A0A060WJD6_ONCMY Loading...

U6 snRNA-associated Sm-like protein LSm5

Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA. Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.

AlphaFold DB (A0A4W5M0U8), UniProt , Accession A0A060WJD6, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene LSM5, Length 91 aa.

						>A0A060WJD6_ONCMY|A0A060WJD6|LSM5
MAATPATNPSQLLPLELVDKCIGSRIHIVMKNDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLIPGGEGPEV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50	Low	60.9	Low	244 Å²	244	122.5 Å²	122.5	100%	1.202	78%	0.776	S	S	*	*				0	95.4	0	-61.4	-58	-147.4	0	0	107.6
2	A	45.5	Very low	62.7	Low	105 Å²	105	118.8 Å²	118.8	87%	0.868	75%	0.746	S	S	*	*	P	Polyproline II helix	trans	-80.7	128.2	175.8	0	0	0	0	0	108.3	T4	A2-T4 PolarHBondContact O-N 2.9Å
3	A	52.2	Low	64.9	Low	96 Å²	96	117 Å²	117	79%	0.793	73%	0.727	S	S	*	*	P	Polyproline II helix	trans	-63.9	126.2	177	0	0	0	0	0	109.4	P5	A3-P5 WeakPolarHBondContact O-CD 3.28Å
4	T	58.6	Low	66.8	Low	135 Å²	135	115.9 Å²	115.9	83%	0.828	72%	0.722	S	S	*	*	P	Polyproline II helix	trans	-62.2	120.1	166.7	15.3	0	0	0	0	107.9	A2 A6	A2-T4 PolarHBondContact O-N 2.9Å; T4-A6 PolarHBondContact O-N 2.93Å
5	P	60.7	Low	68.5	Low	113 Å²	113	114.1 Å²	114.1	73%	0.734	71%	0.705	S	S	*	*	P	Polyproline II helix	trans	-62.4	128.2	175.7	24.6	-30.5	0	0	0	108.3	A3 T7	A3-P5 WeakPolarHBondContact O-CD 3.28Å; P5-T7 PolarHBondContact O-N 3.06Å
6	A	59.2	Low	70	Confident	102 Å²	102	111.8 Å²	111.8	84%	0.843	68%	0.683	S	S	*	*			trans	-63.3	107.1	172.1	0	0	0	0	0	108.1	T4 N8	T4-A6 PolarHBondContact O-N 2.93Å; A6-N8 PolarHBondContact O-N 3.39Å
7	T	60.5	Low	71.3	Confident	105 Å²	105	109.5 Å²	109.5	64%	0.644	67%	0.666	S	S	*	*			trans	-60.9	123.3	172.4	8.9	0	0	0	0	108.1	P5	P5-T7 PolarHBondContact O-N 3.06Å
8	N	70.1	Confident	72.6	Confident	92 Å²	92	104.2 Å²	104.2	49%	0.492	63%	0.633	S	S	.	*			trans	-58.7	126.7	174	-169.7	-14.2	0	0	0	107.4	A6 S10 Q11	A6-N8 PolarHBondContact O-N 3.39Å; N8-S10 PolarHBondContact ND2-OG 3.08Å; N8-S10 PolarHBondContact O-N 3.27Å; N8-S10 PolarHBondContact OD1-OG 3.13Å; N8-Q11 HydrophobicContact CB-CB 4.27Å; N8-Q11 WeakPolarHBondContact O-CB 3.31Å; N8-Q11 PolarHBondContact O-N 3.07Å
9	P	63.2	Low	73.8	Confident	139 Å²	139	103.6 Å²	103.6	90%	0.903	63%	0.626	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.6	-10.6	-178.4	22	-34.3	0	0	0	114
10	S	73.1	Confident	74.9	Confident	95 Å²	95	104.5 Å²	104.5	66%	0.664	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.8	-3.1	171.4	57.9	0	0	0	0	114.8	N8 L12	N8-S10 PolarHBondContact ND2-OG 3.08Å; N8-S10 PolarHBondContact O-N 3.27Å; N8-S10 PolarHBondContact OD1-OG 3.13Å; S10-L12 PolarHBondContact O-N 2.91Å
11	Q	76.9	Confident	75.8	Confident	121 Å²	121	99.9 Å²	99.9	57%	0.565	59%	0.594	S	S	*	*			trans	-98.2	92.8	-175.9	-161.8	175.7	-4.4	0	0	110.2	N8	N8-Q11 HydrophobicContact CB-CB 4.27Å; N8-Q11 WeakPolarHBondContact O-CB 3.31Å; N8-Q11 PolarHBondContact O-N 3.07Å
12	L	82.9	Confident	78	Confident	79 Å²	79	91.6 Å²	91.6	41%	0.414	55%	0.554	S	S	.	*			trans	-80.6	124.8	175.2	-174.8	66	0	0	0	110.1	S10 E16 L17 K20	S10-L12 PolarHBondContact O-N 2.91Å; L12-E16 HydrophobicContact CD1-CB 4.13Å; L12-E16 VanDerWaalsContact CD1-CD 3.5Å; L12-E16 HydrophobicContact CD1-CG 3.95Å; L12-E16 WeakPolarHBondContact CD1-OE1 3.33Å; L12-L17 HydrophobicContact CD2-CB 3.76Å; L12-L17 HydrophobicContact CD2-CD1 3.79Å; L12-L17 HydrophobicContact CD2-CD2 4.42Å; L12-L17 HydrophobicContact CD2-CG 4.18Å; L12-L17 HydrophobicContact CG-CB 4.13Å; L12-K20 HydrophobicContact CD1-CD 4.4Å; L12-K20 VanDerWaalsContact CD1-NZ 3.32Å
13	L	90.8	Very high	80.5	Confident	95 Å²	95	89.1 Å²	89.1	50%	0.497	54%	0.539	S	S	.	.			trans	-76.1	144.4	174	-64.4	177.3	0	0	0	110.4	L15 E16 L17	L13-L15 VanDerWaalsContact C-N 3.31Å; L13-L15 PolarHBondContact O-N 2.87Å; L13-E16 HydrophobicContact CB-CB 3.99Å; L13-E16 WeakPolarHBondContact O-CA 3.21Å; L13-E16 WeakPolarHBondContact O-CB 3.46Å; L13-E16 PolarHBondContact O-N 2.8Å; L13-L17 PolarHBondContact O-N 2.76Å
14	P	91.1	Very high	82.6	Confident	101 Å²	101	87.4 Å²	87.4	66%	0.656	52%	0.521	S	S	*	.	H	α-helix	trans	-55.3	-44	179.9	-28.6	35.6	0	0	0	113.4	E16 L17 V18	P14-E16 VanDerWaalsContact C-N 3.32Å; P14-E16 PolarHBondContact O-N 3.29Å; P14-L17 WeakPolarHBondContact O-CB 3.47Å; P14-L17 PolarHBondContact O-N 2.76Å; P14-V18 WeakPolarHBondContact O-CG2 3.46Å; P14-V18 PolarHBondContact O-N 2.95Å; P14-V18 VanDerWaalsContact O-N 3.13Å
15	L	92.9	Very high	84.4	Confident	89 Å²	89	86.3 Å²	86.3	47%	0.466	50%	0.502	S	S	.	.	H	α-helix	trans	-69.7	-30.2	177.7	-61.4	-178.9	0	0	0	112.6	L13 L17 V18 D19 F43 V47	L13-L15 VanDerWaalsContact C-N 3.31Å; L13-L15 PolarHBondContact O-N 2.87Å; L15-L17 VanDerWaalsContact C-N 3.32Å; L15-V18 PolarHBondContact O-N 2.84Å; L15-D19 WeakPolarHBondContact O-CB 3.48Å; L15-D19 PolarHBondContact O-N 2.86Å; L15-F43 HydrophobicContact CD2-CE2 4.12Å; L15-V47 HydrophobicContact CD2-CG2 4.31Å
16	E	92.9	Very high	86.2	Confident	77 Å²	77	81 Å²	81	36%	0.36	47%	0.467	S	S	.	.	H	α-helix	trans	-67.9	-35.3	173.3	-170.4	-164.1	152	0	0	111.1	L12 L13 P14 K20	L12-E16 HydrophobicContact CD1-CB 4.13Å; L12-E16 VanDerWaalsContact CD1-CD 3.5Å; L12-E16 HydrophobicContact CD1-CG 3.95Å; L12-E16 WeakPolarHBondContact CD1-OE1 3.33Å; L13-E16 HydrophobicContact CB-CB 3.99Å; L13-E16 WeakPolarHBondContact O-CA 3.21Å; L13-E16 WeakPolarHBondContact O-CB 3.46Å; L13-E16 PolarHBondContact O-N 2.8Å; P14-E16 VanDerWaalsContact C-N 3.32Å; P14-E16 PolarHBondContact O-N 3.29Å; E16-K20 WeakPolarHBondContact O-CG 3.38Å; E16-K20 PolarHBondContact O-N 2.96Å; E16-K20 VanDerWaalsContact O-N 3.09Å; E16-K20 WeakPolarHBondContact OE1-CE 3.27Å; E16-K20 IonicContact OE1-NZ 2.89Å; E16-K20 PolarHBondContact OE1-NZ 2.62Å
