A0A060WTS7_ONCMY Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB (A0A673YDA0), UniProt , Accession A0A060WTS7, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 70 aa.

						>A0A060WTS7_ONCMY|A0A060WTS7
MARDMSDIDILKMELEQLKKEVSTPREPVSKTSKDIMDWCEAASGTDLLITGVPDDKNPYKPEKGGCIIT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57	Low	79.7	Confident	207 Å²	207	113.5 Å²	113.5	100%	1.02	58%	0.583	S	S	*	*				0	-69.6	0	-63.4	-154.8	-160.6	0	0	111.4	D4	M1-D4 PolarHBondContact N-OD2 3.32Å
2	A	59.4	Low	80.9	Confident	70 Å²	70	113.8 Å²	113.8	58%	0.579	58%	0.578	S	S	*	*			trans	-82.3	-22.5	174.8	0	0	0	0	0	114.3	D4	A2-D4 VanDerWaalsContact C-N 3.35Å
3	R	61.6	Low	81.9	Confident	245 Å²	245	113.8 Å²	113.8	93%	0.925	58%	0.576	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.1	-10	-176.7	-70.1	-177.2	173	159.8	-1.9	114.8
4	D	77.7	Confident	82.8	Confident	138 Å²	138	113.4 Å²	113.4	74%	0.738	57%	0.571	S	S	*	*	T	Hydrogen-bonded Turn	trans	-103.1	3	-174.8	-49.1	-67.9	0	0	0	112.5	M1 A2	M1-D4 PolarHBondContact N-OD2 3.32Å; A2-D4 VanDerWaalsContact C-N 3.35Å
5	M	77.6	Confident	83.7	Confident	60 Å²	60	111.8 Å²	111.8	30%	0.296	56%	0.564	S	S	.	*	S	Bend	trans	-97	148.6	-178.1	-62.4	-169.8	-49.6	0	0	110.7	D9 I10 M13	M5-D9 HydrophobicContact CB-CB 4.4Å; M5-I10 HydrophobicContact CB-CD1 4.48Å; M5-I10 HydrophobicContact CB-CG1 3.97Å; M5-I10 HydrophobicContact CE-CG1 3.8Å; M5-M13 HydrophobicContact CE-CE 4.06Å; M5-M13 HydrophobicContact CE-SD 3.33Å; M5-M13 WeakPolarHBondContact CE-SD 3.39Å; M5-M13 HydrophobicContact SD-CE 4.46Å; M5-M13 HydrophobicContact SD-SD 3.5Å
6	S	87.9	Confident	84.4	Confident	53 Å²	53	110.8 Å²	110.8	37%	0.371	56%	0.557	S	S	.	*			trans	-67.6	151.5	173.7	76.2	0	0	0	0	110.7	I8 D9 I10	S6-I8 PolarHBondContact O-N 3.18Å; S6-I8 VanDerWaalsContact O-N 3.12Å; S6-I8 WeakPolarHBondContact OG-CG2 3.41Å; S6-D9 PolarHBondContact O-N 3.43Å; S6-D9 PolarHBondContact OG-N 3.12Å; S6-D9 PolarHBondContact OG-OD2 3.31Å; S6-I10 PolarHBondContact O-N 3.39Å; S6-I10 VanDerWaalsContact O-N 3.09Å
7	D	89	Confident	85.2	Confident	133 Å²	133	109.6 Å²	109.6	71%	0.711	55%	0.549	S	S	*	.	H	α-helix	trans	-54.8	-35.3	-179.4	-63.6	-24.1	0	0	0	112.2	D9 I10 L11	D7-D9 PolarHBondContact O-N 3.39Å; D7-I10 PolarHBondContact O-N 3.41Å; D7-L11 VanDerWaalsContact O-CG 3.27Å; D7-L11 WeakPolarHBondContact O-CG 3.42Å; D7-L11 PolarHBondContact O-N 2.76Å; D7-L11 VanDerWaalsContact O-N 3.08Å
8	I	91.2	Very high	85.8	Confident	105 Å²	105	108.5 Å²	108.5	54%	0.538	55%	0.545	S	S	.	.	H	α-helix	trans	-68.9	-32.6	177.8	-167.5	166.7	0	0	0	112.7	S6 K12	S6-I8 PolarHBondContact O-N 3.18Å; S6-I8 VanDerWaalsContact O-N 3.12Å; S6-I8 WeakPolarHBondContact OG-CG2 3.41Å; I8-K12 VanDerWaalsContact O-CG 3.3Å; I8-K12 WeakPolarHBondContact O-CG 3.37Å; I8-K12 PolarHBondContact O-N 3Å; I8-K12 VanDerWaalsContact O-N 3.09Å
9	D	90.8	Very high	86.4	Confident	68 Å²	68	108.7 Å²	108.7	36%	0.364	54%	0.542	S	S	.	.	H	α-helix	trans	-76.1	-36.9	178.5	-62.7	-38.4	0	0	0	111.1	M5 S6 D7 K12 M13	M5-D9 HydrophobicContact CB-CB 4.4Å; S6-D9 PolarHBondContact O-N 3.43Å; S6-D9 PolarHBondContact OG-N 3.12Å; S6-D9 PolarHBondContact OG-OD2 3.31Å; D7-D9 PolarHBondContact O-N 3.39Å; D9-K12 PolarHBondContact O-N 3.07Å; D9-M13 WeakPolarHBondContact O-CG 3.39Å; D9-M13 PolarHBondContact O-N 3.39Å
10	I	91.4	Very high	86.9	Confident	63 Å²	63	110.2 Å²	110.2	32%	0.323	55%	0.545	S	S	.	.	H	α-helix	trans	-59.4	-48.4	172.1	-64.4	170.4	0	0	0	110.1	M5 S6 D7 K12 M13 E14	M5-I10 HydrophobicContact CB-CD1 4.48Å; M5-I10 HydrophobicContact CB-CG1 3.97Å; M5-I10 HydrophobicContact CE-CG1 3.8Å; S6-I10 PolarHBondContact O-N 3.39Å; S6-I10 VanDerWaalsContact O-N 3.09Å; D7-I10 PolarHBondContact O-N 3.41Å; I10-K12 PolarHBondContact O-N 3.02Å; I10-M13 WeakPolarHBondContact O-CB 3.3Å; I10-M13 PolarHBondContact O-N 3.39Å; I10-E14 PolarHBondContact O-N 3.49Å
