A0A060W6D1_ONCMY Loading...

V-type proton ATPase subunit G

Subunit of the V1 complex of vacuolar(H+)-ATPase (V-ATPase), a multisubunit enzyme composed of a peripheral complex (V1) that hydrolyzes ATP and a membrane integral complex (V0) that translocates protons. V-ATPase is responsible for acidifying and maintaining the pH of intracellular compartments and in some cell types, is targeted to the plasma membrane, where it is responsible for acidifying the extracellular environment.

AlphaFold DB (B5XD10), UniProt , Accession A0A060W6D1, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene atp6v1g1, Length 118 aa.

						>A0A060W6D1_ONCMY|A0A060W6D1|atp6v1g1
MASQSQGIQQLLQAEKRAAEKVAEARKRKNRRLKQAKEEAQAEIEQYRMQREKEFKTKEAAALGSHGNSAVEVDKETVGKMGSIQTSYQRNREGVLGNLLKMVCDIKPEIHANYRFAG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.8	Low	77.4	Confident	218 Å²	218	115.9 Å²	115.9	100%	1.074	64%	0.635	S	S	*	*				0	-28.3	0	-62.4	-60.1	-112.9	0	0	114.1	S3	M1-S3 PolarHBondContact O-N 3.5Å
2	A	56.5	Low	78.9	Confident	78 Å²	78	114.4 Å²	114.4	65%	0.645	63%	0.625	S	S	*	*	H	α-helix	trans	-71.6	-25	-177.5	0	0	0	0	0	116.1	S5	A2-S5 PolarHBondContact O-OG 3.26Å
3	S	61.3	Low	80.1	Confident	105 Å²	105	113.8 Å²	113.8	73%	0.734	62%	0.615	S	S	*	*	H	α-helix	trans	-70.5	-32.2	-177.4	174	0	0	0	0	113.5	M1 G7	M1-S3 PolarHBondContact O-N 3.5Å; S3-G7 PolarHBondContact O-N 3.49Å
4	Q	64.8	Low	81.2	Confident	147 Å²	147	109.8 Å²	109.8	69%	0.687	61%	0.605	S	S	*	*	H	α-helix	trans	-70.9	-35.4	-177.6	-159.7	-166.7	29.7	0	0	112.4	I8	Q4-I8 HydrophobicContact CG-CD1 4.44Å; Q4-I8 WeakPolarHBondContact O-CD1 3.44Å; Q4-I8 WeakPolarHBondContact O-CG1 3.41Å; Q4-I8 PolarHBondContact O-N 3.15Å
5	S	75.9	Confident	82.2	Confident	71 Å²	71	111.3 Å²	111.3	50%	0.497	61%	0.606	S	S	.	*	H	α-helix	trans	-72.6	-31.8	-179.7	70.2	0	0	0	0	112.7	A2 Q9	A2-S5 PolarHBondContact O-OG 3.26Å; S5-Q9 PolarHBondContact O-N 3.4Å; S5-Q9 VanDerWaalsContact O-N 3.11Å
6	Q	84.4	Confident	83.1	Confident	138 Å²	138	112.8 Å²	112.8	65%	0.645	61%	0.605	S	S	*	*	H	α-helix	trans	-71.2	-39.1	-178.7	-163.2	165.3	4.8	0	0	112.1	Q9 Q10	Q6-Q9 PolarHBondContact O-N 3.25Å; Q6-Q10 PolarHBondContact O-N 3.49Å; Q6-Q10 VanDerWaalsContact O-N 3.15Å
7	G	90.1	Very high	83.9	Confident	31 Å²	31	115.4 Å²	115.4	32%	0.32	60%	0.604	S	S	.	*	H	α-helix	trans	-65	-41.4	174.3	0	0	0	0	0	113	S3 Q9 Q10 L11	S3-G7 PolarHBondContact O-N 3.49Å; G7-Q9 PolarHBondContact O-N 3.46Å; G7-Q10 WeakPolarHBondContact O-CB 3.47Å; G7-Q10 PolarHBondContact O-N 3.11Å; G7-L11 WeakPolarHBondContact O-CG 3.34Å; G7-L11 PolarHBondContact O-N 3.27Å; G7-L11 VanDerWaalsContact O-N 3.09Å
8	I	89.3	Confident	84.6	Confident	91 Å²	91	112.1 Å²	112.1	47%	0.467	60%	0.596	S	S	.	*	H	α-helix	trans	-62.8	-43	176.3	-67.6	167.5	0	0	0	111	Q4 Q10 L11 L12	Q4-I8 HydrophobicContact CG-CD1 4.44Å; Q4-I8 WeakPolarHBondContact O-CD1 3.44Å; Q4-I8 WeakPolarHBondContact O-CG1 3.41Å; Q4-I8 PolarHBondContact O-N 3.15Å; I8-Q10 VanDerWaalsContact C-N 3.31Å; I8-Q10 PolarHBondContact O-N 2.93Å; I8-L11 PolarHBondContact O-N 3.43Å; I8-L12 HydrophobicContact CG2-CD1 3.97Å; I8-L12 HydrophobicContact CG2-CG 4.46Å; I8-L12 WeakPolarHBondContact O-CG 3.4Å; I8-L12 PolarHBondContact O-N 3.09Å
9	Q	90.3	Very high	85.2	Confident	137 Å²	137	109.4 Å²	109.4	64%	0.64	59%	0.591	S	S	*	*	H	α-helix	trans	-60.4	-39.5	175.7	-105.3	176.5	-27.2	0	0	112.7	S5 Q6 G7 L12 Q13	S5-Q9 PolarHBondContact O-N 3.4Å; S5-Q9 VanDerWaalsContact O-N 3.11Å; Q6-Q9 PolarHBondContact O-N 3.25Å; G7-Q9 PolarHBondContact O-N 3.46Å; Q9-L12 PolarHBondContact O-N 2.98Å; Q9-Q13 WeakPolarHBondContact O-CB 3.5Å; Q9-Q13 PolarHBondContact O-N 3.43Å
10	Q	93.5	Very high	85.9	Confident	134 Å²	134	109.2 Å²	109.2	63%	0.626	59%	0.586	S	S	*	*	H	α-helix	trans	-64.5	-42.2	177.1	-121.9	174.1	-0.6	0	0	112	Q6 G7 I8 Q13 A14	Q6-Q10 PolarHBondContact O-N 3.49Å; Q6-Q10 VanDerWaalsContact O-N 3.15Å; G7-Q10 WeakPolarHBondContact O-CB 3.47Å; G7-Q10 PolarHBondContact O-N 3.11Å; I8-Q10 VanDerWaalsContact C-N 3.31Å; I8-Q10 PolarHBondContact O-N 2.93Å; Q10-Q13 PolarHBondContact O-N 3.37Å; Q10-A14 WeakPolarHBondContact O-CB 3.48Å; Q10-A14 PolarHBondContact O-N 3.09Å
11	L	93.6	Very high	86.4	Confident	125 Å²	125	111.7 Å²	111.7	65%	0.654	59%	0.592	S	S	*	*	H	α-helix	trans	-63.6	-45.6	176	-69.4	172.4	0	0	0	111.7	G7 I8 Q13 A14 E15	G7-L11 WeakPolarHBondContact O-CG 3.34Å; G7-L11 PolarHBondContact O-N 3.27Å; G7-L11 VanDerWaalsContact O-N 3.09Å; I8-L11 PolarHBondContact O-N 3.43Å; L11-Q13 VanDerWaalsContact C-N 3.29Å; L11-Q13 PolarHBondContact O-N 3.35Å; L11-A14 PolarHBondContact O-N 2.99Å; L11-E15 WeakPolarHBondContact O-CB 3.38Å; L11-E15 PolarHBondContact O-N 3.48Å
12	L	94.8	Very high	88.6	Confident	98 Å²	98	105 Å²	105	51%	0.513	56%	0.564	S	S	.	*	H	α-helix	trans	-60.6	-39	176	-72.3	168.2	0	0	0	112	I8 Q9 E15 K16	I8-L12 HydrophobicContact CG2-CD1 3.97Å; I8-L12 HydrophobicContact CG2-CG 4.46Å; I8-L12 WeakPolarHBondContact O-CG 3.4Å; I8-L12 PolarHBondContact O-N 3.09Å; Q9-L12 PolarHBondContact O-N 2.98Å; L12-E15 PolarHBondContact O-N 3.44Å; L12-K16 WeakPolarHBondContact O-CB 3.48Å; L12-K16 PolarHBondContact O-N 3.34Å
13	Q	95.1	Very high	90.6	Very high	107 Å²	107	104 Å²	104	50%	0.5	56%	0.555	S	S	.	*	H	α-helix	trans	-69.9	-37.6	177.4	-156.8	179	38.4	0	0	111.9	Q9 Q10 L11 R17	Q9-Q13 WeakPolarHBondContact O-CB 3.5Å; Q9-Q13 PolarHBondContact O-N 3.43Å; Q10-Q13 PolarHBondContact O-N 3.37Å; L11-Q13 VanDerWaalsContact C-N 3.29Å; L11-Q13 PolarHBondContact O-N 3.35Å; Q13-R17 WeakPolarHBondContact O-CG 3.03Å; Q13-R17 PolarHBondContact O-N 2.84Å; Q13-R17 VanDerWaalsContact O-N 3.09Å
14	A	95.5	Very high	92.3	Very high	57 Å²	57	105.7 Å²	105.7	47%	0.471	55%	0.551	S	S	.	*	H	α-helix	trans	-65.7	-42.3	173.7	0	0	0	0	0	111.7	Q10 L11 R17 A18	Q10-A14 WeakPolarHBondContact O-CB 3.48Å; Q10-A14 PolarHBondContact O-N 3.09Å; L11-A14 PolarHBondContact O-N 2.99Å; A14-R17 PolarHBondContact O-N 3.19Å; A14-A18 WeakPolarHBondContact O-CB 3.45Å; A14-A18 PolarHBondContact O-N 3Å
15	E	95.8	Very high	93.9	Very high	132 Å²	132	101.6 Å²	101.6	62%	0.617	54%	0.543	S	S	*	.	H	α-helix	trans	-60.5	-47.1	175.9	-173.1	179.8	179.9	0	0	111.1	L11 L12 R17 A18 A19	L11-E15 WeakPolarHBondContact O-CB 3.38Å; L11-E15 PolarHBondContact O-N 3.48Å; L12-E15 PolarHBondContact O-N 3.44Å; E15-R17 PolarHBondContact O-N 2.98Å; E15-A18 PolarHBondContact O-N 3.34Å; E15-A19 WeakPolarHBondContact O-CB 3.44Å; E15-A19 PolarHBondContact O-N 2.88Å