17	L	92.1	Very high	88	Confident	74 Å²	74	76.7 Å²	76.7	39%	0.387	43%	0.429	S	S	.	.	H	α-helix	trans	-64.1	-44.3	172.2	177.9	60.9	0	0	0	111.1	L12 L13 P14 L15 K20 C21 P84	L12-L17 HydrophobicContact CD2-CB 3.76Å; L12-L17 HydrophobicContact CD2-CD1 3.79Å; L12-L17 HydrophobicContact CD2-CD2 4.42Å; L12-L17 HydrophobicContact CD2-CG 4.18Å; L12-L17 HydrophobicContact CG-CB 4.13Å; L13-L17 PolarHBondContact O-N 2.76Å; P14-L17 WeakPolarHBondContact O-CB 3.47Å; P14-L17 PolarHBondContact O-N 2.76Å; L15-L17 VanDerWaalsContact C-N 3.32Å; L17-K20 PolarHBondContact O-N 2.94Å; L17-C21 PolarHBondContact O-N 3.09Å; L17-C21 PolarHBondContact O-SG 2.8Å; L17-P84 HydrophobicContact CD1-CG 4.39Å; L17-P84 HydrophobicContact CG-CG 4.45Å
18	V	94.2	Very high	89.7	Confident	13 Å²	13	71.7 Å²	71.7	8%	0.079	40%	0.399	C	S	.	.	H	α-helix	trans	-64.8	-40.7	178.4	-179.4	0	0	0	0	111.3	P14 L15 K20 C21 L40 F43 M49 L82	P14-V18 WeakPolarHBondContact O-CG2 3.46Å; P14-V18 PolarHBondContact O-N 2.95Å; P14-V18 VanDerWaalsContact O-N 3.13Å; L15-V18 PolarHBondContact O-N 2.84Å; V18-K20 VanDerWaalsContact C-N 3.32Å; V18-K20 PolarHBondContact O-N 2.8Å; V18-C21 WeakPolarHBondContact O-CA 3.38Å; V18-C21 VanDerWaalsContact O-CB 3.29Å; V18-C21 WeakPolarHBondContact O-CB 3.07Å; V18-C21 PolarHBondContact O-N 3.47Å; V18-L40 HydrophobicContact CG1-CD2 3.96Å; V18-F43 HydrophobicContact CB-CE1 4.25Å; V18-F43 HydrophobicContact CB-CZ 4.3Å; V18-F43 HydrophobicContact CG1-CD1 3.68Å; V18-F43 HydrophobicContact CG1-CD2 4.33Å; V18-F43 HydrophobicContact CG1-CE1 3.78Å; V18-F43 HydrophobicContact CG1-CE2 4.43Å; V18-F43 HydrophobicContact CG1-CG 3.99Å; V18-F43 HydrophobicContact CG1-CZ 4.16Å; V18-M49 HydrophobicContact CG1-CE 3.9Å; V18-L82 HydrophobicContact CG2-CD1 3.7Å
19	D	95.6	Very high	90.9	Very high	93 Å²	93	68.5 Å²	68.5	50%	0.497	38%	0.383	S	S	.	.	H	α-helix	trans	-58	-43.2	174.3	-174.5	72.1	0	0	0	112.1	L15 C21 I22 F43	L15-D19 WeakPolarHBondContact O-CB 3.48Å; L15-D19 PolarHBondContact O-N 2.86Å; D19-C21 PolarHBondContact O-N 3.37Å; D19-C21 VanDerWaalsContact O-N 3.1Å; D19-I22 WeakPolarHBondContact O-CB 3.34Å; D19-I22 WeakPolarHBondContact O-CG1 3.49Å; D19-I22 PolarHBondContact O-N 2.98Å; D19-I22 VanDerWaalsContact O-N 3.09Å; D19-F43 HydrophobicContact CB-CE1 4.19Å; D19-F43 HydrophobicContact CB-CZ 4.37Å
20	K	94.6	Very high	92.4	Very high	121 Å²	121	63.1 Å²	63.1	53%	0.526	35%	0.346	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.9	-15.3	173.9	-72.5	173.4	-174.9	168.2	0	114.1	L12 E16 L17 V18	L12-K20 HydrophobicContact CD1-CD 4.4Å; L12-K20 VanDerWaalsContact CD1-NZ 3.32Å; E16-K20 WeakPolarHBondContact O-CG 3.38Å; E16-K20 PolarHBondContact O-N 2.96Å; E16-K20 VanDerWaalsContact O-N 3.09Å; E16-K20 WeakPolarHBondContact OE1-CE 3.27Å; E16-K20 IonicContact OE1-NZ 2.89Å; E16-K20 PolarHBondContact OE1-NZ 2.62Å; L17-K20 PolarHBondContact O-N 2.94Å; V18-K20 VanDerWaalsContact C-N 3.32Å; V18-K20 PolarHBondContact O-N 2.8Å
21	C	95.1	Very high	93.3	Very high	8 Å²	8	64.7 Å²	64.7	5%	0.054	34%	0.341	C	S	.	.	T	Hydrogen-bonded Turn	trans	-90	-5.6	177.5	-58.6	0	0	0	0	113.3	L17 V18 D19 G23 S24 I26 L40 P84	L17-C21 PolarHBondContact O-N 3.09Å; L17-C21 PolarHBondContact O-SG 2.8Å; V18-C21 WeakPolarHBondContact O-CA 3.38Å; V18-C21 VanDerWaalsContact O-CB 3.29Å; V18-C21 WeakPolarHBondContact O-CB 3.07Å; V18-C21 PolarHBondContact O-N 3.47Å; D19-C21 PolarHBondContact O-N 3.37Å; D19-C21 VanDerWaalsContact O-N 3.1Å; C21-G23 PolarHBondContact O-N 2.85Å; C21-S24 WeakPolarHBondContact O-CA 3.38Å; C21-S24 WeakPolarHBondContact O-CB 3.46Å; C21-S24 PolarHBondContact O-N 3.36Å; C21-I26 HydrophobicContact CB-CD1 4.45Å; C21-L40 HydrophobicContact CB-CD2 4.1Å; C21-P84 WeakPolarHBondContact SG-CB 3.48Å; C21-P84 WeakPolarHBondContact SG-CG 3.47Å
22	I	96.9	Very high	93.8	Very high	70 Å²	70	64.6 Å²	64.6	36%	0.359	34%	0.344	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.2	134.5	176.4	-63.3	171.3	0	0	0	109.5	D19 S24 L40 F43	D19-I22 WeakPolarHBondContact O-CB 3.34Å; D19-I22 WeakPolarHBondContact O-CG1 3.49Å; D19-I22 PolarHBondContact O-N 2.98Å; D19-I22 VanDerWaalsContact O-N 3.09Å; I22-S24 PolarHBondContact O-N 3.06Å; I22-L40 CarbonylContact C-O 3.57Å; I22-L40 WeakPolarHBondContact CA-O 3.42Å; I22-L40 HydrophobicContact CG1-CD2 4.05Å; I22-L40 HydrophobicContact CG1-CG 4.26Å; I22-F43 HydrophobicContact CD1-CD1 4.35Å; I22-F43 HydrophobicContact CD1-CE1 4.18Å
23	G	96.8	Very high	93.9	Very high	54 Å²	54	66.1 Å²	66.1	56%	0.557	35%	0.353	S	S	*	.	T	Hydrogen-bonded Turn	trans	76.6	-1	-172.9	0	0	0	0	0	114.4	C21 L40	C21-G23 PolarHBondContact O-N 2.85Å; G23-L40 PolarHBondContact N-O 3.01Å
24	S	97.1	Very high	94	Very high	60 Å²	60	63.9 Å²	63.9	42%	0.42	34%	0.339	S	S	.	.	S	Bend	trans	-108.5	158.4	177.2	-59.3	0	0	0	0	111.3	C21 I22 T39 L40	C21-S24 WeakPolarHBondContact O-CA 3.38Å; C21-S24 WeakPolarHBondContact O-CB 3.46Å; C21-S24 PolarHBondContact O-N 3.36Å; I22-S24 PolarHBondContact O-N 3.06Å; S24-T39 WeakPolarHBondContact O-CA 3.45Å; S24-L40 PolarHBondContact O-N 2.85Å
25	R	96.7	Very high	94.2	Very high	112 Å²	112	61 Å²	61	42%	0.423	32%	0.317	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.9	134.6	172.5	-174.1	150.6	-103.7	146	-3.2	109.7	V37 G38 D53 G85	R25-V37 HydrophobicContact CG-CG1 3.8Å; R25-G38 CarbonylContact C-O 3.6Å; R25-G38 WeakPolarHBondContact CA-O 3.47Å; R25-D53 PolarHBondContact NH2-O 3.07Å; R25-D53 VanDerWaalsContact NH2-O 3.13Å; R25-G85 VanDerWaalsContact O-CA 3.3Å; R25-G85 WeakPolarHBondContact O-CA 3.33Å; R25-G85 PolarHBondContact O-N 2.75Å
26	I	97.3	Very high	94.4	Very high	1 Å²	1	56.8 Å²	56.8	1%	0.005	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.5	143	178.2	-165	167.2	0	0	0	109.1	C21 I28 V37 G38 L40 L51 L82	C21-I26 HydrophobicContact CB-CD1 4.45Å; I26-I28 HydrophobicContact CG1-CG1 4.36Å; I26-I28 HydrophobicContact CG2-CD1 4.24Å; I26-I28 HydrophobicContact CG2-CG1 4.13Å; I26-V37 WeakPolarHBondContact O-CA 3.47Å; I26-G38 PolarHBondContact N-O 2.86Å; I26-G38 PolarHBondContact O-N 2.89Å; I26-L40 HydrophobicContact CD1-CD2 4.37Å; I26-L40 HydrophobicContact CG2-CB 4Å; I26-L51 HydrophobicContact CG2-CD2 3.86Å; I26-L82 HydrophobicContact CD1-CB 4.24Å; I26-L82 HydrophobicContact CD1-CD2 4.07Å
