A0A060WV07_ONCMY Loading...

Immediate early response 3-interacting protein 1

Regulator of endoplasmic reticulum secretion that acts as a key determinant of brain size. Required for secretion of extracellular matrix proteins. Required for correct brain development by depositing sufficient extracellular matrix proteins for tissue integrity and the proliferation of neural progenitors. Acts as a regulator of the unfolded protein response (UPR).

AlphaFold DB (B5XBB7), UniProt , Accession A0A060WV07, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 82 aa.

						>A0A060WV07_ONCMY|A0A060WV07
MAFTLYSLIQAVILCVNAVAVLHEDRFLSKIGWGVDQSVGGFGDEPGIKVQLMNLVRSVRTVMRVPLIAVNSVCIVLLLLFG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.5	Very low	66.8	Low	224 Å²	224	114.5 Å²	114.5	100%	1.103	61%	0.606	S	S	*	*				0	39	0	-61	-171.8	-178	0	0	112.3	T4	M1-T4 PolarHBondContact O-OG1 3.35Å
2	A	56.7	Low	67.3	Low	74 Å²	74	111.8 Å²	111.8	61%	0.612	60%	0.597	S	S	*	*			trans	-98	-20.9	176.4	0	0	0	0	0	112.6	T4 L5 Y6	A2-T4 VanDerWaalsContact C-N 3.29Å; A2-T4 PolarHBondContact O-N 3.44Å; A2-L5 PolarHBondContact O-N 2.81Å; A2-Y6 PolarHBondContact O-N 3.26Å
3	F	58.2	Low	67	Low	179 Å²	179	110.3 Å²	110.3	79%	0.785	59%	0.588	S	S	*	*	H	α-helix	trans	-63.8	-31	178.2	-98.4	-87.7	0	0	0	113.4	S7	F3-S7 WeakPolarHBondContact O-CB 3.44Å; F3-S7 PolarHBondContact O-N 2.92Å; F3-S7 PolarHBondContact O-OG 3.28Å; F3-S7 VanDerWaalsContact O-OG 3.06Å
4	T	66.9	Low	67.2	Low	92 Å²	92	110.4 Å²	110.4	56%	0.564	59%	0.587	S	S	*	*	H	α-helix	trans	-69.5	-39.9	178.3	36.9	0	0	0	0	112.6	M1 A2 S7 L8	M1-T4 PolarHBondContact O-OG1 3.35Å; A2-T4 VanDerWaalsContact C-N 3.29Å; A2-T4 PolarHBondContact O-N 3.44Å; T4-S7 WeakPolarHBondContact CA-OG 3.39Å; T4-S7 PolarHBondContact O-OG 2.96Å; T4-L8 VanDerWaalsContact O-CB 3.27Å; T4-L8 WeakPolarHBondContact O-CB 3.35Å; T4-L8 PolarHBondContact O-N 2.96Å
5	L	68.2	Low	67	Low	115 Å²	115	108.4 Å²	108.4	60%	0.602	59%	0.585	S	S	*	*	H	α-helix	trans	-67.9	-41.9	175.4	-69.1	172.9	0	0	0	111.2	A2 L8 I9	A2-L5 PolarHBondContact O-N 2.81Å; L5-L8 PolarHBondContact O-N 3.39Å; L5-I9 WeakPolarHBondContact O-CG1 3.48Å; L5-I9 PolarHBondContact O-N 2.94Å
6	Y	72.6	Confident	66.7	Low	152 Å²	152	107.8 Å²	107.8	60%	0.596	59%	0.585	S	S	*	*	H	α-helix	trans	-61.2	-46.2	175.1	-176	-99	0	0	0	111.9	A2 L8 I9 Q10	A2-Y6 PolarHBondContact O-N 3.26Å; Y6-L8 VanDerWaalsContact C-N 3.27Å; Y6-L8 PolarHBondContact O-N 3.37Å; Y6-I9 PolarHBondContact O-N 3.01Å; Y6-Q10 WeakPolarHBondContact O-CB 3.35Å; Y6-Q10 PolarHBondContact O-N 3.25Å
7	S	71.8	Confident	66.6	Low	61 Å²	61	106.7 Å²	106.7	43%	0.427	58%	0.579	S	S	.	*	H	α-helix	trans	-64.8	-30.2	175.2	58.2	0	0	0	0	113.1	F3 T4 A11	F3-S7 WeakPolarHBondContact O-CB 3.44Å; F3-S7 PolarHBondContact O-N 2.92Å; F3-S7 PolarHBondContact O-OG 3.28Å; F3-S7 VanDerWaalsContact O-OG 3.06Å; T4-S7 WeakPolarHBondContact CA-OG 3.39Å; T4-S7 PolarHBondContact O-OG 2.96Å; S7-A11 VanDerWaalsContact O-CB 3.24Å; S7-A11 WeakPolarHBondContact O-CB 3.25Å; S7-A11 PolarHBondContact O-N 3.1Å
