A0A060WAU9_ONCMY Loading...

Protein BRICK1

AlphaFold DB (Q6IQ86), UniProt , Accession A0A060WAU9, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 75 aa.

						>A0A060WAU9_ONCMY|A0A060WAU9
MAGQEDPVQREIHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTKGETLT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	43.6	Very low	79.6	Confident	241 Å²	241	118.4 Å²	118.4	100%	1.187	65%	0.648	S	S	*	*				0	110.2	0	-68.3	-179.6	177.8	0	0	106	G3	M1-G3 PolarHBondContact O-N 2.9Å; M1-G3 VanDerWaalsContact O-N 3.1Å
2	A	61	Low	80.9	Confident	101 Å²	101	116.2 Å²	116.2	84%	0.835	63%	0.633	S	S	*	*			trans	-55	119	177.8	0	0	0	0	0	107.5	Q4	A2-Q4 PolarHBondContact O-N 3.1Å
3	G	64.6	Low	82.1	Confident	70 Å²	70	117.2 Å²	117.2	72%	0.722	63%	0.631	S	S	*	*			trans	-55.5	108.7	179.2	0	0	0	0	0	107.6	M1 E5	M1-G3 PolarHBondContact O-N 2.9Å; M1-G3 VanDerWaalsContact O-N 3.1Å; G3-E5 VanDerWaalsContact C-N 3.29Å; G3-E5 PolarHBondContact O-N 2.92Å
4	Q	68.9	Low	83.2	Confident	176 Å²	176	116.4 Å²	116.4	82%	0.822	62%	0.621	S	S	*	*			trans	-60.9	106	162.7	-76	178.1	-32.5	0	0	104.3	A2 D6	A2-Q4 PolarHBondContact O-N 3.1Å; Q4-D6 PolarHBondContact O-N 3.28Å
5	E	73.4	Confident	84.2	Confident	88 Å²	88	113.1 Å²	113.1	41%	0.411	60%	0.603	S	S	.	*			trans	-49.7	133.7	172.5	-65.9	-176.7	137.4	0	0	108.4	G3 R10	G3-E5 VanDerWaalsContact C-N 3.29Å; G3-E5 PolarHBondContact O-N 2.92Å; E5-R10 HydrophobicContact CB-CG 3.75Å; E5-R10 PolarHBondContact O-NE 2.92Å; E5-R10 PolarHBondContact O-NH2 3Å
6	D	90.4	Very high	85.1	Confident	88 Å²	88	116.1 Å²	116.1	47%	0.471	60%	0.604	S	S	.	*			trans	-47.4	133.5	174.1	-175.1	-32.4	0	0	0	108.5	Q4 V8 Q9 R10	Q4-D6 PolarHBondContact O-N 3.28Å; D6-V8 PolarHBondContact O-N 3.25Å; D6-V8 WeakPolarHBondContact OD1-CB 3.38Å; D6-V8 PolarHBondContact OD1-N 3.49Å; D6-Q9 HydrophobicContact CB-CB 4.1Å; D6-Q9 WeakPolarHBondContact O-CA 3.42Å; D6-Q9 WeakPolarHBondContact O-CB 3.5Å; D6-Q9 PolarHBondContact O-N 3.34Å; D6-R10 PolarHBondContact O-N 3.03Å
7	P	93.2	Very high	85.8	Confident	89 Å²	89	111.7 Å²	111.7	58%	0.578	59%	0.588	S	S	*	*	H	α-helix	trans	-42.2	-40.7	172.3	-30.8	34.8	0	0	0	113.5	R10 E11	P7-R10 PolarHBondContact O-N 2.83Å; P7-E11 WeakPolarHBondContact O-CG 3.42Å; P7-E11 PolarHBondContact O-N 3.44Å
8	V	94.4	Very high	86.5	Confident	82 Å²	82	109.8 Å²	109.8	50%	0.497	58%	0.579	S	S	.	*	H	α-helix	trans	-64.4	-41.8	177.3	-180	0	0	0	0	111.5	D6 R10 E11 I12	D6-V8 PolarHBondContact O-N 3.25Å; D6-V8 WeakPolarHBondContact OD1-CB 3.38Å; D6-V8 PolarHBondContact OD1-N 3.49Å; V8-R10 VanDerWaalsContact C-N 3.34Å; V8-R10 PolarHBondContact O-N 3.05Å; V8-E11 PolarHBondContact O-N 3.4Å; V8-I12 HydrophobicContact CG1-CD1 3.96Å; V8-I12 VanDerWaalsContact O-CG1 3.26Å; V8-I12 WeakPolarHBondContact O-CG1 3.43Å; V8-I12 PolarHBondContact O-N 2.91Å
9	Q	95.1	Very high	87.2	Confident	104 Å²	104	111.4 Å²	111.4	49%	0.486	58%	0.576	S	S	.	*	H	α-helix	trans	-65.7	-38.2	178.4	-174.7	174.8	-26.6	0	0	111.7	D6 I12 H13	D6-Q9 HydrophobicContact CB-CB 4.1Å; D6-Q9 WeakPolarHBondContact O-CA 3.42Å; D6-Q9 WeakPolarHBondContact O-CB 3.5Å; D6-Q9 PolarHBondContact O-N 3.34Å; Q9-I12 PolarHBondContact O-N 3.05Å; Q9-H13 WeakPolarHBondContact O-CB 3.26Å; Q9-H13 PolarHBondContact O-N 3.28Å
10	R	94.1	Very high	87.7	Confident	124 Å²	124	112.5 Å²	112.5	47%	0.468	58%	0.578	S	S	.	*	H	α-helix	trans	-65.1	-44.1	174.4	-66.1	-176.9	-174.3	164.2	8.8	112	E5 D6 P7 V8 I12 H13 Q14	E5-R10 HydrophobicContact CB-CG 3.75Å; E5-R10 PolarHBondContact O-NE 2.92Å; E5-R10 PolarHBondContact O-NH2 3Å; D6-R10 PolarHBondContact O-N 3.03Å; P7-R10 PolarHBondContact O-N 2.83Å; V8-R10 VanDerWaalsContact C-N 3.34Å; V8-R10 PolarHBondContact O-N 3.05Å; R10-I12 VanDerWaalsContact C-N 3.33Å; R10-I12 PolarHBondContact O-N 3.36Å; R10-H13 PolarHBondContact O-N 2.96Å; R10-Q14 WeakPolarHBondContact O-CB 3.5Å; R10-Q14 PolarHBondContact O-N 2.96Å
11	E	96.6	Very high	88.3	Confident	139 Å²	139	114.7 Å²	114.7	65%	0.65	58%	0.581	S	S	*	*	H	α-helix	trans	-60.1	-44.1	176.1	-76.2	179	-177.3	0	0	111.4	P7 V8 Q14 D15	P7-E11 WeakPolarHBondContact O-CG 3.42Å; P7-E11 PolarHBondContact O-N 3.44Å; V8-E11 PolarHBondContact O-N 3.4Å; E11-Q14 PolarHBondContact O-N 2.92Å; E11-D15 PolarHBondContact O-N 3.35Å
12	I	95.9	Very high	90.9	Very high	92 Å²	92	108.2 Å²	108.2	47%	0.472	55%	0.55	S	S	.	.	H	α-helix	trans	-60.5	-48.2	175.4	-69.6	166.4	0	0	0	110.5	V8 Q9 R10 Q14 D15 W16	V8-I12 HydrophobicContact CG1-CD1 3.96Å; V8-I12 VanDerWaalsContact O-CG1 3.26Å; V8-I12 WeakPolarHBondContact O-CG1 3.43Å; V8-I12 PolarHBondContact O-N 2.91Å; Q9-I12 PolarHBondContact O-N 3.05Å; R10-I12 VanDerWaalsContact C-N 3.33Å; R10-I12 PolarHBondContact O-N 3.36Å; I12-Q14 VanDerWaalsContact C-N 3.3Å; I12-Q14 PolarHBondContact O-N 3.35Å; I12-D15 PolarHBondContact O-N 3.04Å; I12-W16 PolarHBondContact O-N 3.29Å