27	H	97.4	Very high	94.6	Very high	11 Å²	11	53.4 Å²	53.4	5%	0.051	28%	0.279	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.8	124.2	171.8	175.2	-149.7	0	0	0	109.5	E35 I36 V37 I83	H27-E35 IonicContact CE1-OE2 2.8Å; H27-E35 PolarHBondContact CE1-OE2 2.82Å; H27-E35 WeakPolarHBondContact NE2-CB 3.48Å; H27-E35 IonicContact NE2-OE2 2.62Å; H27-E35 PolarHBondContact NE2-OE2 3.01Å; H27-I36 CarbonylContact C-O 3.48Å; H27-I36 WeakPolarHBondContact CA-O 3.47Å; H27-V37 HydrophobicContact CB-CG2 4.02Å; H27-V37 VanDerWaalsContact CD2-CG2 3.49Å; H27-V37 WeakPolarHBondContact CD2-CG2 3.41Å; H27-I83 HydrophobicContact CB-CB 4.09Å; H27-I83 PolarHBondContact N-O 2.83Å; H27-I83 PolarHBondContact O-N 3.02Å
28	I	96.4	Very high	94.8	Very high	0 Å²	0	49.9 Å²	49.9	0%	0	26%	0.261	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.5	123.9	-174.2	-51.8	-171.1	0	0	0	109.1	I26 E35 I36 M49 L51 L74 I79 M81 L82	I26-I28 HydrophobicContact CG1-CG1 4.36Å; I26-I28 HydrophobicContact CG2-CD1 4.24Å; I26-I28 HydrophobicContact CG2-CG1 4.13Å; I28-E35 CarbonylContact O-C 3.57Å; I28-E35 WeakPolarHBondContact O-CA 3.32Å; I28-I36 HydrophobicContact CB-CB 4.38Å; I28-I36 PolarHBondContact N-O 3.3Å; I28-I36 PolarHBondContact O-N 3.23Å; I28-M49 HydrophobicContact CD1-SD 3.45Å; I28-M49 WeakPolarHBondContact CD1-SD 3.37Å; I28-L51 HydrophobicContact CD1-CD1 3.85Å; I28-L51 HydrophobicContact CD1-CD2 4.38Å; I28-L74 HydrophobicContact CB-CD2 4.42Å; I28-L74 HydrophobicContact CD1-CD2 3.66Å; I28-L74 HydrophobicContact CG2-CD2 3.91Å; I28-I79 HydrophobicContact CG2-CB 4.44Å; I28-I79 HydrophobicContact CG2-CD1 4.21Å; I28-I79 HydrophobicContact CG2-CG1 3.94Å; I28-I79 HydrophobicContact CG2-CG2 3.96Å; I28-M81 WeakPolarHBondContact CA-O 3.29Å; I28-L82 HydrophobicContact CB-CD2 4.26Å; I28-L82 HydrophobicContact CD1-CD2 3.89Å; I28-L82 HydrophobicContact CG1-CD2 3.7Å; I28-L82 HydrophobicContact CG2-CD2 3.94Å
29	V	95.3	Very high	95	Very high	26 Å²	26	50.2 Å²	50.2	16%	0.158	26%	0.263	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.9	124.1	175.7	-173.9	0	0	0	0	109.1	E35 T80 M81 I83	V29-E35 HydrophobicContact CB-CG 4.42Å; V29-E35 HydrophobicContact CG1-CG 4.16Å; V29-E35 HydrophobicContact CG2-CG 4.2Å; V29-T80 WeakPolarHBondContact O-CA 3.47Å; V29-T80 WeakPolarHBondContact O-CB 3.35Å; V29-T80 PolarHBondContact O-N 2.95Å; V29-M81 HydrophobicContact CB-CB 4.16Å; V29-M81 HydrophobicContact CB-CE 4.21Å; V29-M81 HydrophobicContact CG1-CE 4.14Å; V29-M81 HydrophobicContact CG2-CB 4.34Å; V29-M81 HydrophobicContact CG2-CE 4.25Å; V29-M81 PolarHBondContact N-O 3.36Å; V29-M81 PolarHBondContact O-N 2.75Å; V29-I83 HydrophobicContact CG2-CD1 4.26Å
30	M	94.9	Very high	95.1	Very high	25 Å²	25	45.8 Å²	45.8	12%	0.123	24%	0.239	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-96.9	164.6	178.9	-56	-97.8	-74.4	0	0	111	N32 K34 I36 L74 N78 I79	M30-N32 VanDerWaalsContact C-N 3.26Å; M30-N32 PolarHBondContact O-N 2.8Å; M30-K34 WeakPolarHBondContact CA-O 3.5Å; M30-K34 HydrophobicContact CB-CB 4.18Å; M30-K34 WeakPolarHBondContact CB-O 3.33Å; M30-K34 HydrophobicContact CG-CB 4.45Å; M30-K34 HydrophobicContact CG-CG 4.32Å; M30-K34 WeakPolarHBondContact CG-O 3.3Å; M30-K34 PolarHBondContact N-O 3.43Å; M30-I36 HydrophobicContact CG-CD1 4.27Å; M30-I36 HydrophobicContact SD-CD1 4.32Å; M30-L74 HydrophobicContact CE-CD1 4.01Å; M30-L74 HydrophobicContact SD-CD1 3.81Å; M30-L74 HydrophobicContact SD-CD2 4.28Å; M30-L74 HydrophobicContact SD-CG 4.35Å; M30-N78 CarbonylContact C-O 3.56Å; M30-N78 VanDerWaalsContact CA-O 3.28Å; M30-N78 WeakPolarHBondContact CA-O 3.47Å; M30-N78 HydrophobicContact CE-CB 3.77Å; M30-N78 HydrophobicContact SD-CB 4.03Å; M30-I79 HydrophobicContact SD-CG1 4.46Å
31	K	91.8	Very high	95.3	Very high	129 Å²	129	43.1 Å²	43.1	56%	0.561	23%	0.23	S	C	*	.	S	Bend	trans	-63.8	-20.6	179	-69.7	174	-179.1	163.3	0	115.6	N77 N78 T80	K31-N77 PolarHBondContact NZ-O 3.28Å; K31-N78 PolarHBondContact N-O 2.81Å; K31-T80 WeakPolarHBondContact CG-OG1 3.49Å; K31-T80 PolarHBondContact N-OG1 2.95Å
32	N	86.3	Confident	95.4	Very high	119 Å²	119	43.5 Å²	43.5	64%	0.636	24%	0.236	S	C	*	.	S	Bend	trans	-113.8	47.6	-166.3	-60.9	-11.5	0	0	0	113	M30 K34	M30-N32 VanDerWaalsContact C-N 3.26Å; M30-N32 PolarHBondContact O-N 2.8Å; N32-K34 PolarHBondContact O-N 3Å
33	D	85.4	Confident	95.4	Very high	110 Å²	110	42.9 Å²	42.9	59%	0.588	23%	0.231	S	C	*	.	S	Bend	trans	51	33.5	-178.6	-55.5	-44.3	0	0	0	113.5	I59	D33-I59 HydrophobicContact CB-CB 4.06Å; D33-I59 HydrophobicContact CB-CD1 4.32Å; D33-I59 HydrophobicContact CB-CG1 4.4Å; D33-I59 PolarHBondContact O-N 3.13Å; D33-I59 VanDerWaalsContact O-N 3.09Å
34	K	92.9	Very high	95.4	Very high	49 Å²	49	43.2 Å²	43.2	21%	0.213	22%	0.22	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-120.5	130.9	-179.6	174.7	169.6	165.6	157.5	0	109	M30 N32 I36 E56 F57	M30-K34 WeakPolarHBondContact CA-O 3.5Å; M30-K34 HydrophobicContact CB-CB 4.18Å; M30-K34 WeakPolarHBondContact CB-O 3.33Å; M30-K34 HydrophobicContact CG-CB 4.45Å; M30-K34 HydrophobicContact CG-CG 4.32Å; M30-K34 WeakPolarHBondContact CG-O 3.3Å; M30-K34 PolarHBondContact N-O 3.43Å; N32-K34 PolarHBondContact O-N 3Å; K34-I36 HydrophobicContact CG-CG1 4.41Å; K34-E56 HydrophobicContact CD-CG 4.29Å; K34-E56 WeakPolarHBondContact CD-OE1 3.46Å; K34-E56 WeakPolarHBondContact CE-OE1 3.33Å; K34-E56 WeakPolarHBondContact CE-OE2 3.42Å; K34-E56 HydrophobicContact CG-CG 4.29Å; K34-E56 IonicContact NZ-OE1 2.69Å; K34-E56 PolarHBondContact NZ-OE1 3.1Å; K34-E56 IonicContact NZ-OE2 2.92Å; K34-E56 PolarHBondContact NZ-OE2 3.45Å; K34-F57 CarbonylContact C-O 3.52Å; K34-F57 WeakPolarHBondContact CA-O 3.13Å