11	L	93.1	Very high	87.3	Confident	106 Å²	106	109.2 Å²	109.2	56%	0.555	54%	0.539	S	S	*	.	H	α-helix	trans	-64.1	-38.1	-179.9	-72	169.8	0	0	0	112.7	D7 E14 L15	D7-L11 VanDerWaalsContact O-CG 3.27Å; D7-L11 WeakPolarHBondContact O-CG 3.42Å; D7-L11 PolarHBondContact O-N 2.76Å; D7-L11 VanDerWaalsContact O-N 3.08Å; L11-E14 PolarHBondContact O-N 3.42Å; L11-L15 WeakPolarHBondContact O-CB 3.46Å; L11-L15 PolarHBondContact O-N 2.8Å
12	K	94.6	Very high	89.2	Confident	118 Å²	118	104.5 Å²	104.5	51%	0.513	52%	0.521	S	S	.	.	H	α-helix	trans	-63.7	-42.4	173.8	-75.9	170.1	-176.3	166.5	0	111.6	I8 D9 I10 L15 E16	I8-K12 VanDerWaalsContact O-CG 3.3Å; I8-K12 WeakPolarHBondContact O-CG 3.37Å; I8-K12 PolarHBondContact O-N 3Å; I8-K12 VanDerWaalsContact O-N 3.09Å; D9-K12 PolarHBondContact O-N 3.07Å; I10-K12 PolarHBondContact O-N 3.02Å; K12-L15 PolarHBondContact O-N 3.19Å; K12-E16 WeakPolarHBondContact O-CG 3.32Å; K12-E16 PolarHBondContact O-N 3.43Å
13	M	93.7	Very high	90.9	Very high	113 Å²	113	105.8 Å²	105.8	56%	0.557	53%	0.526	S	S	*	.	H	α-helix	trans	-63.7	-42.8	177.4	-73.9	178.3	62.3	0	0	112.1	M5 D9 I10 E16 Q17	M5-M13 HydrophobicContact CE-CE 4.06Å; M5-M13 HydrophobicContact CE-SD 3.33Å; M5-M13 WeakPolarHBondContact CE-SD 3.39Å; M5-M13 HydrophobicContact SD-CE 4.46Å; M5-M13 HydrophobicContact SD-SD 3.5Å; D9-M13 WeakPolarHBondContact O-CG 3.39Å; D9-M13 PolarHBondContact O-N 3.39Å; I10-M13 WeakPolarHBondContact O-CB 3.3Å; I10-M13 PolarHBondContact O-N 3.39Å; M13-E16 PolarHBondContact O-N 3.29Å; M13-Q17 PolarHBondContact O-N 3.46Å
14	E	94.1	Very high	92.5	Very high	108 Å²	108	97.7 Å²	97.7	51%	0.505	50%	0.504	S	S	.	.	H	α-helix	trans	-61.3	-44.8	175.3	-174.5	176.2	-177.5	0	0	111.4	I10 L11 E16 Q17 L18	I10-E14 PolarHBondContact O-N 3.49Å; L11-E14 PolarHBondContact O-N 3.42Å; E14-E16 VanDerWaalsContact C-N 3.35Å; E14-E16 PolarHBondContact O-N 3.44Å; E14-Q17 WeakPolarHBondContact O-CB 3.36Å; E14-Q17 PolarHBondContact O-N 3.41Å; E14-Q17 VanDerWaalsContact O-N 3.13Å; E14-L18 HydrophobicContact CG-CD1 4.2Å; E14-L18 HydrophobicContact CG-CG 4.49Å; E14-L18 WeakPolarHBondContact O-CG 3.45Å; E14-L18 PolarHBondContact O-N 3.26Å
15	L	96.1	Very high	93.4	Very high	90 Å²	90	97 Å²	97	47%	0.471	51%	0.507	S	S	.	.	H	α-helix	trans	-62	-42.6	178.8	-163.1	161.3	0	0	0	111.7	L11 K12 Q17 L18 K19	L11-L15 WeakPolarHBondContact O-CB 3.46Å; L11-L15 PolarHBondContact O-N 2.8Å; K12-L15 PolarHBondContact O-N 3.19Å; L15-Q17 VanDerWaalsContact C-N 3.33Å; L15-Q17 PolarHBondContact O-N 3.46Å; L15-L18 PolarHBondContact O-N 3.21Å; L15-K19 HydrophobicContact CD2-CD 3.83Å; L15-K19 HydrophobicContact CD2-CG 4.18Å; L15-K19 WeakPolarHBondContact O-CG 3.33Å; L15-K19 PolarHBondContact O-N 2.78Å
16	E	96.1	Very high	94.3	Very high	96 Å²	96	102.8 Å²	102.8	45%	0.449	53%	0.526	S	S	.	.	H	α-helix	trans	-64.3	-36.2	174.6	-71.5	-59.9	120.5	0	0	112.5	K12 M13 E14 K19 K20	K12-E16 WeakPolarHBondContact O-CG 3.32Å; K12-E16 PolarHBondContact O-N 3.43Å; M13-E16 PolarHBondContact O-N 3.29Å; E14-E16 VanDerWaalsContact C-N 3.35Å; E14-E16 PolarHBondContact O-N 3.44Å; E16-K19 IonicContact OE1-NZ 2.76Å; E16-K19 PolarHBondContact OE1-NZ 2.99Å; E16-K20 WeakPolarHBondContact O-CG 3.33Å; E16-K20 PolarHBondContact O-N 3.13Å