16	K	96.9	Very high	94.9	Very high	135 Å²	135	106.7 Å²	106.7	59%	0.587	55%	0.551	S	S	*	*	H	α-helix	trans	-58.7	-47.1	176.3	-174.2	175.4	176.6	178.9	0	112	L12 A18 A19 E20	L12-K16 WeakPolarHBondContact O-CB 3.48Å; L12-K16 PolarHBondContact O-N 3.34Å; K16-A18 VanDerWaalsContact C-N 3.34Å; K16-A18 PolarHBondContact O-N 2.9Å; K16-A19 PolarHBondContact O-N 3.23Å; K16-E20 WeakPolarHBondContact CE-OE1 3.34Å; K16-E20 WeakPolarHBondContact O-CB 3.45Å; K16-E20 WeakPolarHBondContact O-CG 3.33Å; K16-E20 PolarHBondContact O-N 3.25Å
17	R	96.3	Very high	95.6	Very high	157 Å²	157	107.9 Å²	107.9	59%	0.592	55%	0.554	S	S	*	*	H	α-helix	trans	-62.8	-39.9	177.5	-73.3	176.4	-175.7	172.5	4.7	112.2	Q13 A14 E15 K21	Q13-R17 WeakPolarHBondContact O-CG 3.03Å; Q13-R17 PolarHBondContact O-N 2.84Å; Q13-R17 VanDerWaalsContact O-N 3.09Å; A14-R17 PolarHBondContact O-N 3.19Å; E15-R17 PolarHBondContact O-N 2.98Å; R17-K21 WeakPolarHBondContact O-CB 3.39Å; R17-K21 PolarHBondContact O-N 3.45Å
18	A	96.9	Very high	95.9	Very high	56 Å²	56	112.8 Å²	112.8	46%	0.463	56%	0.563	S	S	.	*	H	α-helix	trans	-65.4	-45.3	176.8	0	0	0	0	0	111.2	A14 E15 K16 K21 V22	A14-A18 WeakPolarHBondContact O-CB 3.45Å; A14-A18 PolarHBondContact O-N 3Å; E15-A18 PolarHBondContact O-N 3.34Å; K16-A18 VanDerWaalsContact C-N 3.34Å; K16-A18 PolarHBondContact O-N 2.9Å; A18-K21 PolarHBondContact O-N 2.99Å; A18-V22 WeakPolarHBondContact O-CG2 3.39Å; A18-V22 PolarHBondContact O-N 3.07Å
19	A	96.9	Very high	96.4	Very high	61 Å²	61	115 Å²	115	50%	0.504	57%	0.569	S	S	.	*	H	α-helix	trans	-61	-45.7	177.2	0	0	0	0	0	111.8	E15 K16 V22 A23	E15-A19 WeakPolarHBondContact O-CB 3.44Å; E15-A19 PolarHBondContact O-N 2.88Å; K16-A19 PolarHBondContact O-N 3.23Å; A19-V22 PolarHBondContact O-N 2.86Å; A19-A23 WeakPolarHBondContact O-CB 3.38Å; A19-A23 PolarHBondContact O-N 2.85Å
20	E	97.4	Very high	96.7	Very high	105 Å²	105	113.5 Å²	113.5	49%	0.491	57%	0.565	S	S	.	*	H	α-helix	trans	-60.1	-46.6	176	-75.4	171.8	-178.7	0	0	111.5	K16 V22 A23 E24	K16-E20 WeakPolarHBondContact CE-OE1 3.34Å; K16-E20 WeakPolarHBondContact O-CB 3.45Å; K16-E20 WeakPolarHBondContact O-CG 3.33Å; K16-E20 PolarHBondContact O-N 3.25Å; E20-V22 VanDerWaalsContact C-N 3.34Å; E20-V22 PolarHBondContact O-N 3.39Å; E20-A23 PolarHBondContact O-N 2.92Å; E20-E24 WeakPolarHBondContact O-CB 3.35Å; E20-E24 PolarHBondContact O-N 3.32Å
21	K	97.8	Very high	96.9	Very high	163 Å²	163	115.1 Å²	115.1	71%	0.709	57%	0.566	S	S	*	*	H	α-helix	trans	-60.9	-41.3	178.4	-171.8	173.2	-176.2	174.5	0	112.2	R17 A18 A25	R17-K21 WeakPolarHBondContact O-CB 3.39Å; R17-K21 PolarHBondContact O-N 3.45Å; A18-K21 PolarHBondContact O-N 2.99Å; K21-A25 WeakPolarHBondContact O-CB 3.34Å; K21-A25 PolarHBondContact O-N 3.34Å; K21-A25 VanDerWaalsContact O-N 3.07Å
22	V	97.9	Very high	97.1	Very high	78 Å²	78	116.1 Å²	116.1	47%	0.473	56%	0.561	S	S	.	*	H	α-helix	trans	-69.2	-42.1	177.1	173.4	0	0	0	0	111.2	A18 A19 E20 A25 R26	A18-V22 WeakPolarHBondContact O-CG2 3.39Å; A18-V22 PolarHBondContact O-N 3.07Å; A19-V22 PolarHBondContact O-N 2.86Å; E20-V22 VanDerWaalsContact C-N 3.34Å; E20-V22 PolarHBondContact O-N 3.39Å; V22-A25 PolarHBondContact O-N 2.91Å; V22-R26 WeakPolarHBondContact O-CG 3.41Å; V22-R26 PolarHBondContact O-N 2.97Å
23	A	97.7	Very high	97.3	Very high	57 Å²	57	116 Å²	116	47%	0.471	56%	0.561	S	S	.	*	H	α-helix	trans	-62.4	-43.8	177.7	0	0	0	0	0	111.6	A19 E20 R26 K27	A19-A23 WeakPolarHBondContact O-CB 3.38Å; A19-A23 PolarHBondContact O-N 2.85Å; E20-A23 PolarHBondContact O-N 2.92Å; A23-R26 PolarHBondContact O-N 3.47Å; A23-K27 WeakPolarHBondContact O-CB 3.45Å; A23-K27 PolarHBondContact O-N 3.41Å
24	E	97.6	Very high	97.4	Very high	140 Å²	140	117.4 Å²	117.4	65%	0.654	57%	0.565	S	S	*	*	H	α-helix	trans	-62.8	-43.9	176.2	-167.2	-174.4	171.7	0	0	111.6	E20 R26 K27 R28	E20-E24 WeakPolarHBondContact O-CB 3.35Å; E20-E24 PolarHBondContact O-N 3.32Å; E24-R26 PolarHBondContact O-N 3.27Å; E24-K27 PolarHBondContact O-N 3.44Å; E24-R28 WeakPolarHBondContact O-CB 3.39Å; E24-R28 PolarHBondContact O-N 3.35Å
25	A	97.8	Very high	97.5	Very high	61 Å²	61	118.9 Å²	118.9	50%	0.504	56%	0.562	S	S	.	*	H	α-helix	trans	-60.3	-43.3	176.1	0	0	0	0	0	112.1	K21 V22 R28 K29	K21-A25 WeakPolarHBondContact O-CB 3.34Å; K21-A25 PolarHBondContact O-N 3.34Å; K21-A25 VanDerWaalsContact O-N 3.07Å; V22-A25 PolarHBondContact O-N 2.91Å; A25-R28 PolarHBondContact O-N 2.89Å; A25-K29 WeakPolarHBondContact O-CB 3.48Å; A25-K29 PolarHBondContact O-N 3.33Å
26	R	97.9	Very high	97.6	Very high	177 Å²	177	115.2 Å²	115.2	67%	0.668	55%	0.554	S	S	*	*	H	α-helix	trans	-63.2	-45	175.2	-72.5	-180	-178.7	-153.8	1.6	111.7	V22 A23 E24 R28 K29 N30	V22-R26 WeakPolarHBondContact O-CG 3.41Å; V22-R26 PolarHBondContact O-N 2.97Å; A23-R26 PolarHBondContact O-N 3.47Å; E24-R26 PolarHBondContact O-N 3.27Å; R26-R28 PolarHBondContact O-N 2.76Å; R26-K29 PolarHBondContact O-N 2.9Å; R26-N30 PolarHBondContact O-N 3.27Å
27	K	97.8	Very high	97.6	Very high	164 Å²	164	116 Å²	116	71%	0.713	56%	0.558	S	S	*	*	H	α-helix	trans	-60.5	-44.2	176.6	-172.2	177.9	-179	179.6	0	111.3	A23 E24 N30 R31	A23-K27 WeakPolarHBondContact O-CB 3.45Å; A23-K27 PolarHBondContact O-N 3.41Å; E24-K27 PolarHBondContact O-N 3.44Å; K27-N30 PolarHBondContact O-N 2.93Å; K27-R31 WeakPolarHBondContact O-CB 3.38Å; K27-R31 PolarHBondContact O-N 3Å
28	R	98	Very high	97.7	Very high	134 Å²	134	113.7 Å²	113.7	51%	0.506	55%	0.554	S	S	.	*	H	α-helix	trans	-63.8	-42.3	177.1	-175.9	176.5	176	168.7	-0.8	112.1	E24 A25 R26 R31 R32	E24-R28 WeakPolarHBondContact O-CB 3.39Å; E24-R28 PolarHBondContact O-N 3.35Å; A25-R28 PolarHBondContact O-N 2.89Å; R26-R28 PolarHBondContact O-N 2.76Å; R28-R31 PolarHBondContact O-N 3.21Å; R28-R32 VanDerWaalsContact NH2-NH2 3.18Å; R28-R32 PolarHBondContact O-N 2.94Å
29	K	98	Very high	97.7	Very high	136 Å²	136	116.2 Å²	116.2	59%	0.591	56%	0.556	S	S	*	*	H	α-helix	trans	-59.4	-50.6	175	-178.9	-175.6	173.6	-177	0	110.8	A25 R26 R31 R32 L33	A25-K29 WeakPolarHBondContact O-CB 3.48Å; A25-K29 PolarHBondContact O-N 3.33Å; R26-K29 PolarHBondContact O-N 2.9Å; K29-R31 VanDerWaalsContact C-N 3.32Å; K29-R31 PolarHBondContact O-N 3.42Å; K29-R32 PolarHBondContact O-N 2.99Å; K29-L33 HydrophobicContact CG-CD1 4.15Å; K29-L33 WeakPolarHBondContact O-CG 3.2Å; K29-L33 PolarHBondContact O-N 3.31Å
30	N	97.6	Very high	97.8	Very high	106 Å²	106	115.4 Å²	115.4	57%	0.567	55%	0.549	S	S	*	.	H	α-helix	trans	-61.9	-40.1	179.9	-73.3	-3.3	0	0	0	112.1	R26 K27 L33 K34	R26-N30 PolarHBondContact O-N 3.27Å; K27-N30 PolarHBondContact O-N 2.93Å; N30-L33 PolarHBondContact O-N 3.47Å; N30-K34 PolarHBondContact O-N 2.98Å
