-V60 PolarHBondContact O-N 3.04Å; V57-N61 PolarHBondContact O-N 3.02Å; V57-N61 PolarHBondContact O-ND2 3.41Å
58	T	94.5	Very high	92.7	Very high	88 Å²	88	88.7 Å²	88.7	54%	0.54	51%	0.508	S	S	.	.	H	α-helix	trans	-60	-40.2	176.2	-58.8	0	0	0	0	111.8	K54 I56 N61 S62	K54-T58 PolarHBondContact O-N 3.46Å; K54-T58 PolarHBondContact O-OG1 2.95Å; K54-T58 VanDerWaalsContact O-OG1 3.08Å; I56-T58 PolarHBondContact O-N 3.25Å; T58-N61 PolarHBondContact O-N 3.48Å; T58-S62 WeakPolarHBondContact O-CB 3.49Å; T58-S62 PolarHBondContact O-N 3.18Å; T58-S62 PolarHBondContact O-OG 3.27Å
59	G	90.8	Very high	92.7	Very high	6 Å²	6	86 Å²	86	6%	0.062	50%	0.5	C	S	.	.	H	α-helix	trans	-65.1	-35.7	176.5	0	0	0	0	0	113.7	N55 I56 V57 S62 R64	N55-G59 PolarHBondContact O-N 3.3Å; I56-G59 WeakPolarHBondContact O-CA 3.48Å; I56-G59 PolarHBondContact O-N 2.83Å; I56-G59 VanDerWaalsContact O-N 3.08Å; V57-G59 VanDerWaalsContact C-N 3.29Å; V57-G59 PolarHBondContact O-N 3.4Å; G59-S62 PolarHBondContact O-OG 3.42Å; G59-R64 WeakPolarHBondContact O-CB 3.46Å; G59-R64 PolarHBondContact O-N 3.49Å
60	V	91.4	Very high	92.8	Very high	65 Å²	65	89.2 Å²	89.2	39%	0.394	51%	0.514	S	S	.	.	H	α-helix	trans	-65.9	-48.8	173.1	173.8	0	0	0	0	110.1	I56 V57 S62 G63 L65	I56-V60 WeakPolarHBondContact O-CG2 3.35Å; I56-V60 PolarHBondContact O-N 3.1Å; V57-V60 PolarHBondContact O-N 3.04Å; V60-S62 VanDerWaalsContact C-N 3.27Å; V60-S62 PolarHBondContact O-N 3.05Å; V60-G63 PolarHBondContact O-N 3.09Å; V60-G63 VanDerWaalsContact O-N 3.07Å; V60-L65 HydrophobicContact CB-CD1 4.27Å; V60-L65 HydrophobicContact CB-CG 4.5Å; V60-L65 HydrophobicContact CG1-CD1 3.83Å; V60-L65 HydrophobicContact CG2-CD1 3.9Å; V60-L65 HydrophobicContact CG2-CD2 4.14Å; V60-L65 HydrophobicContact CG2-CG 4.02Å
61	N	92.5	Very high	92.8	Very high	129 Å²	129	93.4 Å²	93.4	69%	0.69	53%	0.529	S	S	*	.	H	α-helix	trans	-63.5	-30.7	-179	-69.1	-18.9	0	0	0	113.3	V57 T58 G63	V57-N61 PolarHBondContact O-N 3.02Å; V57-N61 PolarHBondContact O-ND2 3.41Å; T58-N61 PolarHBondContact O-N 3.48Å; N61-G63 VanDerWaalsContact C-N 3.28Å; N61-G63 PolarHBondContact O-N 3.13Å
62	S	93.2	Very high	92.7	Very high	87 Å²	87	92.9 Å²	92.9	61%	0.608	53%	0.527	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.7	1	177	67.5	0	0	0	0	114.3	T58 G59 V60	T58-S62 WeakPolarHBondContact O-CB 3.49Å; T58-S62 PolarHBondContact O-N 3.18Å; T58-S62 PolarHBondContact O-OG 3.27Å; G59-S62 PolarHBondContact O-OG 3.42Å; V60-S62 VanDerWaalsContact C-N 3.27Å; V60-S62 PolarHBondContact O-N 3.05Å
63	G	89.2	Confident	92.7	Very high	45 Å²	45	93.9 Å²	93.9	46%	0.464	53%	0.532	S	S	.	.	T	Hydrogen-bonded Turn	trans	80.3	10.7	179.2	0	0	0	0	0	114.9	V60 N61 L65 G66	V60-G63 PolarHBondContact O-N 3.09Å; V60-G63 VanDerWaalsContact O-N 3.07Å; N61-G63 VanDerWaalsContact C-N 3.28Å; N61-G63 PolarHBondContact O-N 3.13Å; G63-L65 PolarHBondContact O-N 2.82Å; G63-L65 VanDerWaalsContact O-N 3.1Å; G63-G66 PolarHBondContact O-N 3.42Å; G63-G66 VanDerWaalsContact O-N 3.17Å