17	Q	96.7	Very high	94.7	Very high	90 Å²	90	105.6 Å²	105.6	42%	0.421	53%	0.533	S	S	.	.	H	α-helix	trans	-66.6	-46	174.2	-178.6	60.3	20.4	0	0	111.6	M13 E14 L15 K19 K20 E21	M13-Q17 PolarHBondContact O-N 3.46Å; E14-Q17 WeakPolarHBondContact O-CB 3.36Å; E14-Q17 PolarHBondContact O-N 3.41Å; E14-Q17 VanDerWaalsContact O-N 3.13Å; L15-Q17 VanDerWaalsContact C-N 3.33Å; L15-Q17 PolarHBondContact O-N 3.46Å; Q17-K19 VanDerWaalsContact C-N 3.33Å; Q17-K19 PolarHBondContact O-N 2.87Å; Q17-K20 WeakPolarHBondContact O-CB 3.49Å; Q17-K20 PolarHBondContact O-N 2.98Å; Q17-K20 VanDerWaalsContact O-N 3.07Å; Q17-E21 WeakPolarHBondContact CG-OE1 3.38Å; Q17-E21 PolarHBondContact NE2-OE1 2.98Å; Q17-E21 PolarHBondContact O-N 3.37Å
18	L	97.3	Very high	95.1	Very high	90 Å²	90	102.7 Å²	102.7	47%	0.471	52%	0.521	S	S	.	.	H	α-helix	trans	-61.1	-40.4	178.3	-70.5	172.6	0	0	0	112.1	E14 L15 K20 E21 V22	E14-L18 HydrophobicContact CG-CD1 4.2Å; E14-L18 HydrophobicContact CG-CG 4.49Å; E14-L18 WeakPolarHBondContact O-CG 3.45Å; E14-L18 PolarHBondContact O-N 3.26Å; L15-L18 PolarHBondContact O-N 3.21Å; L18-K20 VanDerWaalsContact C-N 3.27Å; L18-K20 PolarHBondContact O-N 3.36Å; L18-E21 PolarHBondContact O-N 2.98Å; L18-V22 WeakPolarHBondContact O-CG2 3.33Å; L18-V22 PolarHBondContact O-N 3.46Å
19	K	96.8	Very high	95.4	Very high	113 Å²	113	103 Å²	103	49%	0.491	53%	0.528	S	S	.	.	H	α-helix	trans	-58.5	-39.1	173.9	-77.6	172.9	176.8	163.1	0	112.5	L15 E16 Q17 S23	L15-K19 HydrophobicContact CD2-CD 3.83Å; L15-K19 HydrophobicContact CD2-CG 4.18Å; L15-K19 WeakPolarHBondContact O-CG 3.33Å; L15-K19 PolarHBondContact O-N 2.78Å; E16-K19 IonicContact OE1-NZ 2.76Å; E16-K19 PolarHBondContact OE1-NZ 2.99Å; Q17-K19 VanDerWaalsContact C-N 3.33Å; Q17-K19 PolarHBondContact O-N 2.87Å; K19-S23 PolarHBondContact O-OG 3.43Å
20	K	96.5	Very high	95.7	Very high	137 Å²	137	104.4 Å²	104.4	60%	0.596	54%	0.543	S	S	*	.	H	α-helix	trans	-67.4	-47.4	176	-68.8	172.5	-175.6	175.6	0	111	E16 Q17 L18 V22 S23 T24	E16-K20 WeakPolarHBondContact O-CG 3.33Å; E16-K20 PolarHBondContact O-N 3.13Å; Q17-K20 WeakPolarHBondContact O-CB 3.49Å; Q17-K20 PolarHBondContact O-N 2.98Å; Q17-K20 VanDerWaalsContact O-N 3.07Å; L18-K20 VanDerWaalsContact C-N 3.27Å; L18-K20 PolarHBondContact O-N 3.36Å; K20-V22 VanDerWaalsContact C-N 3.34Å; K20-V22 PolarHBondContact O-N 2.93Å; K20-S23 PolarHBondContact O-N 3.19Å; K20-S23 VanDerWaalsContact O-N 3.12Å; K20-T24 PolarHBondContact O-N 3.38Å; K20-T24 PolarHBondContact O-OG1 3.12Å
21	E	95.9	Very high	95.9	Very high	91 Å²	91	106.1 Å²	106.1	43%	0.425	55%	0.548	S	S	.	.	H	α-helix	trans	-66.5	-31.7	-177	-70.8	-179.8	-165	0	0	114.1	Q17 L18 S23 T24 R26	Q17-E21 WeakPolarHBondContact CG-OE1 3.38Å; Q17-E21 PolarHBondContact NE2-OE1 2.98Å; Q17-E21 PolarHBondContact O-N 3.37Å; L18-E21 PolarHBondContact O-N 2.98Å; E21-S23 PolarHBondContact O-N 3Å; E21-T24 WeakPolarHBondContact O-CB 3.16Å; E21-T24 PolarHBondContact O-N 3.09Å; E21-T24 PolarHBondContact O-OG1 3.09Å; E21-R26 PolarHBondContact O-NH2 2.99Å
22	V	96.8	Very high	96.1	Very high	108 Å²	108	103.5 Å²	103.5	66%	0.655	54%	0.536	S	S	*	.	H	α-helix	trans	-61.6	-39	173.3	167.3	0	0	0	0	110.7	L18 K20 T24 R26	L18-V22 WeakPolarHBondContact O-CG2 3.33Å; L18-V22 PolarHBondContact O-N 3.46Å; K20-V22 VanDerWaalsContact C-N 3.34Å; K20-V22 PolarHBondContact O-N 2.93Å; V22-T24 VanDerWaalsContact C-N 3.27Å; V22-T24 PolarHBondContact O-N 3.08Å; V22-R26 PolarHBondContact O-NH1 2.92Å
23	S	94.4	Very high	96.3	Very high	97 Å²	97	100.4 Å²	100.4	68%	0.678	53%	0.53	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.7	-6.6	-177.3	-53.9	0	0	0	0	113.7	K19 K20 E21	K19-S23 PolarHBondContact O-OG 3.43Å; K20-S23 PolarHBondContact O-N 3.19Å; K20-S23 VanDerWaalsContact O-N 3.12Å; E21-S23 PolarHBondContact O-N 3Å