35	E	95.6	Very high	95.2	Very high	40 Å²	40	47.5 Å²	47.5	19%	0.187	24%	0.238	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	140.9	-177.5	-74.8	177.8	-109.3	0	0	108.9	H27 I28 V29 F57 P89	H27-E35 IonicContact CE1-OE2 2.8Å; H27-E35 PolarHBondContact CE1-OE2 2.82Å; H27-E35 WeakPolarHBondContact NE2-CB 3.48Å; H27-E35 IonicContact NE2-OE2 2.62Å; H27-E35 PolarHBondContact NE2-OE2 3.01Å; I28-E35 CarbonylContact O-C 3.57Å; I28-E35 WeakPolarHBondContact O-CA 3.32Å; V29-E35 HydrophobicContact CB-CG 4.42Å; V29-E35 HydrophobicContact CG1-CG 4.16Å; V29-E35 HydrophobicContact CG2-CG 4.2Å; E35-F57 HydrophobicContact CB-CB 4.22Å; E35-F57 HydrophobicContact CB-CD2 4.5Å; E35-F57 PolarHBondContact N-O 2.83Å; E35-F57 PolarHBondContact O-N 3.43Å; E35-P89 WeakPolarHBondContact OE2-CG 3.45Å
36	I	96.4	Very high	95	Very high	0 Å²	0	49.7 Å²	49.7	0%	0	25%	0.251	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.6	124.5	-172.6	-57.8	177.4	0	0	0	108.3	H27 I28 M30 K34 L51 V54 I72 L74	H27-I36 CarbonylContact C-O 3.48Å; H27-I36 WeakPolarHBondContact CA-O 3.47Å; I28-I36 HydrophobicContact CB-CB 4.38Å; I28-I36 PolarHBondContact N-O 3.3Å; I28-I36 PolarHBondContact O-N 3.23Å; M30-I36 HydrophobicContact CG-CD1 4.27Å; M30-I36 HydrophobicContact SD-CD1 4.32Å; K34-I36 HydrophobicContact CG-CG1 4.41Å; I36-L51 HydrophobicContact CG2-CD1 3.75Å; I36-V54 HydrophobicContact CG2-CG1 3.4Å; I36-V54 VanDerWaalsContact CG2-CG1 3.4Å; I36-I72 HydrophobicContact CD1-CD1 4.47Å; I36-I72 HydrophobicContact CG2-CD1 4.24Å; I36-L74 HydrophobicContact CD1-CD1 3.4Å; I36-L74 VanDerWaalsContact CD1-CD1 3.4Å; I36-L74 HydrophobicContact CD1-CD2 3.9Å; I36-L74 HydrophobicContact CD1-CG 4.29Å
37	V	97.3	Very high	94.9	Very high	6 Å²	6	51.3 Å²	51.3	4%	0.036	26%	0.261	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.3	128.2	174.6	179.4	0	0	0	0	108.6	R25 I26 H27 V54 T55 F57 G88	R25-V37 HydrophobicContact CG-CG1 3.8Å; I26-V37 WeakPolarHBondContact O-CA 3.47Å; H27-V37 HydrophobicContact CB-CG2 4.02Å; H27-V37 VanDerWaalsContact CD2-CG2 3.49Å; H27-V37 WeakPolarHBondContact CD2-CG2 3.41Å; V37-V54 CarbonylContact O-C 3.55Å; V37-V54 WeakPolarHBondContact O-CA 3.29Å; V37-T55 PolarHBondContact N-O 2.87Å; V37-T55 PolarHBondContact O-N 2.94Å; V37-F57 HydrophobicContact CB-CE2 4.25Å; V37-F57 HydrophobicContact CG2-CD2 4.37Å; V37-F57 HydrophobicContact CG2-CE2 3.75Å; V37-G88 VanDerWaalsContact CG2-CA 3.46Å
38	G	97.4	Very high	94.9	Very high	0 Å²	0	52.7 Å²	52.7	0%	0	27%	0.268	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-165.2	175.2	-180	0	0	0	0	0	111.4	R25 I26 E52	R25-G38 CarbonylContact C-O 3.6Å; R25-G38 WeakPolarHBondContact CA-O 3.47Å; I26-G38 PolarHBondContact N-O 2.86Å; I26-G38 PolarHBondContact O-N 2.89Å; G38-E52 WeakPolarHBondContact CA-O 3.48Å
39	T	97.8	Very high	94.9	Very high	21 Å²	21	52.7 Å²	52.7	13%	0.129	27%	0.268	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.7	126.3	171.6	-57.4	0	0	0	0	109	S24 L41 L51 E52	S24-T39 WeakPolarHBondContact O-CA 3.45Å; T39-L41 PolarHBondContact O-N 2.94Å; T39-L51 VanDerWaalsContact O-CA 3.29Å; T39-L51 WeakPolarHBondContact O-CA 3.45Å; T39-E52 HydrophobicContact CG2-CG 4.25Å; T39-E52 PolarHBondContact N-O 3.09Å; T39-E52 PolarHBondContact O-N 3.02Å
40	L	98.1	Very high	95.1	Very high	0 Å²	0	53.9 Å²	53.9	0%	0	28%	0.276	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.4	115.8	179.6	179.1	62.7	0	0	0	110.5	V18 C21 I22 G23 S24 I26 G42 M49 L51	V18-L40 HydrophobicContact CG1-CD2 3.96Å; C21-L40 HydrophobicContact CB-CD2 4.1Å; I22-L40 CarbonylContact C-O 3.57Å; I22-L40 WeakPolarHBondContact CA-O 3.42Å; I22-L40 HydrophobicContact CG1-CD2 4.05Å; I22-L40 HydrophobicContact CG1-CG 4.26Å; G23-L40 PolarHBondContact N-O 3.01Å; S24-L40 PolarHBondContact O-N 2.85Å; I26-L40 HydrophobicContact CD1-CD2 4.37Å; I26-L40 HydrophobicContact CG2-CB 4Å; L40-G42 WeakPolarHBondContact CD1-O 3.13Å; L40-M49 HydrophobicContact CD1-CB 4.03Å; L40-M49 HydrophobicContact CD1-CG 4.19Å; L40-M49 HydrophobicContact CD1-SD 3.94Å; L40-L51 HydrophobicContact CB-CD2 4.17Å; L40-L51 HydrophobicContact CD1-CD2 3.82Å
41	L	98.1	Very high	95.2	Very high	64 Å²	64	52.7 Å²	52.7	34%	0.335	27%	0.27	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.9	-28.8	175.3	-67.5	-176.1	0	0	0	112.8	T39 V50 E52 Q71	T39-L41 PolarHBondContact O-N 2.94Å; L41-V50 HydrophobicContact CB-CB 4.17Å; L41-V50 HydrophobicContact CB-CG1 4.06Å; L41-V50 WeakPolarHBondContact CB-O 3.28Å; L41-V50 HydrophobicContact CD1-CG1 4.01Å; L41-V50 PolarHBondContact N-O 2.92Å; L41-E52 HydrophobicContact CD1-CB 3.93Å; L41-E52 HydrophobicContact CD1-CG 4.1Å; L41-E52 VanDerWaalsContact CD2-CD 3.49Å; L41-E52 HydrophobicContact CD2-CG 3.96Å; L41-E52 HydrophobicContact CG-CB 4.27Å; L41-E52 HydrophobicContact CG-CG 3.96Å; L41-Q71 VanDerWaalsContact CD1-NE2 3.33Å
42	G	97.3	Very high	95.5	Very high	17 Å²	17	49.9 Å²	49.9	18%	0.175	26%	0.259	C	S	.	.	E	Extended strand (participates in β ladder)	trans	169.5	170.4	178.1	0	0	0	0	0	112.1	L40 M49 V50	L40-G42 WeakPolarHBondContact CD1-O 3.13Å; G42-M49 WeakPolarHBondContact O-CA 3.45Å; G42-V50 PolarHBondContact O-N 2.76Å
43	F	97.8	Very high	96	Very high	56 Å²	56	48.9 Å²	48.9	25%	0.246	25%	0.253	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.2	165.3	177.4	70.3	-76.5	0	0	0	110.7	L15 V18 D19 I22 N48 M49	L15-F43 HydrophobicContact CD2-CE2 4.12Å; V18-F43 HydrophobicContact CB-CE1 4.25Å; V18-F43 HydrophobicContact CB-CZ 4.3Å; V18-F43 HydrophobicContact CG1-CD1 3.68Å; V18-F43 HydrophobicContact CG1-CD2 4.33Å; V18-F43 HydrophobicContact CG1-CE1 3.78Å; V18-F43 HydrophobicContact CG1-CE2 4.43Å; V18-F43 HydrophobicContact CG1-CG 3.99Å; V18-F43 HydrophobicContact CG1-CZ 4.16Å; D19-F43 HydrophobicContact CB-CE1 4.19Å; D19-F43 HydrophobicContact CB-CZ 4.37Å; I22-F43 HydrophobicContact CD1-CD1 4.35Å; I22-F43 HydrophobicContact CD1-CE1 4.18Å; F43-N48 CarbonylContact C-O 3.58Å; F43-N48 WeakPolarHBondContact CA-O 3.49Å; F43-N48 WeakPolarHBondContact CB-O 3.43Å; F43-M49 HydrophobicContact CB-CG 4.02Å