31	R	98.1	Very high	97.8	Very high	168 Å²	168	117.1 Å²	117.1	63%	0.634	56%	0.557	S	S	*	*	H	α-helix	trans	-60.4	-47.3	174.6	-170.2	179.1	75.3	-172.5	3.9	111.8	K27 R28 K29 L33 K34 Q35	K27-R31 WeakPolarHBondContact O-CB 3.38Å; K27-R31 PolarHBondContact O-N 3Å; R28-R31 PolarHBondContact O-N 3.21Å; K29-R31 VanDerWaalsContact C-N 3.32Å; K29-R31 PolarHBondContact O-N 3.42Å; R31-L33 VanDerWaalsContact C-N 3.34Å; R31-L33 PolarHBondContact O-N 2.95Å; R31-K34 PolarHBondContact O-N 3.4Å; R31-Q35 WeakPolarHBondContact O-CB 3.39Å; R31-Q35 PolarHBondContact O-N 3.41Å
32	R	97.9	Very high	97.8	Very high	147 Å²	147	111.8 Å²	111.8	56%	0.555	54%	0.544	S	S	*	.	H	α-helix	trans	-63.1	-39.3	178	-78.2	-171.6	169.2	-172.6	-4.9	112.5	R28 K29 Q35 A36	R28-R32 VanDerWaalsContact NH2-NH2 3.18Å; R28-R32 PolarHBondContact O-N 2.94Å; K29-R32 PolarHBondContact O-N 2.99Å; R32-Q35 PolarHBondContact O-N 3.07Å; R32-A36 WeakPolarHBondContact O-CB 3.49Å; R32-A36 PolarHBondContact O-N 3.29Å
33	L	97.4	Very high	97.8	Very high	96 Å²	96	114.8 Å²	114.8	50%	0.503	55%	0.552	S	S	.	*	H	α-helix	trans	-64.8	-40	175.8	-72.4	173.2	0	0	0	112.2	K29 N30 R31 K37	K29-L33 HydrophobicContact CG-CD1 4.15Å; K29-L33 WeakPolarHBondContact O-CG 3.2Å; K29-L33 PolarHBondContact O-N 3.31Å; N30-L33 PolarHBondContact O-N 3.47Å; R31-L33 VanDerWaalsContact C-N 3.34Å; R31-L33 PolarHBondContact O-N 2.95Å; L33-K37 WeakPolarHBondContact O-CG 3.37Å; L33-K37 PolarHBondContact O-N 2.93Å
34	K	97.9	Very high	97.8	Very high	136 Å²	136	117.5 Å²	117.5	59%	0.591	56%	0.558	S	S	*	*	H	α-helix	trans	-66.9	-46.4	176.2	-171	175.3	174.8	-175.3	0	111.3	N30 R31 A36 K37 E38	N30-K34 PolarHBondContact O-N 2.98Å; R31-K34 PolarHBondContact O-N 3.4Å; K34-A36 PolarHBondContact O-N 3.45Å; K34-K37 WeakPolarHBondContact O-CB 3.42Å; K34-K37 PolarHBondContact O-N 3.25Å; K34-K37 VanDerWaalsContact O-N 3.17Å; K34-E38 WeakPolarHBondContact CE-OE1 3.5Å; K34-E38 IonicContact NZ-OE1 3.91Å; K34-E38 PolarHBondContact O-N 3.35Å
35	Q	97.9	Very high	97.8	Very high	87 Å²	87	114.7 Å²	114.7	41%	0.407	54%	0.544	S	S	.	.	H	α-helix	trans	-57.8	-47	176.6	-178.3	176.5	1.8	0	0	111.8	R31 R32 K37 E38 E39	R31-Q35 WeakPolarHBondContact O-CB 3.39Å; R31-Q35 PolarHBondContact O-N 3.41Å; R32-Q35 PolarHBondContact O-N 3.07Å; Q35-K37 VanDerWaalsContact C-N 3.27Å; Q35-K37 PolarHBondContact O-N 2.86Å; Q35-E38 PolarHBondContact O-N 3.17Å; Q35-E38 VanDerWaalsContact O-N 3.17Å; Q35-E39 HydrophobicContact CG-CG 4.29Å; Q35-E39 WeakPolarHBondContact CG-OE1 3.38Å; Q35-E39 PolarHBondContact NE2-OE1 3.37Å; Q35-E39 WeakPolarHBondContact O-CB 3.3Å; Q35-E39 WeakPolarHBondContact O-CG 3.44Å; Q35-E39 PolarHBondContact O-N 3.48Å
36	A	97.8	Very high	97.8	Very high	55 Å²	55	117.9 Å²	117.9	46%	0.455	55%	0.549	S	S	.	.	H	α-helix	trans	-60.5	-36.2	178.4	0	0	0	0	0	112.8	R32 K34 A40	R32-A36 WeakPolarHBondContact O-CB 3.49Å; R32-A36 PolarHBondContact O-N 3.29Å; K34-A36 PolarHBondContact O-N 3.45Å; A36-A40 VanDerWaalsContact O-CB 3.3Å; A36-A40 WeakPolarHBondContact O-CB 3.44Å; A36-A40 PolarHBondContact O-N 3.26Å
37	K	97.6	Very high	97.8	Very high	152 Å²	152	116.3 Å²	116.3	66%	0.661	54%	0.544	S	S	*	.	H	α-helix	trans	-68.3	-44.7	174.8	-73.2	-177.7	178	-169.5	0	112	L33 K34 Q35 Q41	L33-K37 WeakPolarHBondContact O-CG 3.37Å; L33-K37 PolarHBondContact O-N 2.93Å; K34-K37 WeakPolarHBondContact O-CB 3.42Å; K34-K37 PolarHBondContact O-N 3.25Å; K34-K37 VanDerWaalsContact O-N 3.17Å; Q35-K37 VanDerWaalsContact C-N 3.27Å; Q35-K37 PolarHBondContact O-N 2.86Å; K37-Q41 VanDerWaalsContact O-CB 3.31Å; K37-Q41 WeakPolarHBondContact O-CB 3.44Å; K37-Q41 PolarHBondContact O-N 2.91Å
38	E	97.9	Very high	97.8	Very high	109 Å²	109	115 Å²	115	51%	0.509	54%	0.535	S	S	.	.	H	α-helix	trans	-64.1	-43.5	179	-72.7	172.2	175.8	0	0	111.4	K34 Q35 Q41 A42	K34-E38 WeakPolarHBondContact CE-OE1 3.5Å; K34-E38 IonicContact NZ-OE1 3.91Å; K34-E38 PolarHBondContact O-N 3.35Å; Q35-E38 PolarHBondContact O-N 3.17Å; Q35-E38 VanDerWaalsContact O-N 3.17Å; E38-Q41 PolarHBondContact O-N 3.36Å; E38-A42 WeakPolarHBondContact O-CB 3.02Å; E38-A42 PolarHBondContact O-N 2.98Å
39	E	97.4	Very high	97.8	Very high	109 Å²	109	113.7 Å²	113.7	51%	0.509	54%	0.536	S	S	.	.	H	α-helix	trans	-63.5	-47.6	177	-73.2	172.9	-176.7	0	0	111.6	Q35 Q41 A42 E43	Q35-E39 HydrophobicContact CG-CG 4.29Å; Q35-E39 WeakPolarHBondContact CG-OE1 3.38Å; Q35-E39 PolarHBondContact NE2-OE1 3.37Å; Q35-E39 WeakPolarHBondContact O-CB 3.3Å; Q35-E39 WeakPolarHBondContact O-CG 3.44Å; Q35-E39 PolarHBondContact O-N 3.48Å; E39-Q41 VanDerWaalsContact C-N 3.28Å; E39-Q41 PolarHBondContact O-N 3Å; E39-A42 PolarHBondContact O-N 3.17Å; E39-E43 PolarHBondContact O-N 2.98Å
40	A	97.8	Very high	97.8	Very high	44 Å²	44	112.6 Å²	112.6	36%	0.364	53%	0.533	S	S	.	.	H	α-helix	trans	-60.6	-39	176.5	0	0	0	0	0	112.1	A36 E43 I44	A36-A40 VanDerWaalsContact O-CB 3.3Å; A36-A40 WeakPolarHBondContact O-CB 3.44Å; A36-A40 PolarHBondContact O-N 3.26Å; A40-E43 PolarHBondContact O-N 2.99Å; A40-I44 VanDerWaalsContact O-CG1 3.25Å; A40-I44 WeakPolarHBondContact O-CG1 3.31Å; A40-I44 PolarHBondContact O-N 3.39Å
41	Q	97.8	Very high	97.8	Very high	141 Å²	141	113.3 Å²	113.3	66%	0.659	53%	0.527	S	S	*	.	H	α-helix	trans	-71.7	-35.4	179.8	-164.3	147.6	5.7	0	0	112.3	K37 E38 E39 E45	K37-Q41 VanDerWaalsContact O-CB 3.31Å; K37-Q41 WeakPolarHBondContact O-CB 3.44Å; K37-Q41 PolarHBondContact O-N 2.91Å; E38-Q41 PolarHBondContact O-N 3.36Å; E39-Q41 VanDerWaalsContact C-N 3.28Å; E39-Q41 PolarHBondContact O-N 3Å; Q41-E45 PolarHBondContact O-N 3.36Å
42	A	98.1	Very high	97.7	Very high	51 Å²	51	109.2 Å²	109.2	42%	0.421	52%	0.515	S	S	.	.	H	α-helix	trans	-63.6	-42.2	171.7	0	0	0	0	0	111.8	E38 E39 E45 Q46	E38-A42 WeakPolarHBondContact O-CB 3.02Å; E38-A42 PolarHBondContact O-N 2.98Å; E39-A42 PolarHBondContact O-N 3.17Å; A42-E45 PolarHBondContact O-N 3.45Å; A42-Q46 WeakPolarHBondContact O-CG 3.25Å; A42-Q46 PolarHBondContact O-N 3.34Å
43	E	97.8	Very high	97.7	Very high	140 Å²	140	109.5 Å²	109.5	65%	0.654	52%	0.521	S	S	*	.	H	α-helix	trans	-65.1	-42.6	177.3	-170.7	175.5	-179	0	0	112	E39 A40 E45 Q46 Y47	E39-E43 PolarHBondContact O-N 2.98Å; A40-E43 PolarHBondContact O-N 2.99Å; E43-E45 PolarHBondContact O-N 3.4Å; E43-Q46 PolarHBondContact O-N 3Å; E43-Y47 WeakPolarHBondContact O-CB 3.45Å; E43-Y47 PolarHBondContact O-N 2.97Å
44	I	97.8	Very high	97.6	Very high	114 Å²	114	108.2 Å²	108.2	59%	0.585	51%	0.512	S	S	*	.	H	α-helix	trans	-59.5	-45.7	175	-71.3	165.6	0	0	0	111	A40 Y47 R48	A40-I44 VanDerWaalsContact O-CG1 3.25Å; A40-I44 WeakPolarHBondContact O-CG1 3.31Å; A40-I44 PolarHBondContact O-N 3.39Å; I44-Y47 PolarHBondContact O-N 3.46Å; I44-R48 WeakPolarHBondContact O-CB 3.42Å; I44-R48 PolarHBondContact O-N 2.92Å