24	T	95.6	Very high	96.4	Very high	75 Å²	75	100.8 Å²	100.8	46%	0.46	53%	0.528	S	S	.	.	S	Bend	trans	-67.1	123.5	178.6	-58	0	0	0	0	110.5	K20 E21 V22 R26	K20-T24 PolarHBondContact O-N 3.38Å; K20-T24 PolarHBondContact O-OG1 3.12Å; E21-T24 WeakPolarHBondContact O-CB 3.16Å; E21-T24 PolarHBondContact O-N 3.09Å; E21-T24 PolarHBondContact O-OG1 3.09Å; V22-T24 VanDerWaalsContact C-N 3.27Å; V22-T24 PolarHBondContact O-N 3.08Å; T24-R26 PolarHBondContact O-N 2.64Å; T24-R26 PolarHBondContact O-NH1 3.43Å
25	P	95.8	Very high	96.6	Very high	122 Å²	122	99.7 Å²	99.7	79%	0.792	53%	0.526	S	S	*	.			trans	-64.9	134.6	177	26.9	-33.4	0	0	0	110.2
26	R	95.9	Very high	96.7	Very high	183 Å²	183	100.5 Å²	100.5	69%	0.691	53%	0.529	S	S	*	.			trans	-108.7	137.8	179.9	-65.2	175.4	-177.5	72.9	4.9	109.5	E21 V22 T24	E21-R26 PolarHBondContact O-NH2 2.99Å; V22-R26 PolarHBondContact O-NH1 2.92Å; T24-R26 PolarHBondContact O-N 2.64Å; T24-R26 PolarHBondContact O-NH1 3.43Å
27	E	96.4	Very high	96.7	Very high	112 Å²	112	100.8 Å²	100.8	52%	0.523	53%	0.532	S	S	.	.			trans	-91.5	148.8	170.6	-75.3	-78	179.2	0	0	110	V29 K31 T32	E27-V29 PolarHBondContact O-N 3.15Å; E27-K31 VanDerWaalsContact CD-NZ 3.28Å; E27-K31 IonicContact OE1-NZ 3.19Å; E27-K31 PolarHBondContact OE1-NZ 2.99Å; E27-K31 WeakPolarHBondContact OE2-CD 3.27Å; E27-K31 IonicContact OE2-NZ 2.8Å; E27-K31 PolarHBondContact OE2-NZ 2.86Å; E27-T32 HydrophobicContact CB-CG2 3.8Å
28	P	97.6	Very high	96.7	Very high	72 Å²	72	100.2 Å²	100.2	47%	0.468	53%	0.532	S	S	.	.			trans	-59.8	133.7	175.6	-21.6	32.8	0	0	0	111.2	S30 K31 T32	P28-S30 PolarHBondContact O-N 3.31Å; P28-K31 HydrophobicContact CB-CB 4.36Å; P28-K31 WeakPolarHBondContact O-CB 3.47Å; P28-K31 PolarHBondContact O-N 3.49Å; P28-T32 PolarHBondContact O-N 3.36Å; P28-T32 VanDerWaalsContact O-N 3.15Å
29	V	97.2	Very high	96.7	Very high	111 Å²	111	104.7 Å²	104.7	67%	0.673	54%	0.543	S	S	*	.	H	α-helix	trans	-56.9	-37.6	178	179.2	0	0	0	0	111.2	E27 K31 T32 S33	E27-V29 PolarHBondContact O-N 3.15Å; V29-K31 VanDerWaalsContact C-N 3.27Å; V29-K31 PolarHBondContact O-N 3.5Å; V29-T32 PolarHBondContact O-N 3.21Å; V29-T32 PolarHBondContact O-OG1 3.41Å; V29-S33 VanDerWaalsContact O-CB 3.27Å; V29-S33 WeakPolarHBondContact O-CB 3.45Å; V29-S33 PolarHBondContact O-N 3.38Å; V29-S33 PolarHBondContact O-OG 3.15Å
30	S	97.1	Very high	96.7	Very high	98 Å²	98	102.2 Å²	102.2	69%	0.685	54%	0.539	S	S	*	.	H	α-helix	trans	-60.5	-34.8	177.3	52.3	0	0	0	0	113.5	P28 K34	P28-S30 PolarHBondContact O-N 3.31Å; S30-K34 PolarHBondContact O-N 2.98Å
31	K	97.1	Very high	96.6	Very high	98 Å²	98	102 Å²	102	43%	0.426	54%	0.54	S	S	.	.	H	α-helix	trans	-74	-51.2	177.1	179.4	-178.6	163.2	-163.8	0	110.4	E27 P28 V29 S33 K34 D35	E27-K31 VanDerWaalsContact CD-NZ 3.28Å; E27-K31 IonicContact OE1-NZ 3.19Å; E27-K31 PolarHBondContact OE1-NZ 2.99Å; E27-K31 WeakPolarHBondContact OE2-CD 3.27Å; E27-K31 IonicContact OE2-NZ 2.8Å; E27-K31 PolarHBondContact OE2-NZ 2.86Å; P28-K31 HydrophobicContact CB-CB 4.36Å; P28-K31 WeakPolarHBondContact O-CB 3.47Å; P28-K31 PolarHBondContact O-N 3.49Å; V29-K31 VanDerWaalsContact C-N 3.27Å; V29-K31 PolarHBondContact O-N 3.5Å; K31-S33 VanDerWaalsContact C-N 3.32Å; K31-S33 PolarHBondContact O-N 3.47Å; K31-K34 WeakPolarHBondContact O-CB 3.27Å; K31-K34 PolarHBondContact O-N 3.38Å; K31-K34 VanDerWaalsContact O-N 3.09Å; K31-D35 VanDerWaalsContact O-CG 3.32Å; K31-D35 PolarHBondContact O-N 3.09Å
32	T	97.2	Very high	96.6	Very high	51 Å²	51	101.6 Å²	101.6	31%	0.313	55%	0.552	S	S	.	*	H	α-helix	trans	-64.4	-37.1	-178.3	58.3	0	0	0	0	112.3	E27 P28 V29 K34 D35 I36	E27-T32 HydrophobicContact CB-CG2 3.8Å; P28-T32 PolarHBondContact O-N 3.36Å; P28-T32 VanDerWaalsContact O-N 3.15Å; V29-T32 PolarHBondContact O-N 3.21Å; V29-T32 PolarHBondContact O-OG1 3.41Å; T32-K34 VanDerWaalsContact C-N 3.32Å; T32-K34 PolarHBondContact O-N 3.29Å; T32-D35 PolarHBondContact O-N 3.4Å; T32-I36 WeakPolarHBondContact O-CB 3.37Å; T32-I36 WeakPolarHBondContact O-CD1 3.22Å; T32-I36 VanDerWaalsContact O-CG1 3.22Å; T32-I36 WeakPolarHBondContact O-CG1 3.44Å; T32-I36 PolarHBondContact O-N 3.07Å