13	H	96.2	Very high	92.7	Very high	130 Å²	130	110 Å²	110	60%	0.602	54%	0.541	S	S	*	.	H	α-helix	trans	-61.6	-40.1	-179.8	-164.5	77.5	0	0	0	112	Q9 R10 W16 A17	Q9-H13 WeakPolarHBondContact O-CB 3.26Å; Q9-H13 PolarHBondContact O-N 3.28Å; R10-H13 PolarHBondContact O-N 2.96Å; H13-W16 PolarHBondContact O-N 3.49Å; H13-A17 PolarHBondContact O-N 3.45Å
14	Q	97.3	Very high	94.3	Very high	106 Å²	106	110.7 Å²	110.7	50%	0.495	53%	0.53	S	S	.	.	H	α-helix	trans	-65.7	-38.4	175.4	-172	60.8	60.1	0	0	112.3	R10 E11 I12 A17 N18	R10-Q14 WeakPolarHBondContact O-CB 3.5Å; R10-Q14 PolarHBondContact O-N 2.96Å; E11-Q14 PolarHBondContact O-N 2.92Å; I12-Q14 VanDerWaalsContact C-N 3.3Å; I12-Q14 PolarHBondContact O-N 3.35Å; Q14-A17 PolarHBondContact O-N 3.22Å; Q14-N18 PolarHBondContact NE2-OD1 2.97Å; Q14-N18 WeakPolarHBondContact O-CB 3.44Å; Q14-N18 PolarHBondContact O-N 2.94Å; Q14-N18 PolarHBondContact O-ND2 2.74Å; Q14-N18 PolarHBondContact O-OD1 2.82Å
15	D	98.1	Very high	95.7	Very high	66 Å²	66	105.6 Å²	105.6	35%	0.353	51%	0.508	S	S	.	.	H	α-helix	trans	-62.2	-42.7	174.9	-172.5	57.5	0	0	0	111.4	E11 I12 N18 R19	E11-D15 PolarHBondContact O-N 3.35Å; I12-D15 PolarHBondContact O-N 3.04Å; D15-N18 PolarHBondContact O-N 3.05Å; D15-R19 VanDerWaalsContact O-CG 3.32Å; D15-R19 WeakPolarHBondContact O-CG 3.49Å; D15-R19 PolarHBondContact O-N 3.47Å; D15-R19 IonicContact OD1-NE 3.84Å; D15-R19 IonicContact OD2-CZ 3.09Å; D15-R19 IonicContact OD2-NE 2.82Å; D15-R19 PolarHBondContact OD2-NE 3.4Å; D15-R19 IonicContact OD2-NH2 2.74Å; D15-R19 PolarHBondContact OD2-NH2 3.41Å
16	W	98.3	Very high	96.9	Very high	162 Å²	162	105.4 Å²	105.4	61%	0.614	51%	0.513	S	S	*	.	H	α-helix	trans	-60.5	-46.4	173.8	-76.6	106.7	0	0	0	112.4	I12 H13 N18 R19 E20	I12-W16 PolarHBondContact O-N 3.29Å; H13-W16 PolarHBondContact O-N 3.49Å; W16-N18 VanDerWaalsContact C-N 3.31Å; W16-N18 PolarHBondContact O-N 2.89Å; W16-R19 PolarHBondContact O-N 2.92Å; W16-E20 PolarHBondContact O-N 3.34Å
17	A	98.2	Very high	97.3	Very high	41 Å²	41	103.7 Å²	103.7	34%	0.339	51%	0.508	S	S	.	.	H	α-helix	trans	-60.9	-40.3	176.8	0	0	0	0	0	112	H13 Q14 Y21	H13-A17 PolarHBondContact O-N 3.45Å; Q14-A17 PolarHBondContact O-N 3.22Å; A17-Y21 WeakPolarHBondContact O-CB 3.32Å; A17-Y21 PolarHBondContact O-N 3.34Å
18	N	98.5	Very high	97.6	Very high	78 Å²	78	101.9 Å²	101.9	42%	0.417	50%	0.497	S	S	.	.	H	α-helix	trans	-65.6	-41.4	176	-68.2	-16.2	0	0	0	111.8	Q14 D15 W16 Y21 I22	Q14-N18 PolarHBondContact NE2-OD1 2.97Å; Q14-N18 WeakPolarHBondContact O-CB 3.44Å; Q14-N18 PolarHBondContact O-N 2.94Å; Q14-N18 PolarHBondContact O-ND2 2.74Å; Q14-N18 PolarHBondContact O-OD1 2.82Å; D15-N18 PolarHBondContact O-N 3.05Å; W16-N18 VanDerWaalsContact C-N 3.31Å; W16-N18 PolarHBondContact O-N 2.89Å; N18-Y21 PolarHBondContact O-N 3.34Å; N18-I22 VanDerWaalsContact O-CG1 3.31Å; N18-I22 WeakPolarHBondContact O-CG1 3.35Å; N18-I22 PolarHBondContact O-N 3.19Å
19	R	98.6	Very high	97.8	Very high	140 Å²	140	103 Å²	103	53%	0.528	50%	0.5	S	S	.	.	H	α-helix	trans	-64	-44.6	176.8	-73.5	178.9	-167.5	-160.6	5.7	112	D15 W16 Y21 I22 E23	D15-R19 VanDerWaalsContact O-CG 3.32Å; D15-R19 WeakPolarHBondContact O-CG 3.49Å; D15-R19 PolarHBondContact O-N 3.47Å; D15-R19 IonicContact OD1-NE 3.84Å; D15-R19 IonicContact OD2-CZ 3.09Å; D15-R19 IonicContact OD2-NE 2.82Å; D15-R19 PolarHBondContact OD2-NE 3.4Å; D15-R19 IonicContact OD2-NH2 2.74Å; D15-R19 PolarHBondContact OD2-NH2 3.41Å; W16-R19 PolarHBondContact O-N 2.92Å; R19-Y21 VanDerWaalsContact C-N 3.33Å; R19-Y21 PolarHBondContact O-N 2.94Å; R19-I22 PolarHBondContact O-N 3.18Å; R19-E23 WeakPolarHBondContact O-CB 3.47Å; R19-E23 PolarHBondContact O-N 2.87Å
20	E	98.5	Very high	98	Very high	133 Å²	133	104.7 Å²	104.7	62%	0.621	51%	0.505	S	S	*	.	H	α-helix	trans	-60	-44.5	175.9	-177.9	176.4	-151.3	0	0	110.9	W16 I22 E23 V24	W16-E20 PolarHBondContact O-N 3.34Å; E20-I22 PolarHBondContact O-N 3.43Å; E20-E23 PolarHBondContact O-N 3.41Å; E20-V24 WeakPolarHBondContact O-CG2 3.31Å; E20-V24 PolarHBondContact O-N 3.05Å
21	Y	98.5	Very high	98.2	Very high	159 Å²	159	105.3 Å²	105.3	62%	0.624	51%	0.512	S	S	*	.	H	α-helix	trans	-58.6	-47.3	175	-178.7	-99.6	0	0	0	112.1	A17 N18 R19 E23 V24 I25	A17-Y21 WeakPolarHBondContact O-CB 3.32Å; A17-Y21 PolarHBondContact O-N 3.34Å; N18-Y21 PolarHBondContact O-N 3.34Å; R19-Y21 VanDerWaalsContact C-N 3.33Å; R19-Y21 PolarHBondContact O-N 2.94Å; Y21-E23 VanDerWaalsContact C-N 3.3Å; Y21-E23 PolarHBondContact O-N 3.45Å; Y21-V24 PolarHBondContact O-N 2.99Å; Y21-I25 HydrophobicContact CD1-CG1 4.34Å; Y21-I25 HydrophobicContact CE1-CG1 3.97Å; Y21-I25 HydrophobicContact CE2-CD1 4.48Å; Y21-I25 HydrophobicContact CE2-CG1 4.4Å; Y21-I25 WeakPolarHBondContact O-CG1 3.36Å; Y21-I25 PolarHBondContact O-N 3.49Å