44	D	95.5	Very high	96.6	Very high	62 Å²	62	43.7 Å²	43.7	33%	0.332	23%	0.226	S	C	.	.			trans	-111.4	-179.7	174.6	71.6	5.9	0	0	0	112.6	F46 V47 N48	D44-F46 PolarHBondContact O-N 2.77Å; D44-F46 VanDerWaalsContact O-N 3.11Å; D44-F46 VanDerWaalsContact OD1-C 3.3Å; D44-F46 WeakPolarHBondContact OD1-CA 3.48Å; D44-F46 WeakPolarHBondContact OD1-CB 3.26Å; D44-F46 PolarHBondContact OD1-N 2.84Å; D44-V47 PolarHBondContact O-N 3.25Å; D44-V47 PolarHBondContact OD1-N 2.97Å; D44-N48 PolarHBondContact N-O 2.91Å; D44-N48 VanDerWaalsContact N-O 3.13Å; D44-N48 WeakPolarHBondContact OD1-CB 3.19Å; D44-N48 PolarHBondContact OD1-N 2.87Å; D44-N48 PolarHBondContact OD1-ND2 3.22Å; D44-N48 PolarHBondContact OD2-ND2 2.82Å
45	D	93.1	Very high	96.8	Very high	149 Å²	149	42.6 Å²	42.6	80%	0.797	22%	0.223	S	C	*	.	T	Hydrogen-bonded Turn	trans	-61	-20.1	179.1	-66.4	-27.3	0	0	0	113.7
46	F	93.9	Very high	96.7	Very high	159 Å²	159	41.9 Å²	41.9	70%	0.697	22%	0.22	S	C	*	.	T	Hydrogen-bonded Turn	trans	-94.7	4.7	176.4	-58.1	-74	0	0	0	112.5	D44 N48	D44-F46 PolarHBondContact O-N 2.77Å; D44-F46 VanDerWaalsContact O-N 3.11Å; D44-F46 VanDerWaalsContact OD1-C 3.3Å; D44-F46 WeakPolarHBondContact OD1-CA 3.48Å; D44-F46 WeakPolarHBondContact OD1-CB 3.26Å; D44-F46 PolarHBondContact OD1-N 2.84Å; F46-N48 PolarHBondContact O-N 3.28Å
47	V	95.2	Very high	96.7	Very high	35 Å²	35	43 Å²	43	21%	0.212	22%	0.224	C	C	.	.			trans	61.6	27.9	-178.7	-161.6	0	0	0	0	111.5	L15 D44 M49 G76 I79 L82	L15-V47 HydrophobicContact CD2-CG2 4.31Å; D44-V47 PolarHBondContact O-N 3.25Å; D44-V47 PolarHBondContact OD1-N 2.97Å; V47-M49 HydrophobicContact CG1-CE 3.41Å; V47-M49 VanDerWaalsContact CG1-CE 3.41Å; V47-G76 VanDerWaalsContact O-CA 3.24Å; V47-G76 WeakPolarHBondContact O-CA 3.46Å; V47-I79 HydrophobicContact CG1-CD1 4.36Å; V47-I79 WeakPolarHBondContact O-CD1 3.35Å; V47-L82 HydrophobicContact CG1-CD1 4.33Å
48	N	96.3	Very high	96.5	Very high	39 Å²	39	45.8 Å²	45.8	21%	0.209	24%	0.237	C	C	.	.			trans	-69.4	134.6	160.8	-58.2	-58	0	0	0	107.7	F43 D44 F46 L73 L74 N75 G76	F43-N48 CarbonylContact C-O 3.58Å; F43-N48 WeakPolarHBondContact CA-O 3.49Å; F43-N48 WeakPolarHBondContact CB-O 3.43Å; D44-N48 PolarHBondContact N-O 2.91Å; D44-N48 VanDerWaalsContact N-O 3.13Å; D44-N48 WeakPolarHBondContact OD1-CB 3.19Å; D44-N48 PolarHBondContact OD1-N 2.87Å; D44-N48 PolarHBondContact OD1-ND2 3.22Å; D44-N48 PolarHBondContact OD2-ND2 2.82Å; F46-N48 PolarHBondContact O-N 3.28Å; N48-L73 HydrophobicContact CB-CD1 4.41Å; N48-L74 CarbonylContact C-O 3.58Å; N48-L74 VanDerWaalsContact CA-O 3.26Å; N48-L74 WeakPolarHBondContact CA-O 3.35Å; N48-N75 WeakPolarHBondContact OD1-CA 3.41Å; N48-G76 PolarHBondContact OD1-N 3Å
49	M	97.4	Very high	96	Very high	0 Å²	0	50.9 Å²	50.9	0%	0	26%	0.263	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.4	136.9	-171.2	-60.7	-166.8	171.7	0	0	111.9	V18 I28 L40 G42 F43 V47 L51 L74 I79 L82	V18-M49 HydrophobicContact CG1-CE 3.9Å; I28-M49 HydrophobicContact CD1-SD 3.45Å; I28-M49 WeakPolarHBondContact CD1-SD 3.37Å; L40-M49 HydrophobicContact CD1-CB 4.03Å; L40-M49 HydrophobicContact CD1-CG 4.19Å; L40-M49 HydrophobicContact CD1-SD 3.94Å; G42-M49 WeakPolarHBondContact O-CA 3.45Å; F43-M49 HydrophobicContact CB-CG 4.02Å; V47-M49 HydrophobicContact CG1-CE 3.41Å; V47-M49 VanDerWaalsContact CG1-CE 3.41Å; M49-L51 HydrophobicContact CB-CD2 4.45Å; M49-L74 HydrophobicContact CB-CB 4.4Å; M49-L74 PolarHBondContact N-O 3.24Å; M49-L74 PolarHBondContact O-N 3.13Å; M49-I79 HydrophobicContact CE-CD1 4.34Å; M49-I79 HydrophobicContact CG-CD1 4.24Å; M49-I79 HydrophobicContact SD-CD1 4.22Å; M49-L82 HydrophobicContact CE-CD1 3.43Å; M49-L82 VanDerWaalsContact CE-CD1 3.43Å; M49-L82 HydrophobicContact CE-CD2 3.44Å; M49-L82 VanDerWaalsContact CE-CD2 3.44Å; M49-L82 HydrophobicContact CE-CG 4.08Å; M49-L82 HydrophobicContact SD-CD2 3.88Å
50	V	98.1	Very high	95.4	Very high	52 Å²	52	51.7 Å²	51.7	32%	0.315	27%	0.268	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.8	123.5	166.9	-174.4	0	0	0	0	107.7	L41 G42 Q71 I72 L73	L41-V50 HydrophobicContact CB-CB 4.17Å; L41-V50 HydrophobicContact CB-CG1 4.06Å; L41-V50 WeakPolarHBondContact CB-O 3.28Å; L41-V50 HydrophobicContact CD1-CG1 4.01Å; L41-V50 PolarHBondContact N-O 2.92Å; G42-V50 PolarHBondContact O-N 2.76Å; V50-Q71 HydrophobicContact CG1-CG 4.29Å; V50-I72 WeakPolarHBondContact CA-O 3.42Å; V50-L73 HydrophobicContact CG2-CD1 3.97Å
51	L	98	Very high	94.9	Very high	0 Å²	0	58.6 Å²	58.6	0%	0	31%	0.313	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.9	147	179.6	-59.9	-179	0	0	0	110.7	I26 I28 I36 T39 L40 M49 V54 Q71 I72	I26-L51 HydrophobicContact CG2-CD2 3.86Å; I28-L51 HydrophobicContact CD1-CD1 3.85Å; I28-L51 HydrophobicContact CD1-CD2 4.38Å; I36-L51 HydrophobicContact CG2-CD1 3.75Å; T39-L51 VanDerWaalsContact O-CA 3.29Å; T39-L51 WeakPolarHBondContact O-CA 3.45Å; L40-L51 HydrophobicContact CB-CD2 4.17Å; L40-L51 HydrophobicContact CD1-CD2 3.82Å; M49-L51 HydrophobicContact CB-CD2 4.45Å; L51-V54 HydrophobicContact CB-CG2 3.46Å; L51-V54 VanDerWaalsContact CB-CG2 3.46Å; L51-V54 HydrophobicContact CD1-CG2 4.39Å; L51-Q71 CarbonylContact O-C 3.56Å; L51-Q71 VanDerWaalsContact O-CA 3.27Å; L51-Q71 WeakPolarHBondContact O-CA 3.41Å; L51-Q71 WeakPolarHBondContact O-CG 3.44Å; L51-I72 HydrophobicContact CB-CG1 4.06Å; L51-I72 HydrophobicContact CD1-CD1 4.39Å; L51-I72 PolarHBondContact N-O 3.13Å; L51-I72 PolarHBondContact O-N 3.32Å
52	E	98.1	Very high	94.2	Very high	70 Å²	70	64.7 Å²	64.7	33%	0.327	34%	0.34	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.8	165.5	169.2	67.9	-179.6	-171.8	0	0	112.2	G38 T39 L41 V54 D70	G38-E52 WeakPolarHBondContact CA-O 3.48Å; T39-E52 HydrophobicContact CG2-CG 4.25Å; T39-E52 PolarHBondContact N-O 3.09Å; T39-E52 PolarHBondContact O-N 3.02Å; L41-E52 HydrophobicContact CD1-CB 3.93Å; L41-E52 HydrophobicContact CD1-CG 4.1Å; L41-E52 VanDerWaalsContact CD2-CD 3.49Å; L41-E52 HydrophobicContact CD2-CG 3.96Å; L41-E52 HydrophobicContact CG-CB 4.27Å; L41-E52 HydrophobicContact CG-CG 3.96Å; E52-V54 VanDerWaalsContact C-N 3.26Å; E52-V54 PolarHBondContact O-N 3.33Å; E52-D70 CarbonylContact C-O 3.57Å; E52-D70 WeakPolarHBondContact CA-O 3.34Å
53	D	96.8	Very high	93.6	Very high	98 Å²	98	65.6 Å²	65.6	52%	0.524	35%	0.349	S	S	.	.	E	Extended strand (participates in β ladder)	trans	48.9	49.7	-178.5	-70.3	-37.5	0	0	0	112.1	R25 D70	R25-D53 PolarHBondContact NH2-O 3.07Å; R25-D53 VanDerWaalsContact NH2-O 3.13Å; D53-D70 PolarHBondContact N-O 2.9Å