33	S	97.3	Very high	96.4	Very high	54 Å²	54	98 Å²	98	38%	0.378	53%	0.534	S	S	.	.	H	α-helix	trans	-61.4	-41.1	173.2	-66.7	0	0	0	0	112	V29 K31 I36 M37	V29-S33 VanDerWaalsContact O-CB 3.27Å; V29-S33 WeakPolarHBondContact O-CB 3.45Å; V29-S33 PolarHBondContact O-N 3.38Å; V29-S33 PolarHBondContact O-OG 3.15Å; K31-S33 VanDerWaalsContact C-N 3.32Å; K31-S33 PolarHBondContact O-N 3.47Å; S33-I36 PolarHBondContact O-N 3.08Å; S33-M37 VanDerWaalsContact O-CG 3.29Å; S33-M37 WeakPolarHBondContact O-CG 3.5Å; S33-M37 PolarHBondContact O-N 3.29Å
34	K	97.6	Very high	96.2	Very high	120 Å²	120	95.6 Å²	95.6	52%	0.522	52%	0.517	S	S	.	.	H	α-helix	trans	-64.1	-48.4	176.3	-172.1	-178.9	176.7	-177.1	0	111.4	S30 K31 T32 I36 M37 D38	S30-K34 PolarHBondContact O-N 2.98Å; K31-K34 WeakPolarHBondContact O-CB 3.27Å; K31-K34 PolarHBondContact O-N 3.38Å; K31-K34 VanDerWaalsContact O-N 3.09Å; T32-K34 VanDerWaalsContact C-N 3.32Å; T32-K34 PolarHBondContact O-N 3.29Å; K34-I36 VanDerWaalsContact C-N 3.25Å; K34-I36 PolarHBondContact O-N 2.88Å; K34-M37 HydrophobicContact CB-CE 4.48Å; K34-M37 PolarHBondContact O-N 3.49Å; K34-M37 VanDerWaalsContact O-N 3.1Å; K34-D38 PolarHBondContact O-N 3.39Å
35	D	97.4	Very high	95.8	Very high	86 Å²	86	94.7 Å²	94.7	46%	0.46	52%	0.523	S	S	.	.	H	α-helix	trans	-58.6	-39.9	-180	-62.2	-20.4	0	0	0	111.5	K31 T32 W39	K31-D35 VanDerWaalsContact O-CG 3.32Å; K31-D35 PolarHBondContact O-N 3.09Å; T32-D35 PolarHBondContact O-N 3.4Å; D35-W39 WeakPolarHBondContact O-CB 3.35Å; D35-W39 PolarHBondContact O-N 2.71Å; D35-W39 VanDerWaalsContact O-N 3.07Å
36	I	97.4	Very high	95.4	Very high	106 Å²	106	94.3 Å²	94.3	54%	0.544	52%	0.519	S	S	.	.	H	α-helix	trans	-66.7	-44.6	176.2	-68.3	165	0	0	0	111.2	T32 S33 K34 W39 C40	T32-I36 WeakPolarHBondContact O-CB 3.37Å; T32-I36 WeakPolarHBondContact O-CD1 3.22Å; T32-I36 VanDerWaalsContact O-CG1 3.22Å; T32-I36 WeakPolarHBondContact O-CG1 3.44Å; T32-I36 PolarHBondContact O-N 3.07Å; S33-I36 PolarHBondContact O-N 3.08Å; K34-I36 VanDerWaalsContact C-N 3.25Å; K34-I36 PolarHBondContact O-N 2.88Å; I36-W39 PolarHBondContact O-N 3.32Å; I36-C40 WeakPolarHBondContact O-CB 3.38Å; I36-C40 PolarHBondContact O-N 3.1Å; I36-C40 PolarHBondContact O-SG 3Å; I36-C40 VanDerWaalsContact O-SG 3.32Å
37	M	96.7	Very high	95.1	Very high	103 Å²	103	88.8 Å²	88.8	51%	0.507	50%	0.503	S	S	.	.	H	α-helix	trans	-61.5	-49.8	178	-73.1	-176	-57.2	0	0	111.1	S33 K34 W39 C40 E41	S33-M37 VanDerWaalsContact O-CG 3.29Å; S33-M37 WeakPolarHBondContact O-CG 3.5Å; S33-M37 PolarHBondContact O-N 3.29Å; K34-M37 HydrophobicContact CB-CE 4.48Å; K34-M37 PolarHBondContact O-N 3.49Å; K34-M37 VanDerWaalsContact O-N 3.1Å; M37-W39 VanDerWaalsContact C-N 3.25Å; M37-W39 PolarHBondContact O-N 3.4Å; M37-C40 PolarHBondContact O-N 3.01Å; M37-C40 VanDerWaalsContact O-N 3.14Å; M37-E41 WeakPolarHBondContact O-CB 3.44Å; M37-E41 WeakPolarHBondContact O-CG 3.48Å; M37-E41 PolarHBondContact O-N 2.86Å
38	D	97.4	Very high	94.5	Very high	78 Å²	78	87.6 Å²	87.6	42%	0.417	50%	0.499	S	S	.	.	H	α-helix	trans	-58.5	-40.3	-180	-67.8	-8	0	0	0	110.8	K34 A42	K34-D38 PolarHBondContact O-N 3.39Å; D38-A42 WeakPolarHBondContact O-CB 3.29Å; D38-A42 PolarHBondContact O-N 2.84Å; D38-A42 VanDerWaalsContact O-N 3.08Å