64	R	89.4	Confident	92.8	Very high	132 Å²	132	95.5 Å²	95.5	50%	0.498	54%	0.535	S	S	.	.	G	3₁₀ helix	trans	-62.9	-18.7	-178.8	-169.3	167	58.5	155	-3.1	113.6	N55 G59 G66 Q67 T68	N55-R64 PolarHBondContact O-NH2 3.24Å; G59-R64 WeakPolarHBondContact O-CB 3.46Å; G59-R64 PolarHBondContact O-N 3.49Å; R64-G66 VanDerWaalsContact C-N 3.27Å; R64-G66 PolarHBondContact O-N 3.29Å; R64-Q67 PolarHBondContact O-N 3.38Å; R64-Q67 VanDerWaalsContact O-N 3.09Å; R64-T68 PolarHBondContact O-OG1 3.33Å
65	L	84.7	Confident	92.9	Very high	113 Å²	113	97.6 Å²	97.6	59%	0.592	54%	0.539	S	S	*	.	G	3₁₀ helix	trans	-56.8	-40.2	173.8	-71	-178.9	0	0	0	112.3	V60 G63 Q67 T68	V60-L65 HydrophobicContact CB-CD1 4.27Å; V60-L65 HydrophobicContact CB-CG 4.5Å; V60-L65 HydrophobicContact CG1-CD1 3.83Å; V60-L65 HydrophobicContact CG2-CD1 3.9Å; V60-L65 HydrophobicContact CG2-CD2 4.14Å; V60-L65 HydrophobicContact CG2-CG 4.02Å; G63-L65 PolarHBondContact O-N 2.82Å; G63-L65 VanDerWaalsContact O-N 3.1Å; L65-Q67 PolarHBondContact O-N 2.86Å; L65-T68 WeakPolarHBondContact O-CB 3.31Å; L65-T68 PolarHBondContact O-N 2.92Å; L65-T68 VanDerWaalsContact O-N 3.13Å; L65-T68 PolarHBondContact O-OG1 3.44Å
66	G	86.9	Confident	92.9	Very high	78 Å²	78	97.9 Å²	97.9	80%	0.804	54%	0.541	S	S	*	.	G	3₁₀ helix	trans	-68.7	-12.7	179.3	0	0	0	0	0	114.3	G63 R64	G63-G66 PolarHBondContact O-N 3.42Å; G63-G66 VanDerWaalsContact O-N 3.17Å; R64-G66 VanDerWaalsContact C-N 3.27Å; R64-G66 PolarHBondContact O-N 3.29Å
67	Q	90.4	Very high	93.1	Very high	161 Å²	161	94.1 Å²	94.1	75%	0.752	53%	0.53	S	S	*	.	G	3₁₀ helix	trans	-97.9	-2.7	177.5	-58.5	176.2	1.6	0	0	112.4	R64 L65	R64-Q67 PolarHBondContact O-N 3.38Å; R64-Q67 VanDerWaalsContact O-N 3.09Å; L65-Q67 PolarHBondContact O-N 2.86Å
68	T	92.3	Very high	93.3	Very high	57 Å²	57	95.2 Å²	95.2	35%	0.35	53%	0.532	S	S	.	.			trans	-81.2	131	-177.7	-56.6	0	0	0	0	110.3	R64 L65 D72 A73	R64-T68 PolarHBondContact O-OG1 3.33Å; L65-T68 WeakPolarHBondContact O-CB 3.31Å; L65-T68 PolarHBondContact O-N 2.92Å; L65-T68 VanDerWaalsContact O-N 3.13Å; L65-T68 PolarHBondContact O-OG1 3.44Å; T68-D72 HydrophobicContact CG2-CB 3.83Å; T68-A73 HydrophobicContact CG2-CB 4.27Å
69	T	96.1	Very high	93.4	Very high	75 Å²	75	94.4 Å²	94.4	46%	0.46	53%	0.527	S	S	.	.			trans	-70.2	154.1	177.5	77.4	0	0	0	0	111.1	K71 D72 A73	T69-K71 PolarHBondContact O-N 3Å; T69-D72 PolarHBondContact O-N 3.29Å; T69-D72 VanDerWaalsContact O-N 3.11Å; T69-D72 PolarHBondContact OG1-N 3.39Å; T69-D72 PolarHBondContact OG1-OD2 2.94Å; T69-A73 PolarHBondContact O-N 2.96Å