54	V	97.3	Very high	93.1	Very high	1 Å²	1	67 Å²	67	1%	0.006	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.5	134.5	-168.1	-179.3	0	0	0	0	111.3	I36 V37 L51 E52 K68 L69 I72	I36-V54 HydrophobicContact CG2-CG1 3.4Å; I36-V54 VanDerWaalsContact CG2-CG1 3.4Å; V37-V54 CarbonylContact O-C 3.55Å; V37-V54 WeakPolarHBondContact O-CA 3.29Å; L51-V54 HydrophobicContact CB-CG2 3.46Å; L51-V54 VanDerWaalsContact CB-CG2 3.46Å; L51-V54 HydrophobicContact CD1-CG2 4.39Å; E52-V54 VanDerWaalsContact C-N 3.26Å; E52-V54 PolarHBondContact O-N 3.33Å; V54-K68 CarbonylContact O-C 3.54Å; V54-K68 VanDerWaalsContact O-CA 3.28Å; V54-K68 WeakPolarHBondContact O-CA 3.49Å; V54-L69 HydrophobicContact CB-CB 4.33Å; V54-L69 PolarHBondContact N-O 3.3Å; V54-L69 PolarHBondContact O-N 3.42Å; V54-I72 HydrophobicContact CG1-CD1 3.95Å; V54-I72 HydrophobicContact CG1-CG1 4.48Å; V54-I72 HydrophobicContact CG2-CD1 4.26Å; V54-I72 HydrophobicContact CG2-CG1 3.93Å
55	T	96.5	Very high	93	Very high	25 Å²	25	71.3 Å²	71.3	15%	0.153	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.4	116.4	165.3	-54.8	0	0	0	0	108.7	V37 F57 I66 T67	V37-T55 PolarHBondContact N-O 2.87Å; V37-T55 PolarHBondContact O-N 2.94Å; T55-F57 HydrophobicContact CG2-CD1 4.47Å; T55-F57 HydrophobicContact CG2-CD2 4.48Å; T55-F57 HydrophobicContact CG2-CE1 3.82Å; T55-F57 HydrophobicContact CG2-CE2 3.8Å; T55-F57 HydrophobicContact CG2-CZ 3.44Å; T55-F57 VanDerWaalsContact CG2-CZ 3.44Å; T55-I66 HydrophobicContact CG2-CG2 3.59Å; T55-T67 WeakPolarHBondContact CA-O 3.36Å
56	E	95.5	Very high	93	Very high	26 Å²	26	68.7 Å²	68.7	12%	0.121	35%	0.35	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.2	132.9	174	175.4	178	157.6	0	0	109.9	K34 I66 T67	K34-E56 HydrophobicContact CD-CG 4.29Å; K34-E56 WeakPolarHBondContact CD-OE1 3.46Å; K34-E56 WeakPolarHBondContact CE-OE1 3.33Å; K34-E56 WeakPolarHBondContact CE-OE2 3.42Å; K34-E56 HydrophobicContact CG-CG 4.29Å; K34-E56 IonicContact NZ-OE1 2.69Å; K34-E56 PolarHBondContact NZ-OE1 3.1Å; K34-E56 IonicContact NZ-OE2 2.92Å; K34-E56 PolarHBondContact NZ-OE2 3.45Å; E56-I66 CarbonylContact O-C 3.57Å; E56-I66 VanDerWaalsContact O-CA 3.31Å; E56-I66 WeakPolarHBondContact O-CA 3.24Å; E56-T67 PolarHBondContact N-O 3.09Å; E56-T67 PolarHBondContact O-N 2.81Å
57	F	94.7	Very high	93.1	Very high	22 Å²	22	63 Å²	63	10%	0.096	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.8	124.6	173.2	-55.6	-78.9	0	0	0	108.7	K34 E35 V37 T55 R64 R65 I66	K34-F57 CarbonylContact C-O 3.52Å; K34-F57 WeakPolarHBondContact CA-O 3.13Å; E35-F57 HydrophobicContact CB-CB 4.22Å; E35-F57 HydrophobicContact CB-CD2 4.5Å; E35-F57 PolarHBondContact N-O 2.83Å; E35-F57 PolarHBondContact O-N 3.43Å; V37-F57 HydrophobicContact CB-CE2 4.25Å; V37-F57 HydrophobicContact CG2-CD2 4.37Å; V37-F57 HydrophobicContact CG2-CE2 3.75Å; T55-F57 HydrophobicContact CG2-CD1 4.47Å; T55-F57 HydrophobicContact CG2-CD2 4.48Å; T55-F57 HydrophobicContact CG2-CE1 3.82Å; T55-F57 HydrophobicContact CG2-CE2 3.8Å; T55-F57 HydrophobicContact CG2-CZ 3.44Å; T55-F57 VanDerWaalsContact CG2-CZ 3.44Å; F57-R64 VanDerWaalsContact CD1-NE 3.28Å; F57-R65 WeakPolarHBondContact CA-O 3.22Å; F57-I66 HydrophobicContact CD1-CD1 4.18Å; F57-I66 HydrophobicContact CD1-CG1 3.9Å; F57-I66 HydrophobicContact CD1-CG2 4.24Å; F57-I66 HydrophobicContact CE1-CD1 3.99Å; F57-I66 HydrophobicContact CE1-CG1 4.16Å; F57-I66 HydrophobicContact CE1-CG2 4.06Å
58	E	92.9	Very high	93.1	Very high	65 Å²	65	69.4 Å²	69.4	30%	0.304	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.5	130.4	177.2	-176	-178.7	-155	0	0	108.5	T60 R64 R65	E58-T60 HydrophobicContact CG-CG2 4.14Å; E58-R64 WeakPolarHBondContact O-CA 3.44Å; E58-R65 HydrophobicContact CB-CB 4.38Å; E58-R65 PolarHBondContact N-O 3.19Å; E58-R65 PolarHBondContact O-N 2.92Å
59	I	87.4	Confident	93.2	Very high	107 Å²	107	70.5 Å²	70.5	55%	0.549	36%	0.358	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.8	112.4	173	-55.6	179.1	0	0	0	107.8	D33	D33-I59 HydrophobicContact CB-CB 4.06Å; D33-I59 HydrophobicContact CB-CD1 4.32Å; D33-I59 HydrophobicContact CB-CG1 4.4Å; D33-I59 PolarHBondContact O-N 3.13Å; D33-I59 VanDerWaalsContact O-N 3.09Å
60	T	86.6	Confident	93.1	Very high	38 Å²	38	77.4 Å²	77.4	23%	0.233	40%	0.395	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	162.4	173.9	81.6	0	0	0	0	110.1	E58 E62 G63 R65	E58-T60 HydrophobicContact CG-CG2 4.14Å; T60-E62 PolarHBondContact O-N 2.82Å; T60-E62 VanDerWaalsContact O-N 3.08Å; T60-E62 PolarHBondContact OG1-N 3.29Å; T60-G63 WeakPolarHBondContact CA-O 3.47Å; T60-G63 PolarHBondContact N-O 2.96Å; T60-G63 PolarHBondContact O-N 2.98Å; T60-G63 VanDerWaalsContact O-O 3.13Å; T60-G63 PolarHBondContact OG1-N 2.9Å; T60-G63 PolarHBondContact OG1-O 3.36Å; T60-R65 HydrophobicContact CG2-CB 4.22Å
61	P	85.6	Confident	93.1	Very high	145 Å²	145	81 Å²	81	94%	0.942	41%	0.408	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.4	-20.3	173.6	-24.4	34.7	0	0	0	114
62	E	84.8	Confident	93	Very high	192 Å²	192	82.6 Å²	82.6	90%	0.897	42%	0.417	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.2	-8.6	-178.4	-64.4	162.5	-171.1	0	0	112.3	T60	T60-E62 PolarHBondContact O-N 2.82Å; T60-E62 VanDerWaalsContact O-N 3.08Å; T60-E62 PolarHBondContact OG1-N 3.29Å
63	G	85.1	Confident	93	Very high	36 Å²	36	85.5 Å²	85.5	37%	0.371	43%	0.434	S	S	.	.	E	Extended strand (participates in β ladder)	trans	134.3	-164.9	-180	0	0	0	0	0	112.9	T60	T60-G63 WeakPolarHBondContact CA-O 3.47Å; T60-G63 PolarHBondContact N-O 2.96Å; T60-G63 PolarHBondContact O-N 2.98Å; T60-G63 VanDerWaalsContact O-O 3.13Å; T60-G63 PolarHBondContact OG1-N 2.9Å; T60-G63 PolarHBondContact OG1-O 3.36Å
64	R	87.2	Confident	93	Very high	86 Å²	86	81.4 Å²	81.4	33%	0.325	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.7	121.9	178.2	-172.5	170.8	174.8	-173.8	-7.2	109.9	F57 E58 I66 P89	F57-R64 VanDerWaalsContact CD1-NE 3.28Å; E58-R64 WeakPolarHBondContact O-CA 3.44Å; R64-I66 HydrophobicContact CG-CG1 4.46Å; R64-P89 PolarHBondContact NH1-O 3.11Å; R64-P89 VanDerWaalsContact NH2-CD 3.27Å; R64-P89 PolarHBondContact NH2-O 3.02Å