39	W	96.8	Very high	94	Very high	183 Å²	183	91.8 Å²	91.8	69%	0.693	52%	0.517	S	S	*	.	H	α-helix	trans	-65.7	-47.5	175.6	-177	87.7	0	0	0	112.5	D35 I36 M37 E41 A42 A43	D35-W39 WeakPolarHBondContact O-CB 3.35Å; D35-W39 PolarHBondContact O-N 2.71Å; D35-W39 VanDerWaalsContact O-N 3.07Å; I36-W39 PolarHBondContact O-N 3.32Å; M37-W39 VanDerWaalsContact C-N 3.25Å; M37-W39 PolarHBondContact O-N 3.4Å; W39-E41 PolarHBondContact O-N 3.49Å; W39-A42 PolarHBondContact O-N 3.29Å; W39-A43 WeakPolarHBondContact O-CB 3.3Å; W39-A43 PolarHBondContact O-N 3.03Å
40	C	95.9	Very high	93.6	Very high	62 Å²	62	91.9 Å²	91.9	42%	0.419	51%	0.513	S	S	.	.	H	α-helix	trans	-61.6	-44.2	178.9	-75.5	0	0	0	0	111.5	I36 M37 A43 S44	I36-C40 WeakPolarHBondContact O-CB 3.38Å; I36-C40 PolarHBondContact O-N 3.1Å; I36-C40 PolarHBondContact O-SG 3Å; I36-C40 VanDerWaalsContact O-SG 3.32Å; M37-C40 PolarHBondContact O-N 3.01Å; M37-C40 VanDerWaalsContact O-N 3.14Å; C40-A43 PolarHBondContact O-N 2.86Å; C40-S44 VanDerWaalsContact O-CB 3.3Å; C40-S44 WeakPolarHBondContact O-CB 3.49Å; C40-S44 PolarHBondContact O-N 3.36Å
41	E	95.1	Very high	93.1	Very high	132 Å²	132	91.2 Å²	91.2	62%	0.617	50%	0.504	S	S	*	.	H	α-helix	trans	-62.3	-44.3	178.4	-72.9	180	-178.1	0	0	111.2	M37 W39 A43 S44	M37-E41 WeakPolarHBondContact O-CB 3.44Å; M37-E41 WeakPolarHBondContact O-CG 3.48Å; M37-E41 PolarHBondContact O-N 2.86Å; W39-E41 PolarHBondContact O-N 3.49Å; E41-A43 VanDerWaalsContact C-N 3.32Å; E41-A43 PolarHBondContact O-N 3.14Å; E41-S44 PolarHBondContact O-N 3.32Å; E41-S44 PolarHBondContact O-OG 2.94Å
42	A	95.2	Very high	92.3	Very high	82 Å²	82	88.6 Å²	88.6	68%	0.678	51%	0.506	S	S	*	.	H	α-helix	trans	-62.6	-36.4	177	0	0	0	0	0	113	D38 W39	D38-A42 WeakPolarHBondContact O-CB 3.29Å; D38-A42 PolarHBondContact O-N 2.84Å; D38-A42 VanDerWaalsContact O-N 3.08Å; W39-A42 PolarHBondContact O-N 3.29Å
43	A	92.6	Very high	91.6	Very high	32 Å²	32	88.5 Å²	88.5	26%	0.264	51%	0.505	S	S	.	.	H	α-helix	trans	-81.2	-26.2	178.9	0	0	0	0	0	113.4	W39 C40 E41 G45 T46 D47	W39-A43 WeakPolarHBondContact O-CB 3.3Å; W39-A43 PolarHBondContact O-N 3.03Å; C40-A43 PolarHBondContact O-N 2.86Å; E41-A43 VanDerWaalsContact C-N 3.32Å; E41-A43 PolarHBondContact O-N 3.14Å; A43-G45 VanDerWaalsContact C-N 3.28Å; A43-G45 PolarHBondContact O-N 3.38Å; A43-G45 VanDerWaalsContact O-N 3.17Å; A43-T46 PolarHBondContact O-N 3.23Å; A43-T46 PolarHBondContact O-OG1 3.3Å; A43-D47 PolarHBondContact O-N 2.94Å
44	S	90.8	Very high	90.9	Very high	47 Å²	47	88.5 Å²	88.5	33%	0.329	50%	0.504	S	S	.	.	H	α-helix	trans	-57.1	-35.8	-169.8	68.1	0	0	0	0	114.3	C40 E41 T46 D47	C40-S44 VanDerWaalsContact O-CB 3.3Å; C40-S44 WeakPolarHBondContact O-CB 3.49Å; C40-S44 PolarHBondContact O-N 3.36Å; E41-S44 PolarHBondContact O-N 3.32Å; E41-S44 PolarHBondContact O-OG 2.94Å; S44-T46 PolarHBondContact O-N 2.82Å; S44-D47 PolarHBondContact O-N 3.17Å
45	G	87.9	Confident	89.6	Confident	57 Å²	57	88.2 Å²	88.2	59%	0.588	51%	0.508	S	S	*	.	T	Hydrogen-bonded Turn	trans	-71.3	-14.6	178.6	0	0	0	0	0	114.4	A43	A43-G45 VanDerWaalsContact C-N 3.28Å; A43-G45 PolarHBondContact O-N 3.38Å; A43-G45 VanDerWaalsContact O-N 3.17Å
46	T	87.3	Confident	88.7	Confident	114 Å²	114	90 Å²	90	70%	0.699	52%	0.517	S	S	*	.	T	Hydrogen-bonded Turn	trans	-106.3	-10.2	177.8	62.4	0	0	0	0	113	A43 S44 L48	A43-T46 PolarHBondContact O-N 3.23Å; A43-T46 PolarHBondContact O-OG1 3.3Å; S44-T46 PolarHBondContact O-N 2.82Å; T46-L48 PolarHBondContact O-N 3.27Å