70	V	96.3	Very high	93.7	Very high	128 Å²	128	97.6 Å²	97.6	78%	0.776	55%	0.548	S	S	*	.	H	α-helix	trans	-57.9	-37.1	177.6	178.2	0	0	0	0	111.6	D72 A73 F74	V70-D72 PolarHBondContact O-N 3.04Å; V70-A73 PolarHBondContact O-N 3.15Å; V70-F74 VanDerWaalsContact O-CB 3.26Å; V70-F74 WeakPolarHBondContact O-CB 3.48Å; V70-F74 PolarHBondContact O-N 3.17Å
71	K	96.7	Very high	94	Very high	171 Å²	171	98 Å²	98	74%	0.743	55%	0.55	S	S	*	*	H	α-helix	trans	-60.5	-45.7	177	-179	-177.4	175.7	-175.5	0	111.6	T69 F74 R75	T69-K71 PolarHBondContact O-N 3Å; K71-F74 PolarHBondContact O-N 3.18Å; K71-R75 WeakPolarHBondContact O-CB 3.47Å; K71-R75 PolarHBondContact O-N 3.41Å
72	D	94.8	Very high	94.2	Very high	68 Å²	68	97 Å²	97	36%	0.364	54%	0.542	S	S	.	.	H	α-helix	trans	-71.1	-42	-178.9	-61	-39.6	0	0	0	111.3	T68 T69 V70 F74 R75 N76	T68-D72 HydrophobicContact CG2-CB 3.83Å; T69-D72 PolarHBondContact O-N 3.29Å; T69-D72 VanDerWaalsContact O-N 3.11Å; T69-D72 PolarHBondContact OG1-N 3.39Å; T69-D72 PolarHBondContact OG1-OD2 2.94Å; V70-D72 PolarHBondContact O-N 3.04Å; D72-F74 VanDerWaalsContact C-N 3.3Å; D72-F74 PolarHBondContact O-N 3.44Å; D72-R75 PolarHBondContact O-N 2.98Å; D72-N76 WeakPolarHBondContact O-CB 3.45Å; D72-N76 PolarHBondContact O-N 3.43Å; D72-N76 PolarHBondContact O-ND2 3.35Å
73	A	94.8	Very high	94.4	Very high	52 Å²	52	97.4 Å²	97.4	43%	0.43	54%	0.54	S	S	.	.	H	α-helix	trans	-58.2	-44.9	174.4	0	0	0	0	0	111.2	T68 T69 V70 N76 G77	T68-A73 HydrophobicContact CG2-CB 4.27Å; T69-A73 PolarHBondContact O-N 2.96Å; V70-A73 PolarHBondContact O-N 3.15Å; A73-N76 PolarHBondContact O-N 3.21Å; A73-G77 PolarHBondContact O-N 3.17Å
74	F	97.3	Very high	94.8	Very high	141 Å²	141	99.8 Å²	99.8	62%	0.618	54%	0.542	S	S	*	.	H	α-helix	trans	-65.6	-45.9	178.4	-170.9	-109.4	0	0	0	112.2	V70 K71 D72 N76 G77 L78	V70-F74 VanDerWaalsContact O-CB 3.26Å; V70-F74 WeakPolarHBondContact O-CB 3.48Å; V70-F74 PolarHBondContact O-N 3.17Å; K71-F74 PolarHBondContact O-N 3.18Å; D72-F74 VanDerWaalsContact C-N 3.3Å; D72-F74 PolarHBondContact O-N 3.44Å; F74-N76 VanDerWaalsContact C-N 3.34Å; F74-N76 PolarHBondContact O-N 2.84Å; F74-G77 PolarHBondContact O-N 3.17Å; F74-G77 VanDerWaalsContact O-N 3.17Å; F74-L78 HydrophobicContact CD1-CD1 4.06Å; F74-L78 HydrophobicContact CD1-CG 4.42Å; F74-L78 HydrophobicContact CE1-CD1 3.72Å; F74-L78 HydrophobicContact CE1-CD2 4.4Å; F74-L78 HydrophobicContact CE1-CG 4.14Å; F74-L78 HydrophobicContact CZ-CD1 4.34Å; F74-L78 HydrophobicContact CZ-CD2 4.19Å; F74-L78 HydrophobicContact CZ-CG 4.35Å; F74-L78 WeakPolarHBondContact O-CG 3.49Å; F74-L78 PolarHBondContact O-N 3.37Å
75	R	97.5	Very high	95.2	Very high	173 Å²	173	97.9 Å²	97.9	65%	0.653	54%	0.54	S	S	*	.	H	α-helix	trans	-56.7	-47.6	175.1	179	-175.3	173.6	-171.7	-1.5	111.6	K71 D72 G77 L78 V79	K71-R75 WeakPolarHBondContact O-CB 3.47Å; K71-R75 PolarHBondContact O-N 3.41Å; D72-R75 PolarHBondContact O-N 2.98Å; R75-G77 VanDerWaalsContact C-N 3.3Å; R75-G77 PolarHBondContact O-N 3.26Å; R75-L78 PolarHBondContact O-N 3.36Å; R75-V79 PolarHBondContact O-N 3.46Å; R75-V79 VanDerWaalsContact O-N 3.16Å