45	E	97.9	Very high	97.5	Very high	81 Å²	81	107.9 Å²	107.9	38%	0.379	51%	0.511	S	S	.	.	H	α-helix	trans	-68.1	-39.1	-178.8	-166.4	65	-168.1	0	0	111.4	Q41 A42 E43 R48 M49	Q41-E45 PolarHBondContact O-N 3.36Å; A42-E45 PolarHBondContact O-N 3.45Å; E43-E45 PolarHBondContact O-N 3.4Å; E45-R48 PolarHBondContact O-N 3.28Å; E45-R48 IonicContact OE1-CZ 2.97Å; E45-R48 IonicContact OE1-NH1 2.72Å; E45-R48 PolarHBondContact OE1-NH1 2.92Å; E45-R48 IonicContact OE2-CZ 2.95Å; E45-R48 IonicContact OE2-NH1 3.69Å; E45-R48 PolarHBondContact OE2-NH1 3.07Å; E45-M49 HydrophobicContact CG-CE 4.43Å; E45-M49 WeakPolarHBondContact O-CG 3.29Å; E45-M49 PolarHBondContact O-N 2.92Å
46	Q	98	Very high	97.4	Very high	129 Å²	129	108.9 Å²	108.9	60%	0.603	51%	0.514	S	S	*	.	H	α-helix	trans	-59.8	-47.1	172.5	-76.4	-176.4	0.9	0	0	112	A42 E43 R48 M49 Q50	A42-Q46 WeakPolarHBondContact O-CG 3.25Å; A42-Q46 PolarHBondContact O-N 3.34Å; E43-Q46 PolarHBondContact O-N 3Å; Q46-R48 VanDerWaalsContact C-N 3.33Å; Q46-R48 PolarHBondContact O-N 3.48Å; Q46-M49 HydrophobicContact CG-CE 4.23Å; Q46-M49 PolarHBondContact O-N 3.3Å; Q46-Q50 PolarHBondContact O-N 2.95Å
47	Y	97.9	Very high	97.2	Very high	144 Å²	144	110.5 Å²	110.5	57%	0.565	52%	0.518	S	S	*	.	H	α-helix	trans	-61.5	-43.1	177.4	-177.7	-104.6	0	0	0	111.6	E43 I44 Q50 R51	E43-Y47 WeakPolarHBondContact O-CB 3.45Å; E43-Y47 PolarHBondContact O-N 2.97Å; I44-Y47 PolarHBondContact O-N 3.46Å; Y47-Q50 PolarHBondContact O-N 3.32Å; Y47-R51 HydrophobicContact CD1-CG 4.11Å; Y47-R51 HydrophobicContact CD2-CG 4.41Å; Y47-R51 HydrophobicContact CE1-CG 3.71Å; Y47-R51 HydrophobicContact CE2-CG 4.02Å; Y47-R51 HydrophobicContact CG-CG 4.45Å; Y47-R51 WeakPolarHBondContact O-CB 3.4Å; Y47-R51 VanDerWaalsContact O-CG 3.29Å; Y47-R51 WeakPolarHBondContact O-CG 3.36Å; Y47-R51 PolarHBondContact O-N 2.95Å
48	R	97.9	Very high	96.9	Very high	137 Å²	137	110 Å²	110	52%	0.517	52%	0.516	S	S	.	.	H	α-helix	trans	-60.1	-47.8	176.2	-177.7	-176.8	143.1	-148	-5.4	111.7	I44 E45 Q46 Q50 R51 E52	I44-R48 WeakPolarHBondContact O-CB 3.42Å; I44-R48 PolarHBondContact O-N 2.92Å; E45-R48 PolarHBondContact O-N 3.28Å; E45-R48 IonicContact OE1-CZ 2.97Å; E45-R48 IonicContact OE1-NH1 2.72Å; E45-R48 PolarHBondContact OE1-NH1 2.92Å; E45-R48 IonicContact OE2-CZ 2.95Å; E45-R48 IonicContact OE2-NH1 3.69Å; E45-R48 PolarHBondContact OE2-NH1 3.07Å; Q46-R48 VanDerWaalsContact C-N 3.33Å; Q46-R48 PolarHBondContact O-N 3.48Å; R48-Q50 VanDerWaalsContact C-N 3.33Å; R48-Q50 PolarHBondContact O-N 2.92Å; R48-R51 PolarHBondContact O-N 2.8Å; R48-E52 WeakPolarHBondContact O-CB 3.48Å; R48-E52 PolarHBondContact O-N 2.74Å
49	M	97.5	Very high	96.5	Very high	106 Å²	106	109.2 Å²	109.2	52%	0.522	51%	0.512	S	S	.	.	H	α-helix	trans	-60	-42.3	176.8	-73.9	-173.1	-68.7	0	0	111.9	E45 Q46 E52 K53	E45-M49 HydrophobicContact CG-CE 4.43Å; E45-M49 WeakPolarHBondContact O-CG 3.29Å; E45-M49 PolarHBondContact O-N 2.92Å; Q46-M49 HydrophobicContact CG-CE 4.23Å; Q46-M49 PolarHBondContact O-N 3.3Å; M49-E52 PolarHBondContact O-N 3.29Å; M49-K53 WeakPolarHBondContact O-CB 3.38Å; M49-K53 PolarHBondContact O-N 3.43Å
50	Q	97.5	Very high	96	Very high	113 Å²	113	107 Å²	107	53%	0.528	51%	0.513	S	S	.	.	H	α-helix	trans	-62.2	-47.2	177.1	-176.1	173.1	9.7	0	0	111.5	Q46 Y47 R48 E52 K53 E54	Q46-Q50 PolarHBondContact O-N 2.95Å; Y47-Q50 PolarHBondContact O-N 3.32Å; R48-Q50 VanDerWaalsContact C-N 3.33Å; R48-Q50 PolarHBondContact O-N 2.92Å; Q50-E52 PolarHBondContact O-N 3.45Å; Q50-K53 PolarHBondContact O-N 3.34Å; Q50-E54 WeakPolarHBondContact O-CG 3.37Å; Q50-E54 PolarHBondContact O-N 2.9Å
51	R	97.7	Very high	95.5	Very high	121 Å²	121	108 Å²	108	46%	0.457	52%	0.521	S	S	.	.	H	α-helix	trans	-64.6	-39	178.5	-69.6	-60.9	-62.4	179.9	-14.8	112.7	Y47 R48 E54 F55	Y47-R51 HydrophobicContact CD1-CG 4.11Å; Y47-R51 HydrophobicContact CD2-CG 4.41Å; Y47-R51 HydrophobicContact CE1-CG 3.71Å; Y47-R51 HydrophobicContact CE2-CG 4.02Å; Y47-R51 HydrophobicContact CG-CG 4.45Å; Y47-R51 WeakPolarHBondContact O-CB 3.4Å; Y47-R51 VanDerWaalsContact O-CG 3.29Å; Y47-R51 WeakPolarHBondContact O-CG 3.36Å; Y47-R51 PolarHBondContact O-N 2.95Å; R48-R51 PolarHBondContact O-N 2.8Å; R51-E54 IonicContact CZ-OE2 2.8Å; R51-E54 IonicContact NE-OE2 3.55Å; R51-E54 IonicContact NH1-OE2 3.95Å; R51-E54 PolarHBondContact NH1-OE2 2.98Å; R51-E54 PolarHBondContact O-N 3.4Å; R51-F55 VanDerWaalsContact O-CB 3.3Å; R51-F55 WeakPolarHBondContact O-CB 3.43Å; R51-F55 PolarHBondContact O-N 3.48Å
52	E	97.1	Very high	94.8	Very high	82 Å²	82	103.8 Å²	103.8	38%	0.383	51%	0.51	S	S	.	.	H	α-helix	trans	-66.8	-39.2	176.1	-167	176.6	156.9	0	0	111.5	R48 M49 Q50 F55 K56	R48-E52 WeakPolarHBondContact O-CB 3.48Å; R48-E52 PolarHBondContact O-N 2.74Å; M49-E52 PolarHBondContact O-N 3.29Å; Q50-E52 PolarHBondContact O-N 3.45Å; E52-F55 PolarHBondContact O-N 3.49Å; E52-K56 HydrophobicContact CG-CD 4.48Å; E52-K56 WeakPolarHBondContact O-CG 3.4Å; E52-K56 PolarHBondContact O-N 2.97Å; E52-K56 VanDerWaalsContact OE1-CE 3.28Å; E52-K56 WeakPolarHBondContact OE1-CE 3.3Å; E52-K56 IonicContact OE1-NZ 3.91Å; E52-K56 PolarHBondContact OE1-NZ 3.02Å
53	K	97.3	Very high	93.8	Very high	153 Å²	153	107 Å²	107	67%	0.665	52%	0.52	S	S	*	.	H	α-helix	trans	-63.2	-46	173.5	-175.3	-178.7	178.8	-177.9	0	111.9	M49 Q50 F55 K56 T57	M49-K53 WeakPolarHBondContact O-CB 3.38Å; M49-K53 PolarHBondContact O-N 3.43Å; Q50-K53 PolarHBondContact O-N 3.34Å; K53-F55 VanDerWaalsContact C-N 3.31Å; K53-F55 PolarHBondContact O-N 2.98Å; K53-K56 PolarHBondContact O-N 3.28Å; K53-T57 WeakPolarHBondContact O-CB 3.41Å; K53-T57 PolarHBondContact O-N 2.92Å; K53-T57 PolarHBondContact O-OG1 2.89Å
54	E	96.3	Very high	92.6	Very high	68 Å²	68	102.9 Å²	102.9	32%	0.318	52%	0.515	S	S	.	.	H	α-helix	trans	-60	-43.4	175	-75.5	174.5	-169.1	0	0	111.5	Q50 R51 T57 K58	Q50-E54 WeakPolarHBondContact O-CG 3.37Å; Q50-E54 PolarHBondContact O-N 2.9Å; R51-E54 IonicContact CZ-OE2 2.8Å; R51-E54 IonicContact NE-OE2 3.55Å; R51-E54 IonicContact NH1-OE2 3.95Å; R51-E54 PolarHBondContact NH1-OE2 2.98Å; R51-E54 PolarHBondContact O-N 3.4Å; E54-T57 PolarHBondContact O-N 3.36Å; E54-K58 WeakPolarHBondContact O-CG 3.41Å; E54-K58 PolarHBondContact O-N 3.43Å
55	F	95.5	Very high	91	Very high	129 Å²	129	100.8 Å²	100.8	57%	0.566	51%	0.51	S	S	*	.	H	α-helix	trans	-60.5	-53.5	177.5	178.4	-95	0	0	0	111.3	R51 E52 K53 T57 K58 E59	R51-F55 VanDerWaalsContact O-CB 3.3Å; R51-F55 WeakPolarHBondContact O-CB 3.43Å; R51-F55 PolarHBondContact O-N 3.48Å; E52-F55 PolarHBondContact O-N 3.49Å; K53-F55 VanDerWaalsContact C-N 3.31Å; K53-F55 PolarHBondContact O-N 2.98Å; F55-T57 VanDerWaalsContact C-N 3.26Å; F55-T57 PolarHBondContact O-N 2.87Å; F55-K58 PolarHBondContact O-N 3.36Å; F55-K58 VanDerWaalsContact O-N 3.09Å; F55-E59 WeakPolarHBondContact O-CB 3.28Å; F55-E59 PolarHBondContact O-N 2.91Å