47	D	88.6	Confident	87.7	Confident	67 Å²	67	91.9 Å²	91.9	36%	0.358	52%	0.521	S	S	.	.			trans	-74.6	113.7	177.5	-169.1	-28.8	0	0	0	109.5	A43 S44 L49 I50 T51	A43-D47 PolarHBondContact O-N 2.94Å; S44-D47 PolarHBondContact O-N 3.17Å; D47-L49 PolarHBondContact O-N 2.78Å; D47-L49 WeakPolarHBondContact OD1-CB 3.16Å; D47-L49 PolarHBondContact OD1-N 3.15Å; D47-I50 HydrophobicContact CB-CB 4.13Å; D47-I50 HydrophobicContact CB-CD1 3.86Å; D47-I50 HydrophobicContact CB-CG1 3.93Å; D47-I50 PolarHBondContact O-N 3.35Å; D47-I50 VanDerWaalsContact O-N 3.15Å; D47-T51 PolarHBondContact O-N 2.82Å; D47-T51 PolarHBondContact O-OG1 3.28Å
48	L	85.2	Confident	86.8	Confident	86 Å²	86	89.1 Å²	89.1	45%	0.45	51%	0.509	S	S	.	.	H	α-helix	trans	-68.4	-21.6	-179.4	-59.1	174.1	0	0	0	112.7	T46 I50 G52 V53	T46-L48 PolarHBondContact O-N 3.27Å; L48-I50 VanDerWaalsContact C-N 3.32Å; L48-G52 CarbonylContact O-C 3.11Å; L48-G52 WeakPolarHBondContact O-CA 3.34Å; L48-G52 PolarHBondContact O-N 2.93Å; L48-V53 HydrophobicContact CB-CG2 3.79Å; L48-V53 PolarHBondContact O-N 2.89Å
49	L	87	Confident	85.8	Confident	161 Å²	161	90.7 Å²	90.7	84%	0.843	52%	0.523	S	S	*	.	H	α-helix	trans	-77.8	-22.4	174.8	-61.3	179.3	0	0	0	112	D47	D47-L49 PolarHBondContact O-N 2.78Å; D47-L49 WeakPolarHBondContact OD1-CB 3.16Å; D47-L49 PolarHBondContact OD1-N 3.15Å
50	I	87.5	Confident	84.8	Confident	113 Å²	113	89.6 Å²	89.6	58%	0.579	52%	0.52	S	S	*	.	H	α-helix	trans	-89.9	-46.1	175.2	-59.6	179.7	0	0	0	110.5	D47 L48	D47-I50 HydrophobicContact CB-CB 4.13Å; D47-I50 HydrophobicContact CB-CD1 3.86Å; D47-I50 HydrophobicContact CB-CG1 3.93Å; D47-I50 PolarHBondContact O-N 3.35Å; D47-I50 VanDerWaalsContact O-N 3.15Å; L48-I50 VanDerWaalsContact C-N 3.32Å
51	T	86.1	Confident	83.5	Confident	83 Å²	83	90.1 Å²	90.1	51%	0.509	52%	0.515	S	S	.	.	H	α-helix	trans	-86.8	-15.6	-175.2	55.3	0	0	0	0	114.3	D47	D47-T51 PolarHBondContact O-N 2.82Å; D47-T51 PolarHBondContact O-OG1 3.28Å
52	G	81.8	Confident	81.9	Confident	44 Å²	44	89.3 Å²	89.3	45%	0.454	52%	0.522	S	S	.	.			trans	93.5	134.7	-173.9	0	0	0	0	0	112	L48 P54	L48-G52 CarbonylContact O-C 3.11Å; L48-G52 WeakPolarHBondContact O-CA 3.34Å; L48-G52 PolarHBondContact O-N 2.93Å; G52-P54 WeakPolarHBondContact O-CD 3.4Å
53	V	81.9	Confident	80.2	Confident	49 Å²	49	94 Å²	94	30%	0.297	53%	0.53	S	S	.	.			trans	-82.4	120.5	176.5	-171	0	0	0	0	108.5	L48 N58	L48-V53 HydrophobicContact CB-CG2 3.79Å; L48-V53 PolarHBondContact O-N 2.89Å; V53-N58 HydrophobicContact CB-CB 4.38Å; V53-N58 HydrophobicContact CG1-CB 3.63Å
54	P	82.1	Confident	78.5	Confident	54 Å²	54	102.1 Å²	102.1	35%	0.351	56%	0.559	S	S	.	*			trans	-59.1	139.7	172.2	-22.7	33.9	0	0	0	110.7	G52 D56 K57 N58	G52-P54 WeakPolarHBondContact O-CD 3.4Å; P54-D56 VanDerWaalsContact C-N 3.32Å; P54-D56 VanDerWaalsContact CB-OD1 3.31Å; P54-D56 WeakPolarHBondContact CB-OD1 3.47Å; P54-D56 PolarHBondContact O-N 2.99Å; P54-K57 HydrophobicContact CG-CD 4.38Å; P54-K57 PolarHBondContact O-N 3.27Å; P54-N58 PolarHBondContact O-N 3.08Å
55	D	72	Confident	76.8	Confident	114 Å²	114	102.3 Å²	102.3	61%	0.61	57%	0.569	S	S	*	*	G	3₁₀ helix	trans	-51.7	-52.2	-175.8	-77.4	-43.3	0	0	0	111	K57 N58 K61	D55-K57 PolarHBondContact O-N 3.05Å; D55-K57 VanDerWaalsContact O-N 3.08Å; D55-N58 WeakPolarHBondContact O-CB 3.47Å; D55-N58 PolarHBondContact O-N 2.98Å; D55-K61 WeakPolarHBondContact O-CE 3.31Å
56	D	77.1	Confident	75.4	Confident	122 Å²	122	101.1 Å²	101.1	65%	0.652	56%	0.556	S	S	*	*	G	3₁₀ helix	trans	-55.8	-24.7	-179.9	60.6	-64.6	0	0	0	115.1	P54	P54-D56 VanDerWaalsContact C-N 3.32Å; P54-D56 VanDerWaalsContact CB-OD1 3.31Å; P54-D56 WeakPolarHBondContact CB-OD1 3.47Å; P54-D56 PolarHBondContact O-N 2.99Å
57	K	76.3	Confident	73.7	Confident	146 Å²	146	100.9 Å²	100.9	64%	0.635	56%	0.558	S	S	*	*	G	3₁₀ helix	trans	-101	-8.4	178.7	-60.1	-174.9	-176.4	176.4	0	113.1	P54 D55 P59	P54-K57 HydrophobicContact CG-CD 4.38Å; P54-K57 PolarHBondContact O-N 3.27Å; D55-K57 PolarHBondContact O-N 3.05Å; D55-K57 VanDerWaalsContact O-N 3.08Å; K57-P59 VanDerWaalsContact O-CD 3.24Å; K57-P59 WeakPolarHBondContact O-CD 2.66Å