76	N	95.3	Very high	95.7	Very high	98 Å²	98	98.9 Å²	98.9	52%	0.524	54%	0.536	S	S	.	.	H	α-helix	trans	-65.5	-35.9	179	-67.6	-21.1	0	0	0	111.5	D72 A73 F74 V79 C80	D72-N76 WeakPolarHBondContact O-CB 3.45Å; D72-N76 PolarHBondContact O-N 3.43Å; D72-N76 PolarHBondContact O-ND2 3.35Å; A73-N76 PolarHBondContact O-N 3.21Å; F74-N76 VanDerWaalsContact C-N 3.34Å; F74-N76 PolarHBondContact O-N 2.84Å; N76-V79 PolarHBondContact O-N 3.16Å; N76-C80 WeakPolarHBondContact O-CB 3.26Å; N76-C80 PolarHBondContact O-N 3.39Å
77	G	96.6	Very high	96.2	Very high	33 Å²	33	102 Å²	102	34%	0.34	53%	0.527	S	S	.	.	H	α-helix	trans	-62.5	-39.9	172.9	0	0	0	0	0	113.3	A73 F74 R75 C80 T81	A73-G77 PolarHBondContact O-N 3.17Å; F74-G77 PolarHBondContact O-N 3.17Å; F74-G77 VanDerWaalsContact O-N 3.17Å; R75-G77 VanDerWaalsContact C-N 3.3Å; R75-G77 PolarHBondContact O-N 3.26Å; G77-C80 PolarHBondContact O-N 3Å; G77-T81 WeakPolarHBondContact O-CB 3.29Å; G77-T81 PolarHBondContact O-N 2.98Å; G77-T81 PolarHBondContact O-OG1 3.29Å
78	L	98.3	Very high	96.5	Very high	99 Å²	99	100.1 Å²	100.1	52%	0.518	51%	0.514	S	S	.	.	H	α-helix	trans	-63.5	-45.6	175	-69.4	176.2	0	0	0	111.7	F74 R75 C80 T81 E82	F74-L78 HydrophobicContact CD1-CD1 4.06Å; F74-L78 HydrophobicContact CD1-CG 4.42Å; F74-L78 HydrophobicContact CE1-CD1 3.72Å; F74-L78 HydrophobicContact CE1-CD2 4.4Å; F74-L78 HydrophobicContact CE1-CG 4.14Å; F74-L78 HydrophobicContact CZ-CD1 4.34Å; F74-L78 HydrophobicContact CZ-CD2 4.19Å; F74-L78 HydrophobicContact CZ-CG 4.35Å; F74-L78 WeakPolarHBondContact O-CG 3.49Å; F74-L78 PolarHBondContact O-N 3.37Å; R75-L78 PolarHBondContact O-N 3.36Å; L78-C80 VanDerWaalsContact C-N 3.34Å; L78-C80 PolarHBondContact O-N 3.3Å; L78-T81 PolarHBondContact O-N 3.02Å; L78-E82 PolarHBondContact O-N 2.76Å
79	V	97.2	Very high	96.7	Very high	71 Å²	71	101.2 Å²	101.2	43%	0.43	52%	0.517	S	S	.	.	H	α-helix	trans	-62.6	-42.2	175.9	177.2	0	0	0	0	111	R75 N76 T81 E82 V83	R75-V79 PolarHBondContact O-N 3.46Å; R75-V79 VanDerWaalsContact O-N 3.16Å; N76-V79 PolarHBondContact O-N 3.16Å; V79-T81 VanDerWaalsContact C-N 3.31Å; V79-T81 PolarHBondContact O-N 2.95Å; V79-E82 WeakPolarHBondContact O-CB 3.4Å; V79-E82 PolarHBondContact O-N 3.28Å; V79-V83 WeakPolarHBondContact O-CG2 3.36Å; V79-V83 PolarHBondContact O-N 3.02Å
80	C	96.9	Very high	96.7	Very high	73 Å²	73	99.5 Å²	99.5	49%	0.493	51%	0.514	S	S	.	.	H	α-helix	trans	-59.2	-44.1	175	-175	0	0	0	0	111.6	N76 G77 L78 E82 V83 L84	N76-C80 WeakPolarHBondContact O-CB 3.26Å; N76-C80 PolarHBondContact O-N 3.39Å; G77-C80 PolarHBondContact O-N 3Å; L78-C80 VanDerWaalsContact C-N 3.34Å; L78-C80 PolarHBondContact O-N 3.3Å; C80-E82 PolarHBondContact O-N 2.9Å; C80-V83 PolarHBondContact O-N 3.36Å; C80-L84 WeakPolarHBondContact O-CG 3.41Å; C80-L84 PolarHBondContact O-N 3.44Å