22	I	98.6	Very high	98.3	Very high	105 Å²	105	103.5 Å²	103.5	54%	0.538	51%	0.505	S	S	.	.	H	α-helix	trans	-61.2	-40	176.7	-69	166	0	0	0	111	N18 R19 E20 I25 T26	N18-I22 VanDerWaalsContact O-CG1 3.31Å; N18-I22 WeakPolarHBondContact O-CG1 3.35Å; N18-I22 PolarHBondContact O-N 3.19Å; R19-I22 PolarHBondContact O-N 3.18Å; E20-I22 PolarHBondContact O-N 3.43Å; I22-I25 PolarHBondContact O-N 2.87Å; I22-T26 VanDerWaalsContact O-CB 3.29Å; I22-T26 WeakPolarHBondContact O-CB 3.44Å; I22-T26 PolarHBondContact O-N 3.4Å; I22-T26 PolarHBondContact O-OG1 3Å
23	E	98.7	Very high	98.4	Very high	139 Å²	139	101.1 Å²	101.1	65%	0.65	50%	0.499	S	S	*	.	H	α-helix	trans	-63.8	-45.2	178.3	-175.5	176.6	-176.8	0	0	111.7	R19 E20 Y21 I25 T26 S27	R19-E23 WeakPolarHBondContact O-CB 3.47Å; R19-E23 PolarHBondContact O-N 2.87Å; E20-E23 PolarHBondContact O-N 3.41Å; Y21-E23 VanDerWaalsContact C-N 3.3Å; Y21-E23 PolarHBondContact O-N 3.45Å; E23-I25 VanDerWaalsContact C-N 3.35Å; E23-I25 PolarHBondContact O-N 3.25Å; E23-T26 PolarHBondContact O-N 3.4Å; E23-S27 WeakPolarHBondContact O-CB 3.35Å; E23-S27 PolarHBondContact O-N 3.29Å
24	V	98.6	Very high	98.6	Very high	83 Å²	83	99.1 Å²	99.1	50%	0.503	49%	0.493	S	S	.	.	H	α-helix	trans	-59.3	-45.8	175.9	170.7	0	0	0	0	111.1	E20 Y21 S27 S28	E20-V24 WeakPolarHBondContact O-CG2 3.31Å; E20-V24 PolarHBondContact O-N 3.05Å; Y21-V24 PolarHBondContact O-N 2.99Å; V24-S27 PolarHBondContact O-N 3.45Å; V24-S28 WeakPolarHBondContact O-CB 3.33Å; V24-S28 PolarHBondContact O-N 3.01Å; V24-S28 PolarHBondContact O-OG 3.36Å
25	I	98.6	Very high	98.6	Very high	70 Å²	70	99.8 Å²	99.8	36%	0.359	49%	0.494	S	S	.	.	H	α-helix	trans	-64.6	-46	177.3	-65.1	-61.6	0	0	0	110.8	Y21 I22 E23 S27 S28 I29	Y21-I25 HydrophobicContact CD1-CG1 4.34Å; Y21-I25 HydrophobicContact CE1-CG1 3.97Å; Y21-I25 HydrophobicContact CE2-CD1 4.48Å; Y21-I25 HydrophobicContact CE2-CG1 4.4Å; Y21-I25 WeakPolarHBondContact O-CG1 3.36Å; Y21-I25 PolarHBondContact O-N 3.49Å; I22-I25 PolarHBondContact O-N 2.87Å; E23-I25 VanDerWaalsContact C-N 3.35Å; E23-I25 PolarHBondContact O-N 3.25Å; I25-S27 VanDerWaalsContact C-N 3.33Å; I25-S27 PolarHBondContact O-N 3.38Å; I25-S28 WeakPolarHBondContact O-CB 3.38Å; I25-S28 PolarHBondContact O-N 3.44Å; I25-S28 VanDerWaalsContact O-N 3.12Å; I25-I29 HydrophobicContact CG2-CD1 3.82Å; I25-I29 HydrophobicContact CG2-CG1 4.39Å; I25-I29 WeakPolarHBondContact O-CG1 3.37Å; I25-I29 PolarHBondContact O-N 2.83Å
26	T	98.8	Very high	98.7	Very high	83 Å²	83	101.2 Å²	101.2	51%	0.509	50%	0.501	S	S	.	.	H	α-helix	trans	-58.3	-45.5	178.3	-59.2	0	0	0	0	111.4	I22 E23 S28 I29 K30	I22-T26 VanDerWaalsContact O-CB 3.29Å; I22-T26 WeakPolarHBondContact O-CB 3.44Å; I22-T26 PolarHBondContact O-N 3.4Å; I22-T26 PolarHBondContact O-OG1 3Å; E23-T26 PolarHBondContact O-N 3.4Å; T26-S28 VanDerWaalsContact C-N 3.33Å; T26-S28 PolarHBondContact O-N 3.46Å; T26-I29 PolarHBondContact O-N 2.71Å; T26-K30 PolarHBondContact O-N 2.8Å
27	S	98.8	Very high	98.7	Very high	52 Å²	52	98.5 Å²	98.5	36%	0.364	50%	0.499	S	S	.	.	H	α-helix	trans	-61.9	-40.5	175.9	-176.1	0	0	0	0	112	E23 V24 I25 K30 K31	E23-S27 WeakPolarHBondContact O-CB 3.35Å; E23-S27 PolarHBondContact O-N 3.29Å; V24-S27 PolarHBondContact O-N 3.45Å; I25-S27 VanDerWaalsContact C-N 3.33Å; I25-S27 PolarHBondContact O-N 3.38Å; S27-K30 PolarHBondContact O-N 2.88Å; S27-K31 WeakPolarHBondContact O-CG 3.44Å; S27-K31 PolarHBondContact O-N 3.01Å
28	S	98.7	Very high	98.7	Very high	51 Å²	51	99.9 Å²	99.9	36%	0.357	51%	0.506	S	S	.	.	H	α-helix	trans	-65.9	-43.9	177.6	-58.7	0	0	0	0	112	V24 I25 T26 K30 K31 I32	V24-S28 WeakPolarHBondContact O-CB 3.33Å; V24-S28 PolarHBondContact O-N 3.01Å; V24-S28 PolarHBondContact O-OG 3.36Å; I25-S28 WeakPolarHBondContact O-CB 3.38Å; I25-S28 PolarHBondContact O-N 3.44Å; I25-S28 VanDerWaalsContact O-N 3.12Å; T26-S28 VanDerWaalsContact C-N 3.33Å; T26-S28 PolarHBondContact O-N 3.46Å; S28-K30 VanDerWaalsContact C-N 3.32Å; S28-K30 PolarHBondContact O-N 3.12Å; S28-K31 PolarHBondContact O-N 3.28Å; S28-I32 WeakPolarHBondContact O-CG1 3.42Å; S28-I32 PolarHBondContact O-N 3Å
29	I	98.8	Very high	98.7	Very high	106 Å²	106	101.3 Å²	101.3	54%	0.544	51%	0.509	S	S	.	.	H	α-helix	trans	-60	-43.8	174.8	-68.7	168.1	0	0	0	110.4	I25 T26 K31 I32 A33	I25-I29 HydrophobicContact CG2-CD1 3.82Å; I25-I29 HydrophobicContact CG2-CG1 4.39Å; I25-I29 WeakPolarHBondContact O-CG1 3.37Å; I25-I29 PolarHBondContact O-N 2.83Å; T26-I29 PolarHBondContact O-N 2.71Å; I29-K31 PolarHBondContact O-N 2.87Å; I29-I32 PolarHBondContact O-N 2.96Å; I29-A33 PolarHBondContact O-N 3.24Å