58	N	77.4	Confident	72.1	Confident	46 Å²	46	104.1 Å²	104.1	25%	0.246	57%	0.574	C	S	.	*			trans	-79.8	112.8	-178.9	-169	-13.5	0	0	0	110.5	V53 P54 D55 Y60 K61	V53-N58 HydrophobicContact CB-CB 4.38Å; V53-N58 HydrophobicContact CG1-CB 3.63Å; P54-N58 PolarHBondContact O-N 3.08Å; D55-N58 WeakPolarHBondContact O-CB 3.47Å; D55-N58 PolarHBondContact O-N 2.98Å; N58-Y60 PolarHBondContact O-N 2.95Å; N58-Y60 VanDerWaalsContact O-N 3.14Å; N58-Y60 WeakPolarHBondContact OD1-CB 3.24Å; N58-Y60 PolarHBondContact OD1-N 3.14Å; N58-K61 PolarHBondContact O-N 3.49Å
59	P	78.2	Confident	70.5	Confident	111 Å²	111	108 Å²	108	72%	0.721	59%	0.593	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.3	-13.7	177.8	27.4	-33.4	0	0	0	113.3	K57	K57-P59 VanDerWaalsContact O-CD 3.24Å; K57-P59 WeakPolarHBondContact O-CD 2.66Å
60	Y	74.7	Confident	68.6	Low	160 Å²	160	109 Å²	109	63%	0.627	61%	0.606	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.4	23.3	-177	-58.7	-76	0	0	0	114.4	N58	N58-Y60 PolarHBondContact O-N 2.95Å; N58-Y60 VanDerWaalsContact O-N 3.14Å; N58-Y60 WeakPolarHBondContact OD1-CB 3.24Å; N58-Y60 PolarHBondContact OD1-N 3.14Å
61	K	68.9	Low	67.7	Low	72 Å²	72	108.9 Å²	108.9	31%	0.313	61%	0.608	S	S	.	*			trans	-51.1	137.5	175.8	-82.6	-163.3	-173.2	-165	0	112.3	D55 N58 E63 K64	D55-K61 WeakPolarHBondContact O-CE 3.31Å; N58-K61 PolarHBondContact O-N 3.49Å; K61-E63 VanDerWaalsContact C-N 3.27Å; K61-E63 PolarHBondContact O-N 3.22Å; K61-K64 PolarHBondContact O-N 3.29Å
62	P	61.3	Low	66.7	Low	116 Å²	116	110.2 Å²	110.2	75%	0.753	61%	0.613	S	S	*	*	G	3₁₀ helix	trans	-63.9	-25.8	-177.5	21.9	-31.1	0	0	0	114.2	K64 G65	P62-K64 PolarHBondContact O-N 3.23Å; P62-G65 PolarHBondContact O-N 3.18Å
63	E	60.3	Low	65.9	Low	181 Å²	181	113.9 Å²	113.9	85%	0.846	62%	0.622	S	S	*	*	G	3₁₀ helix	trans	-66.6	-14.7	179.7	-67.5	-172.1	124.6	0	0	114.5	K61	K61-E63 VanDerWaalsContact C-N 3.27Å; K61-E63 PolarHBondContact O-N 3.22Å
64	K	57	Low	64.9	Low	201 Å²	201	117.7 Å²	117.7	87%	0.874	64%	0.641	S	S	*	*	G	3₁₀ helix	trans	-113.4	13.7	175.5	-69.9	-163	177.1	-176.5	0	114.5	K61 P62	K61-K64 PolarHBondContact O-N 3.29Å; P62-K64 PolarHBondContact O-N 3.23Å
65	G	53.7	Low	63.9	Low	52 Å²	52	121.7 Å²	121.7	54%	0.536	66%	0.659	S	S	.	*			trans	81.8	98.1	-175.7	0	0	0	0	0	110.6	P62	P62-G65 PolarHBondContact O-N 3.18Å
66	G	59.3	Low	63.3	Low	31 Å²	31	122.2 Å²	122.2	32%	0.32	66%	0.662	S	S	.	*			trans	-59.1	169.6	166.6	0	0	0	0	0	111.4	I68	G66-I68 VanDerWaalsContact O-CG1 3.24Å; G66-I68 WeakPolarHBondContact O-CG1 3.24Å; G66-I68 PolarHBondContact O-N 2.88Å
67	C	52.1	Low	62.3	Low	110 Å²	110	122.2 Å²	122.2	74%	0.743	66%	0.663	S	S	*	*			trans	-57.4	104.2	178.5	-166.6	0	0	0	0	110.3
68	I	54.1	Low	61.3	Low	135 Å²	135	120.4 Å²	120.4	69%	0.692	67%	0.665	S	S	*	*			trans	-89	109.6	172.8	-29.2	176.6	0	0	0	105.5	G66 T70	G66-I68 VanDerWaalsContact O-CG1 3.24Å; G66-I68 WeakPolarHBondContact O-CG1 3.24Å; G66-I68 PolarHBondContact O-N 2.88Å; I68-T70 VanDerWaalsContact C-N 3.27Å; I68-T70 WeakPolarHBondContact CG2-OG1 3.44Å; I68-T70 PolarHBondContact O-N 3.01Å
69	I	52.3	Low	59.9	Low	168 Å²	168	126.6 Å²	126.6	86%	0.862	70%	0.7	S	S	*	*			trans	-73.3	94.2	164.3	-55.4	177.3	0	0	0	105.2
70	T	47.2	Very low	58.3	Low	182 Å²	182	128 Å²	128	100%	1.117	70%	0.698	S	S	*	*			trans	-109.4	0	165.7	-37.3	0	0	0	0	108.7	I68	I68-T70 VanDerWaalsContact C-N 3.27Å; I68-T70 WeakPolarHBondContact CG2-OG1 3.44Å; I68-T70 PolarHBondContact O-N 3.01Å

Retrieved 70 of 70 residues in 115.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).