56	K	95.3	Very high	89.3	Confident	109 Å²	109	103.7 Å²	103.7	47%	0.474	52%	0.523	S	S	.	.	H	α-helix	trans	-59.4	-36.6	178.5	-73.6	177.7	-176.5	167.2	0	112.6	E52 K53 E59 A60	E52-K56 HydrophobicContact CG-CD 4.48Å; E52-K56 WeakPolarHBondContact O-CG 3.4Å; E52-K56 PolarHBondContact O-N 2.97Å; E52-K56 VanDerWaalsContact OE1-CE 3.28Å; E52-K56 WeakPolarHBondContact OE1-CE 3.3Å; E52-K56 IonicContact OE1-NZ 3.91Å; E52-K56 PolarHBondContact OE1-NZ 3.02Å; K53-K56 PolarHBondContact O-N 3.28Å; K56-E59 PolarHBondContact O-N 3.09Å; K56-A60 WeakPolarHBondContact O-CB 3.37Å; K56-A60 PolarHBondContact O-N 3.49Å
57	T	93.3	Very high	87.8	Confident	88 Å²	88	99.7 Å²	99.7	54%	0.54	52%	0.516	S	S	.	.	H	α-helix	trans	-65	-44.3	176.3	-54.8	0	0	0	0	111.1	K53 E54 F55 A61	K53-T57 WeakPolarHBondContact O-CB 3.41Å; K53-T57 PolarHBondContact O-N 2.92Å; K53-T57 PolarHBondContact O-OG1 2.89Å; E54-T57 PolarHBondContact O-N 3.36Å; F55-T57 VanDerWaalsContact C-N 3.26Å; F55-T57 PolarHBondContact O-N 2.87Å; T57-A61 WeakPolarHBondContact O-CB 3.33Å; T57-A61 PolarHBondContact O-N 3.42Å
58	K	91.1	Very high	86.7	Confident	141 Å²	141	98 Å²	98	61%	0.613	52%	0.517	S	S	*	.	H	α-helix	trans	-67.6	-40.1	176.9	-73.3	178.1	179.6	179	0	112.2	E54 F55 A61 A62	E54-K58 WeakPolarHBondContact O-CG 3.41Å; E54-K58 PolarHBondContact O-N 3.43Å; F55-K58 PolarHBondContact O-N 3.36Å; F55-K58 VanDerWaalsContact O-N 3.09Å; K58-A61 PolarHBondContact O-N 3.26Å; K58-A62 WeakPolarHBondContact O-CB 3.41Å; K58-A62 PolarHBondContact O-N 2.95Å
59	E	89.3	Confident	85.8	Confident	94 Å²	94	94.2 Å²	94.2	44%	0.439	51%	0.512	S	S	.	.	H	α-helix	trans	-59.9	-49.6	175.4	-177.7	-179.7	-158.8	0	0	110.9	F55 K56 A61 A62 L63	F55-E59 WeakPolarHBondContact O-CB 3.28Å; F55-E59 PolarHBondContact O-N 2.91Å; K56-E59 PolarHBondContact O-N 3.09Å; E59-A61 VanDerWaalsContact C-N 3.35Å; E59-A61 PolarHBondContact O-N 2.87Å; E59-A62 PolarHBondContact O-N 2.83Å; E59-L63 HydrophobicContact CG-CD1 4.15Å; E59-L63 WeakPolarHBondContact O-CG 3.27Å; E59-L63 PolarHBondContact O-N 2.93Å
60	A	87.6	Confident	85.1	Confident	63 Å²	63	91.6 Å²	91.6	52%	0.521	51%	0.507	S	S	.	.	H	α-helix	trans	-61.5	-41.4	176.4	0	0	0	0	0	112.3	K56 G64	K56-A60 WeakPolarHBondContact O-CB 3.37Å; K56-A60 PolarHBondContact O-N 3.49Å; A60-G64 PolarHBondContact O-N 2.72Å
61	A	86.8	Confident	84.6	Confident	64 Å²	64	90.8 Å²	90.8	53%	0.529	51%	0.51	S	S	.	.	H	α-helix	trans	-64.4	-41	176	0	0	0	0	0	112.4	T57 K58 E59 G64 S65	T57-A61 WeakPolarHBondContact O-CB 3.33Å; T57-A61 PolarHBondContact O-N 3.42Å; K58-A61 PolarHBondContact O-N 3.26Å; E59-A61 VanDerWaalsContact C-N 3.35Å; E59-A61 PolarHBondContact O-N 2.87Å; A61-G64 PolarHBondContact O-N 3.1Å; A61-S65 VanDerWaalsContact O-CB 3.27Å; A61-S65 WeakPolarHBondContact O-CB 3.41Å; A61-S65 PolarHBondContact O-N 2.92Å
62	A	83	Confident	84.2	Confident	52 Å²	52	91.1 Å²	91.1	43%	0.43	52%	0.517	S	S	.	.	H	α-helix	trans	-66.2	-44.9	177.6	0	0	0	0	0	111.7	K58 E59 S65 H66	K58-A62 WeakPolarHBondContact O-CB 3.41Å; K58-A62 PolarHBondContact O-N 2.95Å; E59-A62 PolarHBondContact O-N 2.83Å; A62-S65 PolarHBondContact O-N 3.49Å; A62-H66 PolarHBondContact O-CD2 3.48Å; A62-H66 PolarHBondContact O-N 3.24Å
63	L	77.4	Confident	84	Confident	120 Å²	120	91 Å²	91	63%	0.628	52%	0.521	S	S	*	.	H	α-helix	trans	-63.8	-40	176.1	-71.6	170	0	0	0	112.1	E59	E59-L63 HydrophobicContact CG-CD1 4.15Å; E59-L63 WeakPolarHBondContact O-CG 3.27Å; E59-L63 PolarHBondContact O-N 2.93Å
64	G	71.8	Confident	83.8	Confident	53 Å²	53	88.7 Å²	88.7	55%	0.546	52%	0.516	S	S	.	.	H	α-helix	trans	-68.4	-33.7	175.4	0	0	0	0	0	113.6	A60 A61 G67	A60-G64 PolarHBondContact O-N 2.72Å; A61-G64 PolarHBondContact O-N 3.1Å; G64-G67 PolarHBondContact O-N 3.42Å
65	S	65.8	Low	83.8	Confident	69 Å²	69	93.5 Å²	93.5	48%	0.483	54%	0.536	S	S	.	.	H	α-helix	trans	-66.4	-37.6	179.6	-172.4	0	0	0	0	112.6	A61 A62 G67 N68 S69	A61-S65 VanDerWaalsContact O-CB 3.27Å; A61-S65 WeakPolarHBondContact O-CB 3.41Å; A61-S65 PolarHBondContact O-N 2.92Å; A62-S65 PolarHBondContact O-N 3.49Å; S65-G67 VanDerWaalsContact C-N 3.26Å; S65-G67 PolarHBondContact O-N 3.42Å; S65-N68 PolarHBondContact O-N 3.07Å; S65-N68 VanDerWaalsContact O-N 3.1Å; S65-S69 PolarHBondContact O-N 3.5Å
66	H	61.7	Low	83.8	Confident	142 Å²	142	92.4 Å²	92.4	66%	0.657	53%	0.533	S	S	*	.	H	α-helix	trans	-59.5	-34.1	179.7	-82.7	-57.3	0	0	0	113.6	A62	A62-H66 PolarHBondContact O-CD2 3.48Å; A62-H66 PolarHBondContact O-N 3.24Å
67	G	66.2	Low	83.9	Confident	45 Å²	45	90.3 Å²	90.3	46%	0.464	53%	0.529	S	S	.	.	H	α-helix	trans	-67.6	-36.8	176.4	0	0	0	0	0	113.1	G64 S65 V71	G64-G67 PolarHBondContact O-N 3.42Å; S65-G67 VanDerWaalsContact C-N 3.26Å; S65-G67 PolarHBondContact O-N 3.42Å; G67-V71 WeakPolarHBondContact O-CG2 3.38Å
68	N	74.1	Confident	84	Confident	108 Å²	108	91 Å²	91	58%	0.578	53%	0.533	S	S	*	.	H	α-helix	trans	-74.1	-36.7	-178	-164.5	62.4	0	0	0	112.3	S65 A70 V71 E72	S65-N68 PolarHBondContact O-N 3.07Å; S65-N68 VanDerWaalsContact O-N 3.1Å; N68-A70 PolarHBondContact O-N 3.23Å; N68-V71 PolarHBondContact O-N 3.31Å; N68-E72 PolarHBondContact O-N 2.63Å
69	S	79	Confident	84.3	Confident	58 Å²	58	86.3 Å²	86.3	41%	0.406	52%	0.524	S	S	.	.	H	α-helix	trans	-64.8	-38.7	177.9	-62.9	0	0	0	0	113.1	S65 E72 V73	S65-S69 PolarHBondContact O-N 3.5Å; S69-E72 PolarHBondContact O-N 2.97Å; S69-V73 VanDerWaalsContact O-CG2 3.32Å; S69-V73 WeakPolarHBondContact O-CG2 3.01Å; S69-V73 PolarHBondContact O-N 3.4Å
70	A	83.6	Confident	84.7	Confident	52 Å²	52	87.1 Å²	87.1	43%	0.43	53%	0.526	S	S	.	.	H	α-helix	trans	-63	-45.1	176.9	0	0	0	0	0	111.6	N68 E72 V73 D74	N68-A70 PolarHBondContact O-N 3.23Å; A70-E72 VanDerWaalsContact C-N 3.33Å; A70-E72 PolarHBondContact O-N 3.48Å; A70-V73 PolarHBondContact O-N 2.97Å; A70-D74 WeakPolarHBondContact O-CB 3.45Å; A70-D74 PolarHBondContact O-N 2.86Å
71	V	87.1	Confident	85.2	Confident	96 Å²	96	90.1 Å²	90.1	58%	0.582	53%	0.531	S	S	*	.	H	α-helix	trans	-63.1	-39.7	178.6	176	0	0	0	0	111.7	G67 N68 D74 K75	G67-V71 WeakPolarHBondContact O-CG2 3.38Å; N68-V71 PolarHBondContact O-N 3.31Å; V71-D74 PolarHBondContact O-N 3.3Å; V71-K75 WeakPolarHBondContact O-CB 3.48Å; V71-K75 PolarHBondContact O-N 3.33Å
72	E	88.9	Confident	85.7	Confident	128 Å²	128	88.8 Å²	88.8	60%	0.598	52%	0.523	S	S	*	.	H	α-helix	trans	-66.7	-43.8	178.1	-170.7	169.8	-166.4	0	0	111.9	N68 S69 A70 K75 E76	N68-E72 PolarHBondContact O-N 2.63Å; S69-E72 PolarHBondContact O-N 2.97Å; A70-E72 VanDerWaalsContact C-N 3.33Å; A70-E72 PolarHBondContact O-N 3.48Å; E72-K75 PolarHBondContact O-N 3.05Å; E72-E76 PolarHBondContact O-N 3.05Å