30	K	98.8	Very high	98.7	Very high	139 Å²	139	97.9 Å²	97.9	60%	0.604	50%	0.501	S	S	*	.	H	α-helix	trans	-59.7	-46.6	176.8	-173.3	175.7	-179.2	177.9	0	111.9	T26 S27 S28 I32 A33 D34	T26-K30 PolarHBondContact O-N 2.8Å; S27-K30 PolarHBondContact O-N 2.88Å; S28-K30 VanDerWaalsContact C-N 3.32Å; S28-K30 PolarHBondContact O-N 3.12Å; K30-I32 VanDerWaalsContact C-N 3.31Å; K30-I32 PolarHBondContact O-N 3.5Å; K30-A33 PolarHBondContact O-N 2.9Å; K30-D34 VanDerWaalsContact O-CG 3.29Å; K30-D34 PolarHBondContact O-N 3.48Å
31	K	98.8	Very high	98.7	Very high	138 Å²	138	97.7 Å²	97.7	60%	0.6	50%	0.502	S	S	*	.	H	α-helix	trans	-59.9	-40	176.4	-71.3	171.5	-175.6	175.3	0	112.4	S27 S28 I29 D34 F35	S27-K31 WeakPolarHBondContact O-CG 3.44Å; S27-K31 PolarHBondContact O-N 3.01Å; S28-K31 PolarHBondContact O-N 3.28Å; I29-K31 PolarHBondContact O-N 2.87Å; K31-D34 PolarHBondContact O-N 3.3Å; K31-F35 WeakPolarHBondContact O-CB 3.13Å; K31-F35 PolarHBondContact O-N 3.5Å
32	I	98.9	Very high	98.7	Very high	101 Å²	101	93 Å²	93	52%	0.518	49%	0.492	S	S	.	.	H	α-helix	trans	-64.5	-45.1	176	-67.9	165.2	0	0	0	110.2	S28 I29 K30 D34 F35 L36	S28-I32 WeakPolarHBondContact O-CG1 3.42Å; S28-I32 PolarHBondContact O-N 3Å; I29-I32 PolarHBondContact O-N 2.96Å; K30-I32 VanDerWaalsContact C-N 3.31Å; K30-I32 PolarHBondContact O-N 3.5Å; I32-D34 PolarHBondContact O-N 3.18Å; I32-F35 PolarHBondContact O-N 2.93Å; I32-L36 HydrophobicContact CG2-CD1 3.93Å; I32-L36 HydrophobicContact CG2-CG 4.3Å; I32-L36 VanDerWaalsContact O-CG 3.3Å; I32-L36 WeakPolarHBondContact O-CG 3.29Å; I32-L36 PolarHBondContact O-N 3.38Å
33	A	98.9	Very high	98.8	Very high	41 Å²	41	89.8 Å²	89.8	34%	0.339	48%	0.479	S	S	.	.	H	α-helix	trans	-61.7	-44.4	177.5	0	0	0	0	0	112	I29 K30 F35 L36 N37	I29-A33 PolarHBondContact O-N 3.24Å; K30-A33 PolarHBondContact O-N 2.9Å; A33-F35 VanDerWaalsContact C-N 3.33Å; A33-F35 PolarHBondContact O-N 2.94Å; A33-L36 PolarHBondContact O-N 3.38Å; A33-N37 WeakPolarHBondContact O-CB 3.3Å; A33-N37 VanDerWaalsContact O-CG 3.29Å; A33-N37 PolarHBondContact O-N 3.25Å; A33-N37 PolarHBondContact O-ND2 3.46Å; A33-N37 VanDerWaalsContact O-ND2 3.15Å
34	D	98.8	Very high	98.8	Very high	88 Å²	88	90.9 Å²	90.9	47%	0.471	48%	0.477	S	S	.	.	H	α-helix	trans	-62	-40.8	176.6	-67.6	-22	0	0	0	111.6	K30 K31 I32 S38	K30-D34 VanDerWaalsContact O-CG 3.29Å; K30-D34 PolarHBondContact O-N 3.48Å; K31-D34 PolarHBondContact O-N 3.3Å; I32-D34 PolarHBondContact O-N 3.18Å; D34-S38 PolarHBondContact O-N 2.79Å; D34-S38 PolarHBondContact O-OG 3.05Å
35	F	98.8	Very high	98.8	Very high	120 Å²	120	90.6 Å²	90.6	53%	0.526	48%	0.478	S	S	.	.	H	α-helix	trans	-62.3	-48.6	172.8	171.4	-99.8	0	0	0	111.8	K31 I32 A33 N37 S38 F39	K31-F35 WeakPolarHBondContact O-CB 3.13Å; K31-F35 PolarHBondContact O-N 3.5Å; I32-F35 PolarHBondContact O-N 2.93Å; A33-F35 VanDerWaalsContact C-N 3.33Å; A33-F35 PolarHBondContact O-N 2.94Å; F35-N37 VanDerWaalsContact C-N 3.31Å; F35-N37 PolarHBondContact O-N 3.31Å; F35-S38 PolarHBondContact O-N 2.97Å; F35-S38 PolarHBondContact O-OG 3.15Å; F35-F39 HydrophobicContact CE1-CB 4.36Å; F35-F39 HydrophobicContact CE1-CG 4.5Å; F35-F39 HydrophobicContact CZ-CB 4.29Å; F35-F39 HydrophobicContact CZ-CD2 4.04Å; F35-F39 HydrophobicContact CZ-CG 4.33Å; F35-F39 WeakPolarHBondContact O-CB 3.29Å; F35-F39 PolarHBondContact O-N 2.89Å
36	L	98.9	Very high	98.8	Very high	96 Å²	96	95.5 Å²	95.5	50%	0.503	49%	0.492	S	S	.	.	H	α-helix	trans	-62.4	-39.1	-179	-70.7	173.9	0	0	0	112	I32 A33 F39 D40	I32-L36 HydrophobicContact CG2-CD1 3.93Å; I32-L36 HydrophobicContact CG2-CG 4.3Å; I32-L36 VanDerWaalsContact O-CG 3.3Å; I32-L36 WeakPolarHBondContact O-CG 3.29Å; I32-L36 PolarHBondContact O-N 3.38Å; A33-L36 PolarHBondContact O-N 3.38Å; L36-F39 PolarHBondContact O-N 3.02Å; L36-D40 WeakPolarHBondContact O-CB 3.48Å; L36-D40 PolarHBondContact O-N 2.95Å
37	N	98.7	Very high	98.8	Very high	105 Å²	105	97 Å²	97	56%	0.561	50%	0.497	S	S	*	.	H	α-helix	trans	-65.5	-47	176.4	-72.5	-33.2	0	0	0	112	A33 F35 F39 D40 M41	A33-N37 WeakPolarHBondContact O-CB 3.3Å; A33-N37 VanDerWaalsContact O-CG 3.29Å; A33-N37 PolarHBondContact O-N 3.25Å; A33-N37 PolarHBondContact O-ND2 3.46Å; A33-N37 VanDerWaalsContact O-ND2 3.15Å; F35-N37 VanDerWaalsContact C-N 3.31Å; F35-N37 PolarHBondContact O-N 3.31Å; N37-F39 VanDerWaalsContact C-N 3.33Å; N37-D40 PolarHBondContact O-N 3.45Å; N37-M41 WeakPolarHBondContact O-CG 3.43Å; N37-M41 PolarHBondContact O-N 3.32Å; N37-M41 VanDerWaalsContact O-N 3.15Å
38	S	98.8	Very high	98.8	Very high	70 Å²	70	96.8 Å²	96.8	49%	0.49	50%	0.498	S	S	.	.	H	α-helix	trans	-67	-35.1	177	57.8	0	0	0	0	112.4	D34 F35 S42	D34-S38 PolarHBondContact O-N 2.79Å; D34-S38 PolarHBondContact O-OG 3.05Å; F35-S38 PolarHBondContact O-N 2.97Å; F35-S38 PolarHBondContact O-OG 3.15Å; S38-S42 WeakPolarHBondContact O-CB 3.45Å; S38-S42 PolarHBondContact O-N 3.48Å