81	T	98.1	Very high	96.8	Very high	73 Å²	73	96 Å²	96	45%	0.448	49%	0.49	S	S	.	.	H	α-helix	trans	-63.8	-41.6	177.9	-55.1	0	0	0	0	111.5	G77 L78 V79 V83 L84 M85	G77-T81 WeakPolarHBondContact O-CB 3.29Å; G77-T81 PolarHBondContact O-N 2.98Å; G77-T81 PolarHBondContact O-OG1 3.29Å; L78-T81 PolarHBondContact O-N 3.02Å; V79-T81 VanDerWaalsContact C-N 3.31Å; V79-T81 PolarHBondContact O-N 2.95Å; T81-V83 PolarHBondContact O-N 2.9Å; T81-L84 WeakPolarHBondContact O-CB 3.28Å; T81-L84 PolarHBondContact O-N 2.87Å; T81-M85 WeakPolarHBondContact O-CG 3.33Å; T81-M85 PolarHBondContact O-N 3.45Å
82	E	97.4	Very high	96.8	Very high	110 Å²	110	89.9 Å²	89.9	51%	0.514	47%	0.468	S	S	.	.	H	α-helix	trans	-57.5	-47.6	174.6	-174.7	-164	179.6	0	0	111.8	L78 V79 C80 L84 M85 W86	L78-E82 PolarHBondContact O-N 2.76Å; V79-E82 WeakPolarHBondContact O-CB 3.4Å; V79-E82 PolarHBondContact O-N 3.28Å; C80-E82 PolarHBondContact O-N 2.9Å; E82-L84 VanDerWaalsContact C-N 3.3Å; E82-L84 PolarHBondContact O-N 3.37Å; E82-M85 WeakPolarHBondContact O-CB 3.4Å; E82-M85 PolarHBondContact O-N 3Å; E82-M85 VanDerWaalsContact O-N 3.08Å; E82-W86 PolarHBondContact O-N 3.04Å; E82-W86 VanDerWaalsContact O-N 3.14Å
83	V	96.1	Very high	96.8	Very high	95 Å²	95	93 Å²	93	58%	0.576	48%	0.483	S	S	*	.	H	α-helix	trans	-62	-38.1	177.4	176.1	0	0	0	0	111.5	V79 C80 T81 M85 W86 F87	V79-V83 WeakPolarHBondContact O-CG2 3.36Å; V79-V83 PolarHBondContact O-N 3.02Å; C80-V83 PolarHBondContact O-N 3.36Å; T81-V83 PolarHBondContact O-N 2.9Å; V83-M85 VanDerWaalsContact C-N 3.33Å; V83-M85 PolarHBondContact O-N 3.46Å; V83-W86 WeakPolarHBondContact O-CB 3.4Å; V83-W86 PolarHBondContact O-N 2.88Å; V83-F87 PolarHBondContact O-N 3.28Å
84	L	97.6	Very high	96.9	Very high	94 Å²	94	93.9 Å²	93.9	49%	0.492	50%	0.497	S	S	.	.	H	α-helix	trans	-64	-37.3	173.5	-69.6	171.2	0	0	0	112.1	C80 T81 E82 W86 F87 Y88	C80-L84 WeakPolarHBondContact O-CG 3.41Å; C80-L84 PolarHBondContact O-N 3.44Å; T81-L84 WeakPolarHBondContact O-CB 3.28Å; T81-L84 PolarHBondContact O-N 2.87Å; E82-L84 VanDerWaalsContact C-N 3.3Å; E82-L84 PolarHBondContact O-N 3.37Å; L84-W86 VanDerWaalsContact C-N 3.29Å; L84-W86 PolarHBondContact O-N 3.31Å; L84-F87 WeakPolarHBondContact O-CB 3.47Å; L84-F87 PolarHBondContact O-N 2.91Å; L84-Y88 VanDerWaalsContact O-CD2 3.29Å; L84-Y88 WeakPolarHBondContact O-CD2 3.22Å; L84-Y88 PolarHBondContact O-N 2.78Å