73	V	92.6	Very high	86.4	Confident	80 Å²	80	90.1 Å²	90.1	49%	0.485	53%	0.53	S	S	.	.	H	α-helix	trans	-62.8	-42.4	174.9	171.9	0	0	0	0	111.3	S69 A70 K75 E76 T77	S69-V73 VanDerWaalsContact O-CG2 3.32Å; S69-V73 WeakPolarHBondContact O-CG2 3.01Å; S69-V73 PolarHBondContact O-N 3.4Å; A70-V73 PolarHBondContact O-N 2.97Å; V73-K75 PolarHBondContact O-N 3.24Å; V73-E76 PolarHBondContact O-N 3.41Å; V73-T77 VanDerWaalsContact O-CB 3.32Å; V73-T77 WeakPolarHBondContact O-CB 3.44Å; V73-T77 PolarHBondContact O-N 3.47Å; V73-T77 PolarHBondContact O-OG1 3.24Å
74	D	93.8	Very high	87.4	Confident	104 Å²	104	90 Å²	90	56%	0.556	53%	0.529	S	S	*	.	H	α-helix	trans	-62.5	-44.3	177.2	-76.9	-18.2	0	0	0	111.1	A70 V71 E76 T77 V78	A70-D74 WeakPolarHBondContact O-CB 3.45Å; A70-D74 PolarHBondContact O-N 2.86Å; V71-D74 PolarHBondContact O-N 3.3Å; D74-E76 PolarHBondContact O-N 3.24Å; D74-T77 WeakPolarHBondContact O-CB 3.5Å; D74-T77 PolarHBondContact O-N 3.35Å; D74-V78 WeakPolarHBondContact O-CG2 3.45Å; D74-V78 PolarHBondContact O-N 3.38Å
75	K	95.4	Very high	88.6	Confident	169 Å²	169	92.8 Å²	92.8	74%	0.735	53%	0.527	S	S	*	.	H	α-helix	trans	-60.9	-45	176.5	-175.4	-177.6	177.5	-175.3	0	111.8	V71 E72 V73 T77 G79	V71-K75 WeakPolarHBondContact O-CB 3.48Å; V71-K75 PolarHBondContact O-N 3.33Å; E72-K75 PolarHBondContact O-N 3.05Å; V73-K75 PolarHBondContact O-N 3.24Å; K75-T77 VanDerWaalsContact C-N 3.33Å; K75-G79 PolarHBondContact O-N 2.94Å
76	E	96.1	Very high	90.1	Very high	105 Å²	105	93 Å²	93	49%	0.491	53%	0.526	S	S	.	.	H	α-helix	trans	-63.8	-40.9	176.7	-166.8	-171.7	170.1	0	0	111.3	E72 V73 D74 G79 K80	E72-E76 PolarHBondContact O-N 3.05Å; V73-E76 PolarHBondContact O-N 3.41Å; D74-E76 PolarHBondContact O-N 3.24Å; E76-G79 PolarHBondContact O-N 3.5Å; E76-K80 HydrophobicContact CG-CD 4.41Å; E76-K80 WeakPolarHBondContact O-CG 3.32Å; E76-K80 PolarHBondContact O-N 2.74Å; E76-K80 WeakPolarHBondContact OE1-CE 3.32Å; E76-K80 IonicContact OE1-NZ 2.63Å; E76-K80 PolarHBondContact OE1-NZ 2.85Å
77	T	96.6	Very high	91.8	Very high	65 Å²	65	89.1 Å²	89.1	40%	0.399	52%	0.515	S	S	.	.	H	α-helix	trans	-61.6	-48	178.5	-60.6	0	0	0	0	111.1	V73 D74 K75 G79 K80 M81	V73-T77 VanDerWaalsContact O-CB 3.32Å; V73-T77 WeakPolarHBondContact O-CB 3.44Å; V73-T77 PolarHBondContact O-N 3.47Å; V73-T77 PolarHBondContact O-OG1 3.24Å; D74-T77 WeakPolarHBondContact O-CB 3.5Å; D74-T77 PolarHBondContact O-N 3.35Å; K75-T77 VanDerWaalsContact C-N 3.33Å; T77-G79 VanDerWaalsContact C-N 3.31Å; T77-G79 PolarHBondContact O-N 3.33Å; T77-K80 PolarHBondContact O-N 3.34Å; T77-M81 HydrophobicContact CG2-SD 4.47Å; T77-M81 WeakPolarHBondContact O-CG 3.41Å; T77-M81 PolarHBondContact O-N 3.03Å
78	V	97	Very high	93.3	Very high	104 Å²	104	93.4 Å²	93.4	63%	0.63	52%	0.518	S	S	*	.	H	α-helix	trans	-60.6	-41.8	175.8	172.9	0	0	0	0	111.1	D74 M81 G82	D74-V78 WeakPolarHBondContact O-CG2 3.45Å; D74-V78 PolarHBondContact O-N 3.38Å; V78-M81 PolarHBondContact O-N 3.04Å; V78-G82 PolarHBondContact O-N 2.81Å
79	G	97.1	Very high	94.4	Very high	41 Å²	41	94 Å²	94	42%	0.423	52%	0.517	S	S	.	.	H	α-helix	trans	-62	-43.5	175.8	0	0	0	0	0	113.2	K75 E76 T77 G82 S83	K75-G79 PolarHBondContact O-N 2.94Å; E76-G79 PolarHBondContact O-N 3.5Å; T77-G79 VanDerWaalsContact C-N 3.31Å; T77-G79 PolarHBondContact O-N 3.33Å; G79-G82 PolarHBondContact O-N 2.91Å; G79-S83 PolarHBondContact O-N 2.9Å; G79-S83 PolarHBondContact O-OG 3.47Å
80	K	97.4	Very high	95.3	Very high	112 Å²	112	100.4 Å²	100.4	49%	0.487	53%	0.532	S	S	.	.	H	α-helix	trans	-65	-43.4	176.2	-76.7	177.2	-178.1	165.1	0	111.6	E76 T77 G82 S83 I84	E76-K80 HydrophobicContact CG-CD 4.41Å; E76-K80 WeakPolarHBondContact O-CG 3.32Å; E76-K80 PolarHBondContact O-N 2.74Å; E76-K80 WeakPolarHBondContact OE1-CE 3.32Å; E76-K80 IonicContact OE1-NZ 2.63Å; E76-K80 PolarHBondContact OE1-NZ 2.85Å; T77-K80 PolarHBondContact O-N 3.34Å; K80-G82 VanDerWaalsContact C-N 3.33Å; K80-G82 PolarHBondContact O-N 2.99Å; K80-S83 WeakPolarHBondContact O-CB 3.45Å; K80-S83 PolarHBondContact O-N 3.39Å; K80-S83 VanDerWaalsContact O-N 3.16Å; K80-I84 WeakPolarHBondContact O-CG1 3.39Å; K80-I84 PolarHBondContact O-N 2.9Å
81	M	97.4	Very high	95.9	Very high	125 Å²	125	102 Å²	102	62%	0.616	53%	0.533	S	S	*	.	H	α-helix	trans	-58	-45.3	174.9	-75.5	-175.6	65.3	0	0	111.7	T77 V78 S83 I84 Q85	T77-M81 HydrophobicContact CG2-SD 4.47Å; T77-M81 WeakPolarHBondContact O-CG 3.41Å; T77-M81 PolarHBondContact O-N 3.03Å; V78-M81 PolarHBondContact O-N 3.04Å; M81-S83 VanDerWaalsContact C-N 3.31Å; M81-S83 PolarHBondContact O-N 3.4Å; M81-I84 PolarHBondContact O-N 3.46Å; M81-Q85 WeakPolarHBondContact O-CB 3.35Å; M81-Q85 PolarHBondContact O-N 3.16Å
82	G	97.8	Very high	96.3	Very high	36 Å²	36	102.8 Å²	102.8	37%	0.371	53%	0.526	S	S	.	.	H	α-helix	trans	-61.3	-38.9	176	0	0	0	0	0	113	V78 G79 K80 Q85 T86	V78-G82 PolarHBondContact O-N 2.81Å; G79-G82 PolarHBondContact O-N 2.91Å; K80-G82 VanDerWaalsContact C-N 3.33Å; K80-G82 PolarHBondContact O-N 2.99Å; G82-Q85 PolarHBondContact O-N 3.4Å; G82-T86 WeakPolarHBondContact O-CB 3.38Å; G82-T86 PolarHBondContact O-N 3.29Å; G82-T86 PolarHBondContact O-OG1 2.9Å
83	S	97.6	Very high	96.7	Very high	80 Å²	80	102 Å²	102	56%	0.559	52%	0.522	S	S	*	.	H	α-helix	trans	-65.8	-43.6	176.3	-57.8	0	0	0	0	112.1	G79 K80 M81 T86 S87	G79-S83 PolarHBondContact O-N 2.9Å; G79-S83 PolarHBondContact O-OG 3.47Å; K80-S83 WeakPolarHBondContact O-CB 3.45Å; K80-S83 PolarHBondContact O-N 3.39Å; K80-S83 VanDerWaalsContact O-N 3.16Å; M81-S83 VanDerWaalsContact C-N 3.31Å; M81-S83 PolarHBondContact O-N 3.4Å; S83-T86 PolarHBondContact O-N 3.39Å; S83-S87 WeakPolarHBondContact O-CB 3.35Å; S83-S87 PolarHBondContact O-N 3.49Å
84	I	97.7	Very high	96.9	Very high	119 Å²	119	100.3 Å²	100.3	61%	0.61	52%	0.522	S	S	*	.	H	α-helix	trans	-61.9	-47.5	175.6	-68.9	167.2	0	0	0	110.4	K80 M81 T86 S87 Y88	K80-I84 WeakPolarHBondContact O-CG1 3.39Å; K80-I84 PolarHBondContact O-N 2.9Å; M81-I84 PolarHBondContact O-N 3.46Å; I84-T86 VanDerWaalsContact C-N 3.32Å; I84-T86 PolarHBondContact O-N 2.87Å; I84-S87 PolarHBondContact O-N 2.93Å; I84-Y88 WeakPolarHBondContact O-CB 3.32Å; I84-Y88 PolarHBondContact O-N 2.84Å
85	Q	97.6	Very high	97.1	Very high	111 Å²	111	99.9 Å²	99.9	52%	0.519	52%	0.522	S	S	.	.	H	α-helix	trans	-57.5	-45.7	178.5	-171.8	81.7	-5.4	0	0	111.2	M81 G82 Y88 Q89	M81-Q85 WeakPolarHBondContact O-CB 3.35Å; M81-Q85 PolarHBondContact O-N 3.16Å; G82-Q85 PolarHBondContact O-N 3.4Å; Q85-Y88 PolarHBondContact O-N 3Å; Q85-Q89 VanDerWaalsContact O-CG 3.32Å; Q85-Q89 WeakPolarHBondContact O-CG 3.41Å; Q85-Q89 PolarHBondContact O-N 3.43Å