39	F	98.8	Very high	98.8	Very high	109 Å²	109	97.1 Å²	97.1	48%	0.478	50%	0.498	S	S	.	.	H	α-helix	trans	-66.1	-45.3	175.4	-177.8	-97.8	0	0	0	112.1	F35 L36 N37 M41 S42 C43	F35-F39 HydrophobicContact CE1-CB 4.36Å; F35-F39 HydrophobicContact CE1-CG 4.5Å; F35-F39 HydrophobicContact CZ-CB 4.29Å; F35-F39 HydrophobicContact CZ-CD2 4.04Å; F35-F39 HydrophobicContact CZ-CG 4.33Å; F35-F39 WeakPolarHBondContact O-CB 3.29Å; F35-F39 PolarHBondContact O-N 2.89Å; L36-F39 PolarHBondContact O-N 3.02Å; N37-F39 VanDerWaalsContact C-N 3.33Å; F39-M41 PolarHBondContact O-N 3.5Å; F39-S42 PolarHBondContact O-N 3.35Å; F39-C43 VanDerWaalsContact CE1-SG 3.59Å; F39-C43 VanDerWaalsContact CZ-SG 3.56Å; F39-C43 WeakPolarHBondContact O-CB 3.49Å; F39-C43 PolarHBondContact O-N 2.8Å; F39-C43 PolarHBondContact O-SG 3.21Å; F39-C43 VanDerWaalsContact O-SG 3.35Å
40	D	98.8	Very high	98.8	Very high	68 Å²	68	97.3 Å²	97.3	36%	0.364	50%	0.499	S	S	.	.	H	α-helix	trans	-57.7	-49.1	174.6	179.5	65.7	0	0	0	110.9	L36 N37 S42 C43 R44	L36-D40 WeakPolarHBondContact O-CB 3.48Å; L36-D40 PolarHBondContact O-N 2.95Å; N37-D40 PolarHBondContact O-N 3.45Å; D40-S42 VanDerWaalsContact C-N 3.35Å; D40-S42 PolarHBondContact O-N 3.23Å; D40-C43 PolarHBondContact O-N 3.45Å; D40-R44 WeakPolarHBondContact O-CB 3.49Å; D40-R44 WeakPolarHBondContact O-CG 3.38Å; D40-R44 PolarHBondContact O-N 3.44Å; D40-R44 IonicContact OD1-NE 3.45Å; D40-R44 PolarHBondContact OD1-NE 2.98Å; D40-R44 WeakPolarHBondContact OD2-CD 3.37Å; D40-R44 IonicContact OD2-CZ 3.69Å; D40-R44 IonicContact OD2-NE 2.8Å; D40-R44 PolarHBondContact OD2-NE 3.39Å; D40-R44 IonicContact OD2-NH2 3.75Å
41	M	98.6	Very high	98.8	Very high	129 Å²	129	95.4 Å²	95.4	64%	0.635	50%	0.496	S	S	*	.	H	α-helix	trans	-60.7	-42.4	178.4	-70.2	-61.5	-166.9	0	0	112.6	N37 F39 R44 S45	N37-M41 WeakPolarHBondContact O-CG 3.43Å; N37-M41 PolarHBondContact O-N 3.32Å; N37-M41 VanDerWaalsContact O-N 3.15Å; F39-M41 PolarHBondContact O-N 3.5Å; M41-R44 PolarHBondContact O-N 3.15Å; M41-S45 WeakPolarHBondContact O-CB 3.49Å; M41-S45 PolarHBondContact O-N 3.28Å
42	S	98.7	Very high	98.8	Very high	60 Å²	60	95.1 Å²	95.1	42%	0.42	50%	0.497	S	S	.	.	H	α-helix	trans	-62.5	-45.4	175.9	-175.9	0	0	0	0	111.9	S38 F39 D40 S45 R46	S38-S42 WeakPolarHBondContact O-CB 3.45Å; S38-S42 PolarHBondContact O-N 3.48Å; F39-S42 PolarHBondContact O-N 3.35Å; D40-S42 VanDerWaalsContact C-N 3.35Å; D40-S42 PolarHBondContact O-N 3.23Å; S42-S45 PolarHBondContact O-N 2.9Å; S42-R46 WeakPolarHBondContact O-CB 3.36Å; S42-R46 VanDerWaalsContact O-CG 3.29Å; S42-R46 WeakPolarHBondContact O-CG 3.4Å; S42-R46 PolarHBondContact O-N 2.85Å
43	C	98.8	Very high	98.8	Very high	38 Å²	38	96.5 Å²	96.5	26%	0.257	50%	0.499	S	S	.	.	H	α-helix	trans	-61.9	-47.3	176	-73.1	0	0	0	0	111.8	F39 D40 S45 R46 L47	F39-C43 VanDerWaalsContact CE1-SG 3.59Å; F39-C43 VanDerWaalsContact CZ-SG 3.56Å; F39-C43 WeakPolarHBondContact O-CB 3.49Å; F39-C43 PolarHBondContact O-N 2.8Å; F39-C43 PolarHBondContact O-SG 3.21Å; F39-C43 VanDerWaalsContact O-SG 3.35Å; D40-C43 PolarHBondContact O-N 3.45Å; C43-S45 PolarHBondContact O-N 3.28Å; C43-R46 PolarHBondContact O-N 2.99Å; C43-L47 WeakPolarHBondContact O-CB 3.36Å; C43-L47 VanDerWaalsContact O-CG 3.3Å; C43-L47 WeakPolarHBondContact O-CG 3.38Å; C43-L47 PolarHBondContact O-N 3.26Å
44	R	98.8	Very high	98.8	Very high	162 Å²	162	98.9 Å²	98.9	61%	0.611	51%	0.505	S	S	*	.	H	α-helix	trans	-56.8	-47.2	176.7	-75.1	178.6	-177	-103.3	-2.2	112	D40 M41 L47 A48	D40-R44 WeakPolarHBondContact O-CB 3.49Å; D40-R44 WeakPolarHBondContact O-CG 3.38Å; D40-R44 PolarHBondContact O-N 3.44Å; D40-R44 IonicContact OD1-NE 3.45Å; D40-R44 PolarHBondContact OD1-NE 2.98Å; D40-R44 WeakPolarHBondContact OD2-CD 3.37Å; D40-R44 IonicContact OD2-CZ 3.69Å; D40-R44 IonicContact OD2-NE 2.8Å; D40-R44 PolarHBondContact OD2-NE 3.39Å; D40-R44 IonicContact OD2-NH2 3.75Å; M41-R44 PolarHBondContact O-N 3.15Å; R44-L47 PolarHBondContact O-N 2.97Å; R44-A48 WeakPolarHBondContact O-CB 3.48Å; R44-A48 PolarHBondContact O-N 2.86Å
45	S	98.8	Very high	98.8	Very high	77 Å²	77	96.6 Å²	96.6	54%	0.538	50%	0.495	S	S	.	.	H	α-helix	trans	-61.2	-47	178.1	176.2	0	0	0	0	111.8	M41 S42 C43 L47 A48 T49	M41-S45 WeakPolarHBondContact O-CB 3.49Å; M41-S45 PolarHBondContact O-N 3.28Å; S42-S45 PolarHBondContact O-N 2.9Å; C43-S45 PolarHBondContact O-N 3.28Å; S45-L47 PolarHBondContact O-N 3.49Å; S45-A48 WeakPolarHBondContact O-CB 3.46Å; S45-A48 PolarHBondContact O-N 3.02Å; S45-T49 PolarHBondContact O-N 3.43Å; S45-T49 PolarHBondContact O-OG1 3.39Å
46	R	98.8	Very high	98.8	Very high	173 Å²	173	93.3 Å²	93.3	65%	0.653	49%	0.49	S	S	*	.	H	α-helix	trans	-64.7	-41	179.1	-70.2	172.7	66.4	-178.6	1.2	112.5	S42 C43 T49 L50	S42-R46 WeakPolarHBondContact O-CB 3.36Å; S42-R46 VanDerWaalsContact O-CG 3.29Å; S42-R46 WeakPolarHBondContact O-CG 3.4Å; S42-R46 PolarHBondContact O-N 2.85Å; C43-R46 PolarHBondContact O-N 2.99Å; R46-T49 PolarHBondContact O-N 3.45Å; R46-L50 WeakPolarHBondContact O-CG 3.46Å; R46-L50 PolarHBondContact O-N 2.91Å