85	M	97.8	Very high	96.8	Very high	93 Å²	93	89.3 Å²	89.3	46%	0.458	48%	0.477	S	S	.	.	H	α-helix	trans	-65.5	-33.3	175.8	-66.3	-58	107.2	0	0	112.1	T81 E82 V83 F87 Y88 I89	T81-M85 WeakPolarHBondContact O-CG 3.33Å; T81-M85 PolarHBondContact O-N 3.45Å; E82-M85 WeakPolarHBondContact O-CB 3.4Å; E82-M85 PolarHBondContact O-N 3Å; E82-M85 VanDerWaalsContact O-N 3.08Å; V83-M85 VanDerWaalsContact C-N 3.33Å; V83-M85 PolarHBondContact O-N 3.46Å; M85-F87 VanDerWaalsContact C-N 3.27Å; M85-F87 PolarHBondContact O-N 2.85Å; M85-Y88 HydrophobicContact CE-CD2 3.78Å; M85-Y88 HydrophobicContact CE-CE2 3.92Å; M85-Y88 PolarHBondContact O-N 2.99Å; M85-Y88 VanDerWaalsContact O-N 3.12Å; M85-Y88 HydrophobicContact SD-CD2 4.33Å; M85-I89 WeakPolarHBondContact O-CG1 3.33Å; M85-I89 PolarHBondContact O-N 3.35Å
86	W	96.5	Very high	96.7	Very high	134 Å²	134	84.5 Å²	84.5	51%	0.508	48%	0.481	S	S	.	.	H	α-helix	trans	-60.3	-34.4	172.8	-83.2	108.8	0	0	0	113.4	L38 E82 V83 L84 I89 G90	L38-W86 HydrophobicContact CD2-CZ2 4.09Å; E82-W86 PolarHBondContact O-N 3.04Å; E82-W86 VanDerWaalsContact O-N 3.14Å; V83-W86 WeakPolarHBondContact O-CB 3.4Å; V83-W86 PolarHBondContact O-N 2.88Å; L84-W86 VanDerWaalsContact C-N 3.29Å; L84-W86 PolarHBondContact O-N 3.31Å; W86-I89 HydrophobicContact CD2-CD1 4.27Å; W86-I89 HydrophobicContact CE3-CB 4.38Å; W86-I89 HydrophobicContact CE3-CD1 3.97Å; W86-I89 HydrophobicContact CE3-CG2 4.31Å; W86-I89 HydrophobicContact CZ3-CD1 4.25Å; W86-I89 HydrophobicContact CZ3-CG2 4.33Å; W86-I89 PolarHBondContact O-N 3.43Å; W86-G90 PolarHBondContact O-N 3.31Å
87	F	96.5	Very high	96.6	Very high	143 Å²	143	81.1 Å²	81.1	63%	0.627	47%	0.47	S	S	*	.	H	α-helix	trans	-61.1	-46.7	171.8	170.1	-93.8	0	0	0	111.6	V83 L84 M85 I89 G90 E91	V83-F87 PolarHBondContact O-N 3.28Å; L84-F87 WeakPolarHBondContact O-CB 3.47Å; L84-F87 PolarHBondContact O-N 2.91Å; M85-F87 VanDerWaalsContact C-N 3.27Å; M85-F87 PolarHBondContact O-N 2.85Å; F87-I89 PolarHBondContact O-N 3.44Å; F87-G90 CarbonylContact O-C 3.6Å; F87-G90 WeakPolarHBondContact O-CA 3.47Å; F87-G90 PolarHBondContact O-N 3.38Å; F87-G90 VanDerWaalsContact O-N 3.1Å; F87-E91 PolarHBondContact O-N 3.36Å
88	Y	96.7	Very high	96.5	Very high	122 Å²	122	87 Å²	87	48%	0.478	49%	0.491	S	S	.	.	H	α-helix	trans	-68.8	-31.1	178	-67.8	-66.6	0	0	0	113.4	L84 M85 G90 E91 C92	L84-Y88 VanDerWaalsContact O-CD2 3.29Å; L84-Y88 WeakPolarHBondContact O-CD2 3.22Å; L84-Y88 PolarHBondContact O-N 2.78Å; M85-Y88 HydrophobicContact CE-CD2 3.78Å; M85-Y88 HydrophobicContact CE-CE2 3.92Å; M85-Y88 PolarHBondContact O-N 2.99Å; M85-Y88 VanDerWaalsContact O-N 3.12Å; M85-Y88 HydrophobicContact SD-CD2 4.33Å; Y88-G90 VanDerWaalsContact C-N 3.29Å; Y88-E91 WeakPolarHBondContact CD1-OE2 3.4Å; Y88-E91 WeakPolarHBondContact O-CB 3.19Å; Y88-E91 PolarHBondContact O-N 3.18Å; Y88-C92 PolarHBondContact O-N 2.85Å; Y88-C92 PolarHBondContact O-SG 3.41Å; Y88-C92 VanDerWaalsContact O-SG 3.4Å