65	R	91.8	Very high	92.8	Very high	153 Å²	153	85 Å²	85	58%	0.577	43%	0.431	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93.8	131.2	171.9	-175.7	179.5	-178.9	175.5	2.3	109.5	F57 E58 T60	F57-R65 WeakPolarHBondContact CA-O 3.22Å; E58-R65 HydrophobicContact CB-CB 4.38Å; E58-R65 PolarHBondContact N-O 3.19Å; E58-R65 PolarHBondContact O-N 2.92Å; T60-R65 HydrophobicContact CG2-CB 4.22Å
66	I	94	Very high	92.7	Very high	94 Å²	94	84.3 Å²	84.3	48%	0.482	43%	0.429	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.9	124.4	177.1	-51	-177.1	0	0	0	108.8	T55 E56 F57 R64	T55-I66 HydrophobicContact CG2-CG2 3.59Å; E56-I66 CarbonylContact O-C 3.57Å; E56-I66 VanDerWaalsContact O-CA 3.31Å; E56-I66 WeakPolarHBondContact O-CA 3.24Å; F57-I66 HydrophobicContact CD1-CD1 4.18Å; F57-I66 HydrophobicContact CD1-CG1 3.9Å; F57-I66 HydrophobicContact CD1-CG2 4.24Å; F57-I66 HydrophobicContact CE1-CD1 3.99Å; F57-I66 HydrophobicContact CE1-CG1 4.16Å; F57-I66 HydrophobicContact CE1-CG2 4.06Å; R64-I66 HydrophobicContact CG-CG1 4.46Å
67	T	95.2	Very high	92.6	Very high	39 Å²	39	88.7 Å²	88.7	24%	0.239	45%	0.453	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.8	133.4	177.7	-52.4	0	0	0	0	109.6	T55 E56 L69	T55-T67 WeakPolarHBondContact CA-O 3.36Å; E56-T67 PolarHBondContact N-O 3.09Å; E56-T67 PolarHBondContact O-N 2.81Å; T67-L69 HydrophobicContact CG2-CD2 4.17Å; T67-L69 HydrophobicContact CG2-CG 4.23Å
68	K	96.3	Very high	92.5	Very high	170 Å²	170	90.6 Å²	90.6	74%	0.739	47%	0.465	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-103.6	136.5	173.3	-67.9	-171.1	176.1	-173.2	0	110.4	V54	V54-K68 CarbonylContact O-C 3.54Å; V54-K68 VanDerWaalsContact O-CA 3.28Å; V54-K68 WeakPolarHBondContact O-CA 3.49Å
69	L	97.1	Very high	92.6	Very high	62 Å²	62	88.8 Å²	88.8	33%	0.325	46%	0.457	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.9	138.8	-177.5	-60.2	169.3	0	0	0	108.8	V54 T67 I72	V54-L69 HydrophobicContact CB-CB 4.33Å; V54-L69 PolarHBondContact N-O 3.3Å; V54-L69 PolarHBondContact O-N 3.42Å; T67-L69 HydrophobicContact CG2-CD2 4.17Å; T67-L69 HydrophobicContact CG2-CG 4.23Å; L69-I72 HydrophobicContact CB-CG2 3.9Å; L69-I72 HydrophobicContact CD1-CG2 3.65Å; L69-I72 HydrophobicContact CG-CG2 4.38Å
70	D	96.9	Very high	93	Very high	144 Å²	144	87.4 Å²	87.4	77%	0.77	45%	0.454	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-69.8	-50.4	-176.4	-61.7	-27.8	0	0	0	111.4	E52 D53	E52-D70 CarbonylContact C-O 3.57Å; E52-D70 WeakPolarHBondContact CA-O 3.34Å; D53-D70 PolarHBondContact N-O 2.9Å
71	Q	96.6	Very high	93.4	Very high	127 Å²	127	90.7 Å²	90.7	59%	0.593	47%	0.468	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-148.3	140.3	178.8	-171.3	177.3	66.7	0	0	110.8	L41 V50 L51	L41-Q71 VanDerWaalsContact CD1-NE2 3.33Å; V50-Q71 HydrophobicContact CG1-CG 4.29Å; L51-Q71 CarbonylContact O-C 3.56Å; L51-Q71 VanDerWaalsContact O-CA 3.27Å; L51-Q71 WeakPolarHBondContact O-CA 3.41Å; L51-Q71 WeakPolarHBondContact O-CG 3.44Å
72	I	97.6	Very high	93.9	Very high	34 Å²	34	86.2 Å²	86.2	17%	0.174	44%	0.436	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.2	155	176.3	66.4	169.2	0	0	0	112	I36 V50 L51 V54 L69 L74	I36-I72 HydrophobicContact CD1-CD1 4.47Å; I36-I72 HydrophobicContact CG2-CD1 4.24Å; V50-I72 WeakPolarHBondContact CA-O 3.42Å; L51-I72 HydrophobicContact CB-CG1 4.06Å; L51-I72 HydrophobicContact CD1-CD1 4.39Å; L51-I72 PolarHBondContact N-O 3.13Å; L51-I72 PolarHBondContact O-N 3.32Å; V54-I72 HydrophobicContact CG1-CD1 3.95Å; V54-I72 HydrophobicContact CG1-CG1 4.48Å; V54-I72 HydrophobicContact CG2-CD1 4.26Å; V54-I72 HydrophobicContact CG2-CG1 3.93Å; L69-I72 HydrophobicContact CB-CG2 3.9Å; L69-I72 HydrophobicContact CD1-CG2 3.65Å; L69-I72 HydrophobicContact CG-CG2 4.38Å; I72-L74 HydrophobicContact CD1-CB 4.48Å
73	L	97.4	Very high	94.5	Very high	131 Å²	131	80.4 Å²	80.4	69%	0.686	41%	0.41	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.3	116.8	159.4	178.8	64.9	0	0	0	108.5	N48 V50	N48-L73 HydrophobicContact CB-CD1 4.41Å; V50-L73 HydrophobicContact CG2-CD1 3.97Å
74	L	96.3	Very high	94.9	Very high	13 Å²	13	81.7 Å²	81.7	7%	0.068	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96	130.9	179.4	-173	63.6	0	0	0	110.8	I28 M30 I36 N48 M49 I72 I79	I28-L74 HydrophobicContact CB-CD2 4.42Å; I28-L74 HydrophobicContact CD1-CD2 3.66Å; I28-L74 HydrophobicContact CG2-CD2 3.91Å; M30-L74 HydrophobicContact CE-CD1 4.01Å; M30-L74 HydrophobicContact SD-CD1 3.81Å; M30-L74 HydrophobicContact SD-CD2 4.28Å; M30-L74 HydrophobicContact SD-CG 4.35Å; I36-L74 HydrophobicContact CD1-CD1 3.4Å; I36-L74 VanDerWaalsContact CD1-CD1 3.4Å; I36-L74 HydrophobicContact CD1-CD2 3.9Å; I36-L74 HydrophobicContact CD1-CG 4.29Å; N48-L74 CarbonylContact C-O 3.58Å; N48-L74 VanDerWaalsContact CA-O 3.26Å; N48-L74 WeakPolarHBondContact CA-O 3.35Å; M49-L74 HydrophobicContact CB-CB 4.4Å; M49-L74 PolarHBondContact N-O 3.24Å; M49-L74 PolarHBondContact O-N 3.13Å; I72-L74 HydrophobicContact CD1-CB 4.48Å; L74-I79 HydrophobicContact CD2-CD1 4Å; L74-I79 HydrophobicContact CD2-CG1 4.18Å; L74-I79 HydrophobicContact CG-CD1 4.45Å
75	N	94.6	Very high	95.1	Very high	75 Å²	75	80.2 Å²	80.2	40%	0.401	42%	0.423	S	S	.	.	P	Polyproline II helix	trans	-76.9	123.2	177.9	-171.8	-59.7	0	0	0	111.5	N48 N77	N48-N75 WeakPolarHBondContact OD1-CA 3.41Å; N75-N77 VanDerWaalsContact C-N 3.28Å; N75-N77 PolarHBondContact O-N 2.96Å; N75-N77 WeakPolarHBondContact OD1-CB 3.49Å; N75-N77 PolarHBondContact OD1-N 3.01Å; N75-N77 PolarHBondContact OD1-ND2 3.47Å
76	G	93.2	Very high	95	Very high	12 Å²	12	73.5 Å²	73.5	12%	0.124	40%	0.402	C	S	.	.	G	3₁₀ helix	trans	-65.3	-23.2	-176.7	0	0	0	0	0	115.1	V47 N48 N78 I79	V47-G76 VanDerWaalsContact O-CA 3.24Å; V47-G76 WeakPolarHBondContact O-CA 3.46Å; N48-G76 PolarHBondContact OD1-N 3Å; G76-N78 PolarHBondContact O-N 3.47Å; G76-N78 VanDerWaalsContact O-N 3.13Å; G76-I79 PolarHBondContact O-N 2.69Å