86	T	97.8	Very high	97.2	Very high	73 Å²	73	95.4 Å²	95.4	45%	0.448	51%	0.506	S	S	.	.	H	α-helix	trans	-64.9	-43.7	179.3	-56.6	0	0	0	0	111.4	G82 S83 I84 Q89 R90	G82-T86 WeakPolarHBondContact O-CB 3.38Å; G82-T86 PolarHBondContact O-N 3.29Å; G82-T86 PolarHBondContact O-OG1 2.9Å; S83-T86 PolarHBondContact O-N 3.39Å; I84-T86 VanDerWaalsContact C-N 3.32Å; I84-T86 PolarHBondContact O-N 2.87Å; T86-Q89 PolarHBondContact O-N 3.24Å; T86-R90 WeakPolarHBondContact O-CB 3.44Å; T86-R90 PolarHBondContact O-N 2.96Å
87	S	97.5	Very high	97.2	Very high	61 Å²	61	92.3 Å²	92.3	43%	0.427	50%	0.502	S	S	.	.	H	α-helix	trans	-62.8	-43.2	176.4	-174.2	0	0	0	0	111.7	S83 I84 R90 N91	S83-S87 WeakPolarHBondContact O-CB 3.35Å; S83-S87 PolarHBondContact O-N 3.49Å; I84-S87 PolarHBondContact O-N 2.93Å; S87-R90 PolarHBondContact O-N 3.17Å; S87-N91 PolarHBondContact O-N 3.46Å; S87-N91 PolarHBondContact O-ND2 3.37Å
88	Y	97.2	Very high	97.2	Very high	135 Å²	135	94 Å²	94	53%	0.529	51%	0.509	S	S	.	.	H	α-helix	trans	-59.7	-53.4	175.4	170.8	-99.5	0	0	0	111.2	I84 Q85 R90 N91 R92	I84-Y88 WeakPolarHBondContact O-CB 3.32Å; I84-Y88 PolarHBondContact O-N 2.84Å; Q85-Y88 PolarHBondContact O-N 3Å; Y88-R90 VanDerWaalsContact C-N 3.28Å; Y88-R90 PolarHBondContact O-N 3.28Å; Y88-N91 PolarHBondContact O-N 2.84Å; Y88-N91 VanDerWaalsContact O-N 3.14Å; Y88-R92 HydrophobicContact CE1-CG 4.32Å; Y88-R92 HydrophobicContact CE2-CG 4.36Å; Y88-R92 WeakPolarHBondContact O-CB 3.34Å; Y88-R92 PolarHBondContact O-N 3.05Å; Y88-R92 WeakPolarHBondContact OH-CD 3.49Å
89	Q	96.8	Very high	97.2	Very high	119 Å²	119	94 Å²	94	56%	0.556	51%	0.505	S	S	*	.	H	α-helix	trans	-58	-40.5	-178.8	-73.7	176.3	-0.6	0	0	112.3	Q85 T86 N91	Q85-Q89 VanDerWaalsContact O-CG 3.32Å; Q85-Q89 WeakPolarHBondContact O-CG 3.41Å; Q85-Q89 PolarHBondContact O-N 3.43Å; T86-Q89 PolarHBondContact O-N 3.24Å; Q89-N91 PolarHBondContact O-N 3.14Å
90	R	97.5	Very high	97.2	Very high	194 Å²	194	97.2 Å²	97.2	73%	0.732	51%	0.512	S	S	*	.	H	α-helix	trans	-62.6	-41.2	177.9	-175	-177	-60.5	171.2	1.9	112.7	T86 S87 Y88	T86-R90 WeakPolarHBondContact O-CB 3.44Å; T86-R90 PolarHBondContact O-N 2.96Å; S87-R90 PolarHBondContact O-N 3.17Å; Y88-R90 VanDerWaalsContact C-N 3.28Å; Y88-R90 PolarHBondContact O-N 3.28Å
91	N	96.9	Very high	97.1	Very high	84 Å²	84	99.3 Å²	99.3	45%	0.449	52%	0.521	S	S	.	.	H	α-helix	trans	-95.9	-14.9	-171.6	-64.9	-57.3	0	0	0	113.5	S87 Y88 Q89 E93 G94 V95	S87-N91 PolarHBondContact O-N 3.46Å; S87-N91 PolarHBondContact O-ND2 3.37Å; Y88-N91 PolarHBondContact O-N 2.84Å; Y88-N91 VanDerWaalsContact O-N 3.14Å; Q89-N91 PolarHBondContact O-N 3.14Å; N91-E93 PolarHBondContact O-N 3.44Å; N91-G94 PolarHBondContact O-N 2.95Å; N91-V95 WeakPolarHBondContact O-CG2 3.41Å; N91-V95 PolarHBondContact O-N 2.82Å
92	R	96.6	Very high	97	Very high	113 Å²	113	100.2 Å²	100.2	43%	0.426	53%	0.525	S	S	.	.	H	α-helix	trans	-51	-54.9	-172.4	-172.2	-176.8	85.8	171.6	6.2	112.8	Y88 G94 V95 L96	Y88-R92 HydrophobicContact CE1-CG 4.32Å; Y88-R92 HydrophobicContact CE2-CG 4.36Å; Y88-R92 WeakPolarHBondContact O-CB 3.34Å; Y88-R92 PolarHBondContact O-N 3.05Å; Y88-R92 WeakPolarHBondContact OH-CD 3.49Å; R92-G94 VanDerWaalsContact C-N 3.35Å; R92-G94 PolarHBondContact O-N 3.33Å; R92-V95 PolarHBondContact O-N 2.91Å; R92-L96 HydrophobicContact CG-CD1 3.91Å; R92-L96 HydrophobicContact CG-CG 4.47Å; R92-L96 WeakPolarHBondContact O-CB 3.43Å; R92-L96 WeakPolarHBondContact O-CG 3.36Å; R92-L96 PolarHBondContact O-N 3.47Å
93	E	96.9	Very high	96.9	Very high	111 Å²	111	103.4 Å²	103.4	52%	0.519	54%	0.537	S	S	.	.	H	α-helix	trans	-66.1	-37.9	-174.7	-61.8	-53.9	137.4	0	0	112.2	N91 L96 G97	N91-E93 PolarHBondContact O-N 3.44Å; E93-L96 PolarHBondContact O-N 3.24Å; E93-G97 PolarHBondContact O-N 3.34Å
94	G	96.8	Very high	96.7	Very high	46 Å²	46	104.3 Å²	104.3	47%	0.474	54%	0.542	S	S	.	.	H	α-helix	trans	-65	-41.9	176.8	0	0	0	0	0	112.6	N91 R92 N98	N91-G94 PolarHBondContact O-N 2.95Å; R92-G94 VanDerWaalsContact C-N 3.35Å; R92-G94 PolarHBondContact O-N 3.33Å; G94-N98 PolarHBondContact O-N 2.95Å; G94-N98 VanDerWaalsContact O-N 3.12Å; G94-N98 PolarHBondContact O-ND2 3.12Å
95	V	97.5	Very high	96.6	Very high	94 Å²	94	102.4 Å²	102.4	57%	0.57	53%	0.534	S	S	*	.	H	α-helix	trans	-67	-45.5	176.8	175.5	0	0	0	0	111	N91 R92 G97 N98 L99	N91-V95 WeakPolarHBondContact O-CG2 3.41Å; N91-V95 PolarHBondContact O-N 2.82Å; R92-V95 PolarHBondContact O-N 2.91Å; V95-G97 PolarHBondContact O-N 3.49Å; V95-N98 PolarHBondContact O-N 2.9Å; V95-L99 WeakPolarHBondContact O-CB 3.36Å; V95-L99 PolarHBondContact O-N 3.46Å
96	L	96.8	Very high	96.3	Very high	76 Å²	76	104 Å²	104	40%	0.398	54%	0.544	S	S	.	.	H	α-helix	trans	-60.4	-45.2	177.3	-74.3	174.3	0	0	0	111.7	R92 E93 N98 L99 L100	R92-L96 HydrophobicContact CG-CD1 3.91Å; R92-L96 HydrophobicContact CG-CG 4.47Å; R92-L96 WeakPolarHBondContact O-CB 3.43Å; R92-L96 WeakPolarHBondContact O-CG 3.36Å; R92-L96 PolarHBondContact O-N 3.47Å; E93-L96 PolarHBondContact O-N 3.24Å; L96-N98 PolarHBondContact O-N 2.94Å; L96-L99 PolarHBondContact O-N 3.37Å; L96-L100 WeakPolarHBondContact O-CB 3.26Å; L96-L100 WeakPolarHBondContact O-CG 3.37Å; L96-L100 PolarHBondContact O-N 3.04Å
97	G	96.9	Very high	96.1	Very high	39 Å²	39	107.2 Å²	107.2	40%	0.402	55%	0.552	S	S	.	*	H	α-helix	trans	-60.2	-44.6	178.2	0	0	0	0	0	112.5	E93 V95 K101	E93-G97 PolarHBondContact O-N 3.34Å; V95-G97 PolarHBondContact O-N 3.49Å; G97-K101 VanDerWaalsContact O-CB 3.28Å; G97-K101 WeakPolarHBondContact O-CB 3.33Å; G97-K101 PolarHBondContact O-N 3.42Å
98	N	96.6	Very high	95.7	Very high	102 Å²	102	110 Å²	110	55%	0.545	57%	0.568	S	S	.	*	H	α-helix	trans	-64.5	-43.9	176.9	-74.5	-19.9	0	0	0	112.1	G94 V95 L96 K101 M102	G94-N98 PolarHBondContact O-N 2.95Å; G94-N98 VanDerWaalsContact O-N 3.12Å; G94-N98 PolarHBondContact O-ND2 3.12Å; V95-N98 PolarHBondContact O-N 2.9Å; L96-N98 PolarHBondContact O-N 2.94Å; N98-K101 PolarHBondContact O-N 3.42Å; N98-M102 WeakPolarHBondContact O-CG 3.42Å; N98-M102 PolarHBondContact O-N 3.41Å
99	L	96.9	Very high	95.5	Very high	102 Å²	102	111.7 Å²	111.7	53%	0.534	58%	0.581	S	S	.	*	H	α-helix	trans	-62.2	-48.9	178.5	-178.7	62.8	0	0	0	111.3	V95 L96 K101 M102 V103	V95-L99 WeakPolarHBondContact O-CB 3.36Å; V95-L99 PolarHBondContact O-N 3.46Å; L96-L99 PolarHBondContact O-N 3.37Å; L99-K101 VanDerWaalsContact C-N 3.34Å; L99-K101 PolarHBondContact O-N 3.25Å; L99-M102 PolarHBondContact O-N 3.45Å; L99-V103 HydrophobicContact CD1-CG2 4.33Å; L99-V103 VanDerWaalsContact O-CG2 3.28Å; L99-V103 WeakPolarHBondContact O-CG2 3.28Å; L99-V103 PolarHBondContact O-N 3.31Å