89	I	96.8	Very high	96.4	Very high	79 Å²	79	88.8 Å²	88.8	41%	0.405	51%	0.506	S	S	.	.	H	α-helix	trans	-61.2	-43.5	169.1	-68.4	168.7	0	0	0	109.7	M85 W86 F87 E91 C92 I93	M85-I89 WeakPolarHBondContact O-CG1 3.33Å; M85-I89 PolarHBondContact O-N 3.35Å; W86-I89 HydrophobicContact CD2-CD1 4.27Å; W86-I89 HydrophobicContact CE3-CB 4.38Å; W86-I89 HydrophobicContact CE3-CD1 3.97Å; W86-I89 HydrophobicContact CE3-CG2 4.31Å; W86-I89 HydrophobicContact CZ3-CD1 4.25Å; W86-I89 HydrophobicContact CZ3-CG2 4.33Å; W86-I89 PolarHBondContact O-N 3.43Å; F87-I89 PolarHBondContact O-N 3.44Å; I89-E91 VanDerWaalsContact C-N 3.33Å; I89-E91 PolarHBondContact O-N 2.84Å; I89-C92 WeakPolarHBondContact O-CB 3.32Å; I89-C92 PolarHBondContact O-N 3.1Å; I89-I93 HydrophobicContact CG2-CD1 4.24Å; I89-I93 WeakPolarHBondContact O-CG1 3.35Å; I89-I93 PolarHBondContact O-N 2.95Å
90	G	96.5	Very high	96.2	Very high	39 Å²	39	87.5 Å²	87.5	40%	0.402	51%	0.507	S	S	.	.	H	α-helix	trans	-58.7	-41.9	172.7	0	0	0	0	0	112.9	W86 F87 Y88 I93 G94	W86-G90 PolarHBondContact O-N 3.31Å; F87-G90 CarbonylContact O-C 3.6Å; F87-G90 WeakPolarHBondContact O-CA 3.47Å; F87-G90 PolarHBondContact O-N 3.38Å; F87-G90 VanDerWaalsContact O-N 3.1Å; Y88-G90 VanDerWaalsContact C-N 3.29Å; G90-I93 PolarHBondContact O-N 2.9Å; G90-G94 PolarHBondContact O-N 3.18Å
91	E	96.9	Very high	96	Very high	56 Å²	56	91 Å²	91	26%	0.262	51%	0.511	S	S	.	.	H	α-helix	trans	-61.4	-44.1	173.8	-169.7	-152.7	116	0	0	111.9	F87 Y88 I89 I93 G94 K95	F87-E91 PolarHBondContact O-N 3.36Å; Y88-E91 WeakPolarHBondContact CD1-OE2 3.4Å; Y88-E91 WeakPolarHBondContact O-CB 3.19Å; Y88-E91 PolarHBondContact O-N 3.18Å; I89-E91 VanDerWaalsContact C-N 3.33Å; I89-E91 PolarHBondContact O-N 2.84Å; E91-I93 VanDerWaalsContact C-N 3.31Å; E91-I93 PolarHBondContact O-N 3.35Å; E91-G94 PolarHBondContact O-N 3.19Å; E91-G94 VanDerWaalsContact O-N 3.15Å; E91-K95 HydrophobicContact CG-CD 4.5Å; E91-K95 WeakPolarHBondContact O-CG 3.41Å; E91-K95 PolarHBondContact O-N 2.94Å; E91-K95 IonicContact OE1-NZ 2.91Å; E91-K95 PolarHBondContact OE1-NZ 2.91Å
92	C	96.6	Very high	95.5	Very high	41 Å²	41	92.7 Å²	92.7	28%	0.277	53%	0.532	S	S	.	.	H	α-helix	trans	-59.9	-39.6	175.6	-72.5	0	0	0	0	112.7	Y88 I89 G96 G97	Y88-C92 PolarHBondContact O-N 2.85Å; Y88-C92 PolarHBondContact O-SG 3.41Å; Y88-C92 VanDerWaalsContact O-SG 3.4Å; I89-C92 WeakPolarHBondContact O-CB 3.32Å; I89-C92 PolarHBondContact O-N 3.1Å; C92-G96 PolarHBondContact O-N 3.13Å; C92-G97 PolarHBondContact O-N 3.33Å
93	I	95.9	Very high	94.8	Very high	134 Å²	134	96.9 Å²	96.9	69%	0.687	57%	0.565	S	S	*	*	H	α-helix	trans	-65.9	-47.3	172.7	-64.6	167.4	0	0	0	110.1	I89 G90 E91 K95 G96	I89-I93 HydrophobicContact CG2-CD1 4.24Å; I89-I93 WeakPolarHBondContact O-CG1 3.35Å; I89-I93 PolarHBondContact O-N 2.95Å; G90-I93 PolarHBondContact O-N 2.9Å; E91-I93 VanDerWaalsContact C-N 3.31Å; E91-I93 PolarHBondContact O-N 3.35Å; I93-K95 PolarHBondContact O-N 3.02Å; I93-G96 PolarHBondContact O-N 3.18Å