77	N	94.3	Very high	94.5	Very high	117 Å²	117	77.5 Å²	77.5	63%	0.626	42%	0.418	S	S	*	.	G	3₁₀ helix	trans	-63.8	-24.7	-176.1	-66.7	-47.1	0	0	0	113.8	K31 N75	K31-N77 PolarHBondContact NZ-O 3.28Å; N75-N77 VanDerWaalsContact C-N 3.28Å; N75-N77 PolarHBondContact O-N 2.96Å; N75-N77 WeakPolarHBondContact OD1-CB 3.49Å; N75-N77 PolarHBondContact OD1-N 3.01Å; N75-N77 PolarHBondContact OD1-ND2 3.47Å
78	N	92.4	Very high	94	Very high	63 Å²	63	76.5 Å²	76.5	34%	0.337	42%	0.416	S	S	.	.	G	3₁₀ helix	trans	-101.1	-4.4	-176.9	-67.2	-34	0	0	0	113.3	M30 K31 G76	M30-N78 CarbonylContact C-O 3.56Å; M30-N78 VanDerWaalsContact CA-O 3.28Å; M30-N78 WeakPolarHBondContact CA-O 3.47Å; M30-N78 HydrophobicContact CE-CB 3.77Å; M30-N78 HydrophobicContact SD-CB 4.03Å; K31-N78 PolarHBondContact N-O 2.81Å; G76-N78 PolarHBondContact O-N 3.47Å; G76-N78 VanDerWaalsContact O-N 3.13Å
79	I	95.2	Very high	93.4	Very high	26 Å²	26	70.3 Å²	70.3	13%	0.133	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.7	131.4	176.9	-62.6	-179	0	0	0	109	I28 M30 V47 M49 L74 G76 L82	I28-I79 HydrophobicContact CG2-CB 4.44Å; I28-I79 HydrophobicContact CG2-CD1 4.21Å; I28-I79 HydrophobicContact CG2-CG1 3.94Å; I28-I79 HydrophobicContact CG2-CG2 3.96Å; M30-I79 HydrophobicContact SD-CG1 4.46Å; V47-I79 HydrophobicContact CG1-CD1 4.36Å; V47-I79 WeakPolarHBondContact O-CD1 3.35Å; M49-I79 HydrophobicContact CE-CD1 4.34Å; M49-I79 HydrophobicContact CG-CD1 4.24Å; M49-I79 HydrophobicContact SD-CD1 4.22Å; L74-I79 HydrophobicContact CD2-CD1 4Å; L74-I79 HydrophobicContact CD2-CG1 4.18Å; L74-I79 HydrophobicContact CG-CD1 4.45Å; G76-I79 PolarHBondContact O-N 2.69Å; I79-L82 HydrophobicContact CG2-CD2 3.84Å; I79-L82 HydrophobicContact CG2-CG 4.02Å
80	T	95.6	Very high	92.1	Very high	79 Å²	79	76.5 Å²	76.5	49%	0.485	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.4	-44.3	177.4	-55.2	0	0	0	0	111.1	V29 K31	V29-T80 WeakPolarHBondContact O-CA 3.47Å; V29-T80 WeakPolarHBondContact O-CB 3.35Å; V29-T80 PolarHBondContact O-N 2.95Å; K31-T80 WeakPolarHBondContact CG-OG1 3.49Å; K31-T80 PolarHBondContact N-OG1 2.95Å
81	M	95.2	Very high	90.3	Very high	107 Å²	107	78.9 Å²	78.9	53%	0.527	44%	0.439	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.6	151.7	178.5	-66.2	-178.1	-74.5	0	0	111.8	I28 V29	I28-M81 WeakPolarHBondContact CA-O 3.29Å; V29-M81 HydrophobicContact CB-CB 4.16Å; V29-M81 HydrophobicContact CB-CE 4.21Å; V29-M81 HydrophobicContact CG1-CE 4.14Å; V29-M81 HydrophobicContact CG2-CB 4.34Å; V29-M81 HydrophobicContact CG2-CE 4.25Å; V29-M81 PolarHBondContact N-O 3.36Å; V29-M81 PolarHBondContact O-N 2.75Å
82	L	95.9	Very high	90	Very high	51 Å²	51	76.5 Å²	76.5	27%	0.267	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.1	123.8	177.2	-63.5	169.7	0	0	0	108.3	V18 I26 I28 V47 M49 I79	V18-L82 HydrophobicContact CG2-CD1 3.7Å; I26-L82 HydrophobicContact CD1-CB 4.24Å; I26-L82 HydrophobicContact CD1-CD2 4.07Å; I28-L82 HydrophobicContact CB-CD2 4.26Å; I28-L82 HydrophobicContact CD1-CD2 3.89Å; I28-L82 HydrophobicContact CG1-CD2 3.7Å; I28-L82 HydrophobicContact CG2-CD2 3.94Å; V47-L82 HydrophobicContact CG1-CD1 4.33Å; M49-L82 HydrophobicContact CE-CD1 3.43Å; M49-L82 VanDerWaalsContact CE-CD1 3.43Å; M49-L82 HydrophobicContact CE-CD2 3.44Å; M49-L82 VanDerWaalsContact CE-CD2 3.44Å; M49-L82 HydrophobicContact CE-CG 4.08Å; M49-L82 HydrophobicContact SD-CD2 3.88Å; I79-L82 HydrophobicContact CG2-CD2 3.84Å; I79-L82 HydrophobicContact CG2-CG 4.02Å
83	I	96.1	Very high	89.5	Confident	69 Å²	69	78.7 Å²	78.7	35%	0.354	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.8	100.2	-175.6	-57.8	165.5	0	0	0	108	H27 V29 G85 G86	H27-I83 HydrophobicContact CB-CB 4.09Å; H27-I83 PolarHBondContact N-O 2.83Å; H27-I83 PolarHBondContact O-N 3.02Å; V29-I83 HydrophobicContact CG2-CD1 4.26Å; I83-G85 PolarHBondContact O-N 3.28Å; I83-G86 PolarHBondContact O-N 2.91Å
84	P	95.2	Very high	89.1	Confident	64 Å²	64	75.8 Å²	75.8	42%	0.416	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-59	132.3	174.8	-25	36.2	0	0	0	111.6	L17 C21 G86	L17-P84 HydrophobicContact CD1-CG 4.39Å; L17-P84 HydrophobicContact CG-CG 4.45Å; C21-P84 WeakPolarHBondContact SG-CB 3.48Å; C21-P84 WeakPolarHBondContact SG-CG 3.47Å; P84-G86 PolarHBondContact O-N 3.3Å
85	G	91.3	Very high	88.7	Confident	54 Å²	54	79.5 Å²	79.5	56%	0.557	45%	0.453	S	S	*	.	T	Hydrogen-bonded Turn	trans	70.8	6.2	178.9	0	0	0	0	0	115.2	R25 I83	R25-G85 VanDerWaalsContact O-CA 3.3Å; R25-G85 WeakPolarHBondContact O-CA 3.33Å; R25-G85 PolarHBondContact O-N 2.75Å; I83-G85 PolarHBondContact O-N 3.28Å
86	G	87.9	Confident	88.3	Confident	13 Å²	13	79.8 Å²	79.8	13%	0.134	46%	0.456	C	S	.	.			trans	-67.5	139.4	179.9	0	0	0	0	0	112.6	I83 P84	I83-G86 PolarHBondContact O-N 2.91Å; P84-G86 PolarHBondContact O-N 3.3Å
87	E	85.1	Confident	88	Confident	177 Å²	177	84.3 Å²	84.3	83%	0.827	48%	0.479	S	S	*	.			trans	-92.9	-1.6	179.5	-59.2	-168.1	156.5	0	0	113.1
88	G	84.2	Confident	87.6	Confident	18 Å²	18	81.9 Å²	81.9	19%	0.186	47%	0.468	C	S	.	.			trans	95.1	-177.5	-173.2	0	0	0	0	0	112.4	V37 E90	V37-G88 VanDerWaalsContact CG2-CA 3.46Å; G88-E90 PolarHBondContact O-N 3.27Å
89	P	83.1	Confident	87.2	Confident	40 Å²	40	83.4 Å²	83.4	26%	0.26	48%	0.478	S	S	.	.	S	Bend	trans	-66.3	126.9	177.9	-0.1	4.2	0	0	0	110.8	E35 R64 V91	E35-P89 WeakPolarHBondContact OE2-CG 3.45Å; R64-P89 PolarHBondContact NH1-O 3.11Å; R64-P89 VanDerWaalsContact NH2-CD 3.27Å; R64-P89 PolarHBondContact NH2-O 3.02Å; P89-V91 PolarHBondContact O-N 3.37Å
90	E	70.4	Confident	86.5	Confident	192 Å²	192	88.2 Å²	88.2	90%	0.897	51%	0.507	S	S	*	.			trans	-54.3	135.1	167.4	-67.3	-171.8	153.7	0	0	109	G88	G88-E90 PolarHBondContact O-N 3.27Å
91	V	58	Low	85.7	Confident	194 Å²	194	89 Å²	89	100%	1.176	51%	0.509	S	S	*	.			trans	-69.2	0	179.5	-98.4	0	0	0	0	112.1	P89	P89-V91 PolarHBondContact O-N 3.37Å

Retrieved 91 of 91 residues in 26.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).