100	L	96.5	Very high	95.2	Very high	109 Å²	109	112 Å²	112	57%	0.571	59%	0.585	S	S	*	*	H	α-helix	trans	-61.8	-42	178.1	-71.5	172.9	0	0	0	111.7	L96 M102 V103 C104	L96-L100 WeakPolarHBondContact O-CB 3.26Å; L96-L100 WeakPolarHBondContact O-CG 3.37Å; L96-L100 PolarHBondContact O-N 3.04Å; L100-M102 VanDerWaalsContact C-N 3.33Å; L100-M102 PolarHBondContact O-N 2.97Å; L100-V103 PolarHBondContact O-N 2.69Å; L100-C104 WeakPolarHBondContact O-CB 3.13Å; L100-C104 PolarHBondContact O-N 3.38Å; L100-C104 PolarHBondContact O-SG 3.46Å; L100-C104 VanDerWaalsContact O-SG 3.38Å
101	K	96.5	Very high	94.9	Very high	156 Å²	156	109.3 Å²	109.3	68%	0.678	58%	0.581	S	S	*	*	H	α-helix	trans	-57.9	-45.8	175.7	-177.8	-179.9	178.1	-178.9	0	111.7	G97 N98 L99 D105	G97-K101 VanDerWaalsContact O-CB 3.28Å; G97-K101 WeakPolarHBondContact O-CB 3.33Å; G97-K101 PolarHBondContact O-N 3.42Å; N98-K101 PolarHBondContact O-N 3.42Å; L99-K101 VanDerWaalsContact C-N 3.34Å; L99-K101 PolarHBondContact O-N 3.25Å; K101-D105 VanDerWaalsContact O-CB 3.26Å; K101-D105 WeakPolarHBondContact O-CB 3.28Å; K101-D105 PolarHBondContact O-N 3.09Å; K101-D105 VanDerWaalsContact O-N 3.09Å
102	M	94.9	Very high	94.8	Very high	145 Å²	145	110 Å²	110	71%	0.714	60%	0.598	S	S	*	*	H	α-helix	trans	-66.5	-40.4	178.8	-70.2	179.6	-174.2	0	0	112.3	N98 L99 L100 D105	N98-M102 WeakPolarHBondContact O-CG 3.42Å; N98-M102 PolarHBondContact O-N 3.41Å; L99-M102 PolarHBondContact O-N 3.45Å; L100-M102 VanDerWaalsContact C-N 3.33Å; L100-M102 PolarHBondContact O-N 2.97Å; M102-D105 PolarHBondContact O-N 2.94Å
103	V	95.3	Very high	94.7	Very high	103 Å²	103	110.6 Å²	110.6	62%	0.624	61%	0.61	S	S	*	*	H	α-helix	trans	-68.1	-36	-179.8	172.2	0	0	0	0	111.7	L99 L100	L99-V103 HydrophobicContact CD1-CG2 4.33Å; L99-V103 VanDerWaalsContact O-CG2 3.28Å; L99-V103 WeakPolarHBondContact O-CG2 3.28Å; L99-V103 PolarHBondContact O-N 3.31Å; L100-V103 PolarHBondContact O-N 2.69Å
104	C	94.3	Very high	94.5	Very high	98 Å²	98	112.2 Å²	112.2	66%	0.662	61%	0.612	S	S	*	*	H	α-helix	trans	-85.1	-12.6	179.5	-64.7	0	0	0	0	114.1	L100 I106	L100-C104 WeakPolarHBondContact O-CB 3.13Å; L100-C104 PolarHBondContact O-N 3.38Å; L100-C104 PolarHBondContact O-SG 3.46Å; L100-C104 VanDerWaalsContact O-SG 3.38Å; C104-I106 PolarHBondContact O-N 3.1Å; C104-I106 VanDerWaalsContact O-N 3.1Å
105	D	94.6	Very high	94	Very high	80 Å²	80	120.8 Å²	120.8	43%	0.428	63%	0.63	S	S	.	*			trans	-83.8	75.7	177.8	-175	22.2	0	0	0	110.8	K101 M102 K107	K101-D105 VanDerWaalsContact O-CB 3.26Å; K101-D105 WeakPolarHBondContact O-CB 3.28Å; K101-D105 PolarHBondContact O-N 3.09Å; K101-D105 VanDerWaalsContact O-N 3.09Å; M102-D105 PolarHBondContact O-N 2.94Å; D105-K107 PolarHBondContact O-N 3.29Å; D105-K107 WeakPolarHBondContact OD2-CE 3.4Å; D105-K107 IonicContact OD2-NZ 2.69Å; D105-K107 PolarHBondContact OD2-NZ 3.23Å
106	I	92.3	Very high	93.3	Very high	144 Å²	144	124.3 Å²	124.3	74%	0.738	64%	0.638	S	S	*	*			trans	-72.3	113.5	178.6	-56	176	0	0	0	109	C104 P108	C104-I106 PolarHBondContact O-N 3.1Å; C104-I106 VanDerWaalsContact O-N 3.1Å; I106-P108 WeakPolarHBondContact O-CD 3.19Å
107	K	91.9	Very high	92.2	Very high	141 Å²	141	125.8 Å²	125.8	61%	0.613	66%	0.661	S	S	*	*			trans	-106.9	89.3	172.6	-70.8	178.5	-178.3	139.2	0	109.7	D105 E109	D105-K107 PolarHBondContact O-N 3.29Å; D105-K107 WeakPolarHBondContact OD2-CE 3.4Å; D105-K107 IonicContact OD2-NZ 2.69Å; D105-K107 PolarHBondContact OD2-NZ 3.23Å; K107-E109 PolarHBondContact O-N 3.15Å; K107-E109 VanDerWaalsContact O-N 3.15Å
108	P	90.6	Very high	90.1	Very high	118 Å²	118	129.9 Å²	129.9	77%	0.766	70%	0.704	S	S	*	*			trans	-69.1	114	176.5	28.2	-31.1	0	0	0	108.6	I106	I106-P108 WeakPolarHBondContact O-CD 3.19Å
109	E	92.9	Very high	89.8	Confident	171 Å²	171	131.3 Å²	131.3	80%	0.799	71%	0.711	S	S	*	*			trans	-111.3	134.4	174.2	-69.1	-175.6	-179.7	0	0	109.2	K107 H111	K107-E109 PolarHBondContact O-N 3.15Å; K107-E109 VanDerWaalsContact O-N 3.15Å; E109-H111 PolarHBondContact O-N 3.5Å
110	I	90.1	Very high	89.4	Confident	126 Å²	126	132.8 Å²	132.8	65%	0.646	72%	0.721	S	S	*	*			trans	-71.8	130.9	168.2	-63.2	179.2	0	0	0	106.7	A112 Y114	I110-A112 PolarHBondContact O-N 3.36Å; I110-Y114 HydrophobicContact CG2-CD1 3.77Å; I110-Y114 HydrophobicContact CG2-CD2 4.14Å; I110-Y114 HydrophobicContact CG2-CG 3.43Å; I110-Y114 VanDerWaalsContact CG2-CG 3.43Å
111	H	92.1	Very high	89	Confident	138 Å²	138	134.2 Å²	134.2	64%	0.639	73%	0.729	S	S	*	*			trans	-51.9	135.9	178.2	-172.2	-85.6	0	0	0	110.4	E109 N113 Y114	E109-H111 PolarHBondContact O-N 3.5Å; H111-N113 PolarHBondContact ND1-N 2.84Å; H111-N113 PolarHBondContact O-N 3.36Å; H111-Y114 WeakPolarHBondContact O-CB 3.4Å; H111-Y114 PolarHBondContact O-N 2.86Å
112	A	93.6	Very high	88.6	Confident	98 Å²	98	132.9 Å²	132.9	81%	0.81	73%	0.732	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.9	-21.6	-170.9	0	0	0	0	0	115.1	I110	I110-A112 PolarHBondContact O-N 3.36Å
113	N	94.1	Very high	88.2	Confident	125 Å²	125	132.1 Å²	132.1	67%	0.668	73%	0.733	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.2	5.4	179.9	-62.3	-22.4	0	0	0	114.5	H111 R115	H111-N113 PolarHBondContact ND1-N 2.84Å; H111-N113 PolarHBondContact O-N 3.36Å; N113-R115 PolarHBondContact O-N 3.31Å
114	Y	92.6	Very high	87.7	Confident	146 Å²	146	134.1 Å²	134.1	57%	0.573	74%	0.74	S	S	*	*			trans	-62.8	125.8	176.9	179.5	-99.2	0	0	0	110.3	I110 H111	I110-Y114 HydrophobicContact CG2-CD1 3.77Å; I110-Y114 HydrophobicContact CG2-CD2 4.14Å; I110-Y114 HydrophobicContact CG2-CG 3.43Å; I110-Y114 VanDerWaalsContact CG2-CG 3.43Å; H111-Y114 WeakPolarHBondContact O-CB 3.4Å; H111-Y114 PolarHBondContact O-N 2.86Å
115	R	87.5	Confident	87.2	Confident	226 Å²	226	136.6 Å²	136.6	85%	0.853	75%	0.746	S	S	*	*			trans	-117.4	125.4	174.9	-66.2	-174.2	176.6	-173.9	-1.2	108.2	N113 A117	N113-R115 PolarHBondContact O-N 3.31Å; R115-A117 PolarHBondContact O-N 3.28Å
116	F	83	Confident	86.7	Confident	168 Å²	168	141 Å²	141	74%	0.737	77%	0.771	S	S	*	*			trans	-70.4	116.6	172.3	-171.7	-100	0	0	0	108.2	G118	F116-G118 PolarHBondContact O-N 3.39Å
117	A	72.8	Confident	86.2	Confident	106 Å²	106	140.8 Å²	140.8	88%	0.876	77%	0.773	S	S	*	*			trans	-91	89.1	173	0	0	0	0	0	108	R115	R115-A117 PolarHBondContact O-N 3.28Å
118	G	53.1	Low	85.7	Confident	126 Å²	126	140.7 Å²	140.7	100%	1.299	79%	0.788	S	S	*	*			trans	-142.2	0	170.9	0	0	0	0	0	109.1	F116	F116-G118 PolarHBondContact O-N 3.39Å

Retrieved 118 of 118 residues in 278.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).