47	L	98.9	Very high	98.8	Very high	115 Å²	115	93.4 Å²	93.4	60%	0.602	49%	0.49	S	S	*	.	H	α-helix	trans	-64.8	-40.4	175.7	-73.4	173	0	0	0	111.4	C43 R44 S45 L50 N51	C43-L47 WeakPolarHBondContact O-CB 3.36Å; C43-L47 VanDerWaalsContact O-CG 3.3Å; C43-L47 WeakPolarHBondContact O-CG 3.38Å; C43-L47 PolarHBondContact O-N 3.26Å; R44-L47 PolarHBondContact O-N 2.97Å; S45-L47 PolarHBondContact O-N 3.49Å; L47-L50 PolarHBondContact O-N 3.43Å; L47-N51 WeakPolarHBondContact O-CB 3.3Å; L47-N51 PolarHBondContact O-N 3.41Å
48	A	98.8	Very high	98.8	Very high	47 Å²	47	92.7 Å²	92.7	39%	0.388	48%	0.483	S	S	.	.	H	α-helix	trans	-60	-46.3	174.2	0	0	0	0	0	111.5	R44 S45 L50 N51 E52	R44-A48 WeakPolarHBondContact O-CB 3.48Å; R44-A48 PolarHBondContact O-N 2.86Å; S45-A48 WeakPolarHBondContact O-CB 3.46Å; S45-A48 PolarHBondContact O-N 3.02Å; A48-L50 VanDerWaalsContact C-N 3.34Å; A48-L50 PolarHBondContact O-N 2.86Å; A48-N51 WeakPolarHBondContact O-CB 3.39Å; A48-N51 PolarHBondContact O-N 3.24Å; A48-E52 WeakPolarHBondContact O-CG 3.36Å; A48-E52 PolarHBondContact O-N 3Å
49	T	98.8	Very high	98.8	Very high	58 Å²	58	97.4 Å²	97.4	36%	0.356	49%	0.49	S	S	.	.	H	α-helix	trans	-61.5	-40.1	175.3	-57.9	0	0	0	0	112.7	S45 R46 K53	S45-T49 PolarHBondContact O-N 3.43Å; S45-T49 PolarHBondContact O-OG1 3.39Å; R46-T49 PolarHBondContact O-N 3.45Å; T49-K53 HydrophobicContact CG2-CD 4.46Å; T49-K53 WeakPolarHBondContact O-CG 3.45Å; T49-K53 PolarHBondContact O-N 3.3Å; T49-K53 VanDerWaalsContact O-N 3.1Å
50	L	98.9	Very high	98.7	Very high	109 Å²	109	100.2 Å²	100.2	57%	0.571	50%	0.498	S	S	*	.	H	α-helix	trans	-65.3	-41.3	175.8	-74	173.7	0	0	0	111.4	R46 L47 A48 K53 L54	R46-L50 WeakPolarHBondContact O-CG 3.46Å; R46-L50 PolarHBondContact O-N 2.91Å; L47-L50 PolarHBondContact O-N 3.43Å; A48-L50 VanDerWaalsContact C-N 3.34Å; A48-L50 PolarHBondContact O-N 2.86Å; L50-K53 PolarHBondContact O-N 3.1Å; L50-L54 WeakPolarHBondContact O-CB 3.36Å; L50-L54 PolarHBondContact O-N 3.2Å
51	N	98.8	Very high	98.7	Very high	100 Å²	100	101.3 Å²	101.3	54%	0.535	50%	0.503	S	S	.	.	H	α-helix	trans	-62	-44.7	176.6	-171.6	77.1	0	0	0	111.7	L47 A48 K53 L54 T55	L47-N51 WeakPolarHBondContact O-CB 3.3Å; L47-N51 PolarHBondContact O-N 3.41Å; A48-N51 WeakPolarHBondContact O-CB 3.39Å; A48-N51 PolarHBondContact O-N 3.24Å; N51-K53 VanDerWaalsContact C-N 3.34Å; N51-K53 PolarHBondContact O-N 2.92Å; N51-L54 PolarHBondContact O-N 3.24Å; N51-T55 PolarHBondContact O-N 2.9Å; N51-T55 PolarHBondContact O-OG1 3.38Å
52	E	98.9	Very high	98.7	Very high	131 Å²	131	100.9 Å²	100.9	61%	0.612	50%	0.499	S	S	*	.	H	α-helix	trans	-59	-43.9	174.9	-73.2	170.2	-175.1	0	0	112.3	A48 T55 A56	A48-E52 WeakPolarHBondContact O-CG 3.36Å; A48-E52 PolarHBondContact O-N 3Å; E52-T55 PolarHBondContact O-N 3.42Å; E52-A56 WeakPolarHBondContact O-CB 3.33Å; E52-A56 PolarHBondContact O-N 3.28Å
53	K	98.8	Very high	98.6	Very high	131 Å²	131	104.8 Å²	104.8	57%	0.57	51%	0.506	S	S	*	.	H	α-helix	trans	-64.2	-41.6	176.5	-73.5	176.3	-179.7	-179	0	111.9	T49 L50 N51 A56 L57	T49-K53 HydrophobicContact CG2-CD 4.46Å; T49-K53 WeakPolarHBondContact O-CG 3.45Å; T49-K53 PolarHBondContact O-N 3.3Å; T49-K53 VanDerWaalsContact O-N 3.1Å; L50-K53 PolarHBondContact O-N 3.1Å; N51-K53 VanDerWaalsContact C-N 3.34Å; N51-K53 PolarHBondContact O-N 2.92Å; K53-A56 PolarHBondContact O-N 3.15Å; K53-L57 WeakPolarHBondContact O-CG 3.4Å; K53-L57 PolarHBondContact O-N 2.91Å
54	L	98.9	Very high	98.4	Very high	90 Å²	90	107.4 Å²	107.4	47%	0.471	52%	0.516	S	S	.	.	H	α-helix	trans	-61.4	-51.3	176.6	-179.5	61.8	0	0	0	110.5	L50 N51 A56 L57 E58	L50-L54 WeakPolarHBondContact O-CB 3.36Å; L50-L54 PolarHBondContact O-N 3.2Å; N51-L54 PolarHBondContact O-N 3.24Å; L54-A56 VanDerWaalsContact C-N 3.28Å; L54-A56 PolarHBondContact O-N 3.48Å; L54-L57 WeakPolarHBondContact O-CA 3.4Å; L54-L57 WeakPolarHBondContact O-CB 3.48Å; L54-L57 PolarHBondContact O-N 3.1Å; L54-E58 HydrophobicContact CD1-CG 4.42Å; L54-E58 HydrophobicContact CG-CG 4.46Å; L54-E58 WeakPolarHBondContact O-CG 3.37Å; L54-E58 PolarHBondContact O-N 3.43Å
55	T	98.7	Very high	98.3	Very high	40 Å²	40	105.3 Å²	105.3	25%	0.245	51%	0.513	C	S	.	.	H	α-helix	trans	-59.2	-37.5	176.8	-59.5	0	0	0	0	112.7	N51 E52 E58 R59	N51-T55 PolarHBondContact O-N 2.9Å; N51-T55 PolarHBondContact O-OG1 3.38Å; E52-T55 PolarHBondContact O-N 3.42Å; T55-E58 WeakPolarHBondContact CA-OE2 3.38Å; T55-R59 WeakPolarHBondContact O-CG 3.46Å; T55-R59 PolarHBondContact O-N 2.94Å; T55-R59 VanDerWaalsContact O-N 3.13Å