94	G	95.8	Very high	94.7	Very high	71 Å²	71	97 Å²	97	73%	0.732	57%	0.565	S	S	*	*	H	α-helix	trans	-64.1	-36.3	-177.4	0	0	0	0	0	114	G90 E91	G90-G94 PolarHBondContact O-N 3.18Å; E91-G94 PolarHBondContact O-N 3.19Å; E91-G94 VanDerWaalsContact O-N 3.15Å
95	K	95.4	Very high	94.6	Very high	45 Å²	45	97.2 Å²	97.2	20%	0.196	57%	0.569	C	S	.	*	H	α-helix	trans	-83.9	-11.8	175.9	77.7	-163.6	-178.8	-163.5	0	114	E91 I93 G97 Y101	E91-K95 HydrophobicContact CG-CD 4.5Å; E91-K95 WeakPolarHBondContact O-CG 3.41Å; E91-K95 PolarHBondContact O-N 2.94Å; E91-K95 IonicContact OE1-NZ 2.91Å; E91-K95 PolarHBondContact OE1-NZ 2.91Å; I93-K95 PolarHBondContact O-N 3.02Å; K95-G97 WeakPolarHBondContact CE-O 3.36Å; K95-G97 WeakPolarHBondContact CG-O 3.37Å; K95-Y101 HydrophobicContact CB-CD1 3.64Å; K95-Y101 HydrophobicContact CB-CE1 3.4Å; K95-Y101 HydrophobicContact CB-CG 4.49Å; K95-Y101 HydrophobicContact CD-CE1 4.33Å; K95-Y101 HydrophobicContact CD-CE2 4.45Å
96	G	95.4	Very high	94.4	Very high	72 Å²	72	97.4 Å²	97.4	74%	0.742	58%	0.575	S	S	*	*	T	Hydrogen-bonded Turn	trans	72.7	24.3	178.9	0	0	0	0	0	114.6	C92 I93	C92-G96 PolarHBondContact O-N 3.13Å; I93-G96 PolarHBondContact O-N 3.18Å
97	G	94	Very high	94.3	Very high	27 Å²	27	95.2 Å²	95.2	28%	0.278	58%	0.579	S	S	.	*			trans	-162.8	153.8	-175.3	0	0	0	0	0	113.2	C92 K95	C92-G97 PolarHBondContact O-N 3.33Å; K95-G97 WeakPolarHBondContact CE-O 3.36Å; K95-G97 WeakPolarHBondContact CG-O 3.37Å
98	I	94.7	Very high	94.1	Very high	155 Å²	155	92.3 Å²	92.3	80%	0.795	58%	0.576	S	S	*	*	S	Bend	trans	-84.8	-25.6	178.7	-57.4	173.9	0	0	0	110.8
99	V	95.2	Very high	93.9	Very high	137 Å²	137	90.3 Å²	90.3	83%	0.83	58%	0.582	S	S	*	*	S	Bend	trans	-125.4	116.9	-174.2	-177.1	0	0	0	0	110.1
100	G	93.1	Very high	93.7	Very high	44 Å²	44	91.1 Å²	91.1	45%	0.454	60%	0.595	S	S	.	*	S	Bend	trans	60.3	-176.4	175.8	0	0	0	0	0	114.3
101	Y	93	Very high	93.5	Very high	147 Å²	147	95.1 Å²	95.1	58%	0.576	61%	0.61	S	S	*	*			trans	-93.7	141.5	164.5	-75.9	-90.4	0	0	0	108.5	K95 V103	K95-Y101 HydrophobicContact CB-CD1 3.64Å; K95-Y101 HydrophobicContact CB-CE1 3.4Å; K95-Y101 HydrophobicContact CB-CG 4.49Å; K95-Y101 HydrophobicContact CD-CE1 4.33Å; K95-Y101 HydrophobicContact CD-CE2 4.45Å; Y101-V103 PolarHBondContact O-N 2.93Å
102	A	88.3	Confident	93.2	Very high	108 Å²	108	98.3 Å²	98.3	89%	0.893	64%	0.639	S	S	*	*			trans	-75.4	82.3	168.3	0	0	0	0	0	108.6
103	V	81.6	Confident	92.9	Very high	199 Å²	199	103.5 Å²	103.5	100%	1.206	67%	0.672	S	S	*	*			trans	-88.8	0	174	-68.8	0	0	0	0	111.9	Y101	Y101-V103 PolarHBondContact O-N 2.93Å

Retrieved 103 of 103 residues in 226.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).