56	A	98.8	Very high	98.2	Very high	51 Å²	51	103.8 Å²	103.8	42%	0.421	51%	0.506	S	S	.	.	H	α-helix	trans	-66	-38.2	174.9	0	0	0	0	0	112.3	E52 K53 L54 R60	E52-A56 WeakPolarHBondContact O-CB 3.33Å; E52-A56 PolarHBondContact O-N 3.28Å; K53-A56 PolarHBondContact O-N 3.15Å; L54-A56 VanDerWaalsContact C-N 3.28Å; L54-A56 PolarHBondContact O-N 3.48Å; A56-R60 WeakPolarHBondContact O-CG 3.36Å; A56-R60 PolarHBondContact O-N 2.94Å
57	L	98.8	Very high	98	Very high	98 Å²	98	99.7 Å²	99.7	51%	0.513	49%	0.49	S	S	.	.	H	α-helix	trans	-69.2	-44.1	175.9	-72.9	171.3	0	0	0	111.8	K53 L54 R59 R60 I61	K53-L57 WeakPolarHBondContact O-CG 3.4Å; K53-L57 PolarHBondContact O-N 2.91Å; L54-L57 WeakPolarHBondContact O-CA 3.4Å; L54-L57 WeakPolarHBondContact O-CB 3.48Å; L54-L57 PolarHBondContact O-N 3.1Å; L57-R59 PolarHBondContact O-N 2.86Å; L57-R60 PolarHBondContact O-N 3.11Å; L57-R60 VanDerWaalsContact O-N 3.11Å; L57-I61 WeakPolarHBondContact O-CG1 3.25Å; L57-I61 PolarHBondContact O-N 3.05Å
58	E	98.7	Very high	97.8	Very high	90 Å²	90	98.1 Å²	98.1	42%	0.421	49%	0.485	S	S	.	.	H	α-helix	trans	-54.2	-50.5	175.8	-71.8	169.2	155.8	0	0	110.9	L54 T55 R60 I61 E62	L54-E58 HydrophobicContact CD1-CG 4.42Å; L54-E58 HydrophobicContact CG-CG 4.46Å; L54-E58 WeakPolarHBondContact O-CG 3.37Å; L54-E58 PolarHBondContact O-N 3.43Å; T55-E58 WeakPolarHBondContact CA-OE2 3.38Å; E58-R60 VanDerWaalsContact C-N 3.3Å; E58-R60 PolarHBondContact O-N 3.13Å; E58-I61 WeakPolarHBondContact O-CB 3.41Å; E58-I61 PolarHBondContact O-N 2.98Å; E58-I61 VanDerWaalsContact O-N 3.1Å; E58-E62 WeakPolarHBondContact O-CG 3.49Å; E58-E62 PolarHBondContact O-N 3.01Å
59	R	98.5	Very high	97.6	Very high	169 Å²	169	101.7 Å²	101.7	64%	0.638	50%	0.502	S	S	*	.	H	α-helix	trans	-60.6	-36.3	177	-70.9	176	-175.8	170.1	3.3	113.6	T55 L57 Y63	T55-R59 WeakPolarHBondContact O-CG 3.46Å; T55-R59 PolarHBondContact O-N 2.94Å; T55-R59 VanDerWaalsContact O-N 3.13Å; L57-R59 PolarHBondContact O-N 2.86Å; R59-Y63 WeakPolarHBondContact O-CB 3.43Å; R59-Y63 PolarHBondContact O-N 3.23Å; R59-Y63 VanDerWaalsContact O-N 3.07Å
60	R	98.2	Very high	97.3	Very high	169 Å²	169	106 Å²	106	64%	0.638	52%	0.516	S	S	*	.	H	α-helix	trans	-69	-38.2	176.9	-74.6	178.3	72.1	177.3	3.1	111.2	A56 L57 E58 I64	A56-R60 WeakPolarHBondContact O-CG 3.36Å; A56-R60 PolarHBondContact O-N 2.94Å; L57-R60 PolarHBondContact O-N 3.11Å; L57-R60 VanDerWaalsContact O-N 3.11Å; E58-R60 VanDerWaalsContact C-N 3.3Å; E58-R60 PolarHBondContact O-N 3.13Å; R60-I64 WeakPolarHBondContact O-CD1 3.4Å; R60-I64 VanDerWaalsContact O-CG1 3.25Å; R60-I64 WeakPolarHBondContact O-CG1 3.32Å; R60-I64 PolarHBondContact O-N 3.16Å
61	I	98	Very high	96.9	Very high	91 Å²	91	103 Å²	103	47%	0.467	51%	0.511	S	S	.	.	H	α-helix	trans	-63.4	-51.9	175	-70	167.8	0	0	0	109.5	L57 E58 Y63 I64 E65	L57-I61 WeakPolarHBondContact O-CG1 3.25Å; L57-I61 PolarHBondContact O-N 3.05Å; E58-I61 WeakPolarHBondContact O-CB 3.41Å; E58-I61 PolarHBondContact O-N 2.98Å; E58-I61 VanDerWaalsContact O-N 3.1Å; I61-Y63 VanDerWaalsContact C-N 3.26Å; I61-Y63 PolarHBondContact O-N 3.29Å; I61-I64 PolarHBondContact O-N 3.39Å; I61-E65 HydrophobicContact CG2-CG 4.1Å; I61-E65 WeakPolarHBondContact O-CG 3.39Å; I61-E65 PolarHBondContact O-N 3.15Å
62	E	98	Very high	96.3	Very high	120 Å²	120	103 Å²	103	56%	0.561	51%	0.508	S	S	*	.	H	α-helix	trans	-53.2	-44.2	177.5	-71.2	170.6	-175.1	0	0	112.1	E58 E65 A66	E58-E62 WeakPolarHBondContact O-CG 3.49Å; E58-E62 PolarHBondContact O-N 3.01Å; E62-E65 PolarHBondContact O-N 2.99Å; E62-A66 WeakPolarHBondContact O-CB 3.45Å; E62-A66 PolarHBondContact O-N 3.07Å
63	Y	96.7	Very high	95.1	Very high	142 Å²	142	99.4 Å²	99.4	56%	0.557	50%	0.495	S	S	*	.	H	α-helix	trans	-62.3	-44	176.1	173.9	-101.5	0	0	0	112.6	R59 I61 A66 R67	R59-Y63 WeakPolarHBondContact O-CB 3.43Å; R59-Y63 PolarHBondContact O-N 3.23Å; R59-Y63 VanDerWaalsContact O-N 3.07Å; I61-Y63 VanDerWaalsContact C-N 3.26Å; I61-Y63 PolarHBondContact O-N 3.29Å; Y63-A66 PolarHBondContact O-N 2.92Å; Y63-R67 VanDerWaalsContact CE1-CD 3.43Å; Y63-R67 HydrophobicContact CE1-CG 4.27Å; Y63-R67 HydrophobicContact CE2-CG 4.28Å; Y63-R67 WeakPolarHBondContact O-CG 3.32Å; Y63-R67 PolarHBondContact O-N 2.89Å; Y63-R67 WeakPolarHBondContact OH-CD 3.45Å
64	I	95.8	Very high	93.7	Very high	93 Å²	93	100.7 Å²	100.7	48%	0.477	51%	0.507	S	S	.	.	H	α-helix	trans	-65.7	-45.8	178.3	-69.9	166	0	0	0	110.2	R60 I61 A66 R67 V68	R60-I64 WeakPolarHBondContact O-CD1 3.4Å; R60-I64 VanDerWaalsContact O-CG1 3.25Å; R60-I64 WeakPolarHBondContact O-CG1 3.32Å; R60-I64 PolarHBondContact O-N 3.16Å; I61-I64 PolarHBondContact O-N 3.39Å; I64-A66 VanDerWaalsContact C-N 3.3Å; I64-A66 PolarHBondContact O-N 3.48Å; I64-R67 PolarHBondContact O-N 2.82Å; I64-R67 VanDerWaalsContact O-N 3.16Å; I64-V68 HydrophobicContact CG2-CG2 4.24Å; I64-V68 VanDerWaalsContact O-CG2 3.32Å; I64-V68 WeakPolarHBondContact O-CG2 3.35Å; I64-V68 PolarHBondContact O-N 2.94Å
65	E	96	Very high	91.9	Very high	117 Å²	117	106.2 Å²	106.2	55%	0.547	55%	0.545	S	S	.	.	H	α-helix	trans	-57.8	-43.5	176.8	-71.5	177.9	152.7	0	0	111.4	I61 E62 V68 T69	I61-E65 HydrophobicContact CG2-CG 4.1Å; I61-E65 WeakPolarHBondContact O-CG 3.39Å; I61-E65 PolarHBondContact O-N 3.15Å; E62-E65 PolarHBondContact O-N 2.99Å; E65-V68 PolarHBondContact O-N 3.46Å; E65-T69 WeakPolarHBondContact O-CB 3.35Å; E65-T69 PolarHBondContact O-N 3.4Å; E65-T69 PolarHBondContact O-OG1 3.05Å
66	A	95.7	Very high	91.6	Very high	46 Å²	46	109.6 Å²	109.6	38%	0.38	56%	0.56	S	S	.	*	H	α-helix	trans	-62.3	-43.1	175.9	0	0	0	0	0	112.2	E62 Y63 I64 T69 K70	E62-A66 WeakPolarHBondContact O-CB 3.45Å; E62-A66 PolarHBondContact O-N 3.07Å; Y63-A66 PolarHBondContact O-N 2.92Å; I64-A66 VanDerWaalsContact C-N 3.3Å; I64-A66 PolarHBondContact O-N 3.48Å; A66-T69 PolarHBondContact O-N 3Å; A66-K70 VanDerWaalsContact O-CG 3.32Å; A66-K70 WeakPolarHBondContact O-CG 3.43Å; A66-K70 PolarHBondContact O-N 3Å
67	R	94.8	Very high	91.2	Very high	87 Å²	87	112.6 Å²	112.6	33%	0.328	57%	0.568	S	S	.	*	H	α-helix	trans	-66.5	-41.9	177.7	-75.4	-169	60.6	-161.4	-5	112.9	Y63 I64 T69 K70 G71 E72 T73	Y63-R67 VanDerWaalsContact CE1-CD 3.43Å; Y63-R67 HydrophobicContact CE1-CG 4.27Å; Y63-R67 HydrophobicContact CE2-CG 4.28Å; Y63-R67 WeakPolarHBondContact O-CG 3.32Å; Y63-R67 PolarHBondContact O-N 2.89Å; Y63-R67 WeakPolarHBondContact OH-CD 3.45Å; I64-R67 PolarHBondContact O-N 2.82Å; I64-R67 VanDerWaalsContact O-N 3.16Å; R67-T69 VanDerWaalsContact C-N 3.35Å; R67-K70 PolarHBondContact O-N 3.2Å; R67-G71 PolarHBondContact O-N 3.33Å; R67-E72 HydrophobicContact CB-CB 4.47Å; R67-E72 PolarHBondContact NH2-O 3.44Å; R67-E72 PolarHBondContact O-N 3.45Å; R67-T73 HydrophobicContact CB-CG2 3.8Å
68	V	95.4	Very high	90.8	Very high	81 Å²	81	113.4 Å²	113.4	49%	0.491	57%	0.571	S	S	.	*	H	α-helix	trans	-63	-44.5	176.1	171.8	0	0	0	0	110	I64 E65 K70 G71 T73	I64-V68 HydrophobicContact CG2-CG2 4.24Å; I64-V68 VanDerWaalsContact O-CG2 3.32Å; I64-V68 WeakPolarHBondContact O-CG2 3.35Å; I64-V68 PolarHBondContact O-N 2.94Å; E65-V68 PolarHBondContact O-N 3.46Å; V68-K70 VanDerWaalsContact C-N 3.27Å; V68-K70 PolarHBondContact O-N 3.49Å; V68-G71 PolarHBondContact O-N 3.31Å; V68-T73 HydrophobicContact CG2-CG2 3.98Å
69	T	94.4	Very high	90.3	Very high	123 Å²	123	114.8 Å²	114.8	76%	0.755	58%	0.58	S	S	*	*	H	α-helix	trans	-61.3	-35	177.3	-57.1	0	0	0	0	112.4	E65 A66 R67 G71	E65-T69 WeakPolarHBondContact O-CB 3.35Å; E65-T69 PolarHBondContact O-N 3.4Å; E65-T69 PolarHBondContact O-OG1 3.05Å; A66-T69 PolarHBondContact O-N 3Å; R67-T69 VanDerWaalsContact C-N 3.35Å; T69-G71 VanDerWaalsContact C-N 3.29Å; T69-G71 PolarHBondContact O-N 3.06Å
70	K	93.2	Very high	89.8	Confident	148 Å²	148	111.4 Å²	111.4	64%	0.643	58%	0.576	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.2	-6	175.3	-69.3	177.7	-177.4	-178.7	0	114.3	A66 R67 V68 E72	A66-K70 VanDerWaalsContact O-CG 3.32Å; A66-K70 WeakPolarHBondContact O-CG 3.43Å; A66-K70 PolarHBondContact O-N 3Å; R67-K70 PolarHBondContact O-N 3.2Å; V68-K70 VanDerWaalsContact C-N 3.27Å; V68-K70 PolarHBondContact O-N 3.49Å; K70-E72 HydrophobicContact CB-CG 3.77Å; K70-E72 VanDerWaalsContact CD-OE1 3.32Å; K70-E72 WeakPolarHBondContact CD-OE1 3.32Å; K70-E72 PolarHBondContact O-N 2.91Å
71	G	89	Confident	89.2	Confident	45 Å²	45	107.6 Å²	107.6	46%	0.464	57%	0.572	S	S	.	*	T	Hydrogen-bonded Turn	trans	72.6	11.9	-174.7	0	0	0	0	0	114.4	R67 V68 T69 T73	R67-G71 PolarHBondContact O-N 3.33Å; V68-G71 PolarHBondContact O-N 3.31Å; T69-G71 VanDerWaalsContact C-N 3.29Å; T69-G71 PolarHBondContact O-N 3.06Å; G71-T73 PolarHBondContact O-N 2.75Å; G71-T73 VanDerWaalsContact O-N 3.15Å
72	E	86.8	Confident	88.6	Confident	100 Å²	100	108.8 Å²	108.8	47%	0.467	58%	0.579	S	S	.	*	T	Hydrogen-bonded Turn	trans	-77.3	6.3	-176.3	-64.6	171.8	169.6	0	0	113.6	R67 K70	R67-E72 HydrophobicContact CB-CB 4.47Å; R67-E72 PolarHBondContact NH2-O 3.44Å; R67-E72 PolarHBondContact O-N 3.45Å; K70-E72 HydrophobicContact CB-CG 3.77Å; K70-E72 VanDerWaalsContact CD-OE1 3.32Å; K70-E72 WeakPolarHBondContact CD-OE1 3.32Å; K70-E72 PolarHBondContact O-N 2.91Å
73	T	74.9	Confident	87.9	Confident	57 Å²	57	107.9 Å²	107.9	35%	0.35	58%	0.581	S	S	.	*	T	Hydrogen-bonded Turn	trans	-113.8	-10	-177	57	0	0	0	0	114.1	R67 V68 G71	R67-T73 HydrophobicContact CB-CG2 3.8Å; V68-T73 HydrophobicContact CG2-CG2 3.98Å; G71-T73 PolarHBondContact O-N 2.75Å; G71-T73 VanDerWaalsContact O-N 3.15Å
74	L	69	Low	87.2	Confident	157 Å²	157	105.1 Å²	105.1	82%	0.822	58%	0.583	S	S	*	*			trans	-105.7	78.2	178.7	-65.6	171	0	0	0	109.5
75	T	61.1	Low	86.4	Confident	207 Å²	207	106.2 Å²	106.2	100%	1.27	59%	0.592	S	S	*	*			trans	-109.3	0	158.5	55	0	0	0	0	108.9

Retrieved 75 of 75 residues in 624.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).