8	L	76.3	Confident	66.2	Low	109 Å²	109	103.4 Å²	103.4	57%	0.571	57%	0.568	S	S	*	*	H	α-helix	trans	-74.3	-42.5	179.4	-167.1	137.4	0	0	0	111.2	T4 L5 Y6 Q10 A11 V12	T4-L8 VanDerWaalsContact O-CB 3.27Å; T4-L8 WeakPolarHBondContact O-CB 3.35Å; T4-L8 PolarHBondContact O-N 2.96Å; L5-L8 PolarHBondContact O-N 3.39Å; Y6-L8 VanDerWaalsContact C-N 3.27Å; Y6-L8 PolarHBondContact O-N 3.37Å; L8-Q10 VanDerWaalsContact C-N 3.34Å; L8-A11 PolarHBondContact O-N 3.41Å; L8-V12 HydrophobicContact CD2-CG2 4.44Å; L8-V12 VanDerWaalsContact O-CG2 3.26Å; L8-V12 WeakPolarHBondContact O-CG2 3.4Å; L8-V12 PolarHBondContact O-N 2.81Å
9	I	70.8	Confident	65.8	Low	106 Å²	106	103.1 Å²	103.1	54%	0.544	57%	0.57	S	S	.	*	H	α-helix	trans	-61.5	-44.9	171.5	-67.2	172.8	0	0	0	110.1	L5 Y6 A11 V12 I13	L5-I9 WeakPolarHBondContact O-CG1 3.48Å; L5-I9 PolarHBondContact O-N 2.94Å; Y6-I9 PolarHBondContact O-N 3.01Å; I9-A11 VanDerWaalsContact C-N 3.34Å; I9-A11 PolarHBondContact O-N 3.45Å; I9-V12 PolarHBondContact O-N 3.22Å; I9-I13 HydrophobicContact CG2-CD1 3.83Å; I9-I13 VanDerWaalsContact O-CG1 3.28Å; I9-I13 WeakPolarHBondContact O-CG1 3.29Å; I9-I13 PolarHBondContact O-N 3.45Å
10	Q	71.3	Confident	65.3	Low	99 Å²	99	100.4 Å²	100.4	46%	0.463	56%	0.562	S	S	.	*	H	α-helix	trans	-61.8	-39.6	176.7	-165.9	174.7	27.2	0	0	112.6	Y6 L8 I13 L14	Y6-Q10 WeakPolarHBondContact O-CB 3.35Å; Y6-Q10 PolarHBondContact O-N 3.25Å; L8-Q10 VanDerWaalsContact C-N 3.34Å; Q10-I13 PolarHBondContact O-N 3.42Å; Q10-L14 HydrophobicContact CG-CD1 4.43Å; Q10-L14 WeakPolarHBondContact O-CB 3.45Å; Q10-L14 PolarHBondContact O-N 3.39Å
11	A	72.5	Confident	64.7	Low	49 Å²	49	98.6 Å²	98.6	41%	0.405	55%	0.553	S	S	.	*	H	α-helix	trans	-67.5	-39.5	175.3	0	0	0	0	0	112.4	S7 L8 I9 L14 C15	S7-A11 VanDerWaalsContact O-CB 3.24Å; S7-A11 WeakPolarHBondContact O-CB 3.25Å; S7-A11 PolarHBondContact O-N 3.1Å; L8-A11 PolarHBondContact O-N 3.41Å; I9-A11 VanDerWaalsContact C-N 3.34Å; I9-A11 PolarHBondContact O-N 3.45Å; A11-L14 PolarHBondContact O-N 3.27Å; A11-C15 WeakPolarHBondContact O-CB 3.39Å; A11-C15 PolarHBondContact O-N 3.09Å; A11-C15 PolarHBondContact O-SG 2.88Å
12	V	72.6	Confident	65.1	Low	82 Å²	82	92.6 Å²	92.6	50%	0.497	53%	0.525	S	S	.	.	H	α-helix	trans	-63.8	-43.2	175.3	170.6	0	0	0	0	110.6	L8 I9 C15 V16	L8-V12 HydrophobicContact CD2-CG2 4.44Å; L8-V12 VanDerWaalsContact O-CG2 3.26Å; L8-V12 WeakPolarHBondContact O-CG2 3.4Å; L8-V12 PolarHBondContact O-N 2.81Å; I9-V12 PolarHBondContact O-N 3.22Å; V12-C15 PolarHBondContact O-N 3.16Å; V12-V16 VanDerWaalsContact O-CG2 3.31Å; V12-V16 WeakPolarHBondContact O-CG2 3.3Å; V12-V16 PolarHBondContact O-N 2.66Å
13	I	63.9	Low	64.8	Low	92 Å²	92	94.8 Å²	94.8	47%	0.472	52%	0.522	S	S	.	.	H	α-helix	trans	-60.9	-45.7	175.6	-68	164.7	0	0	0	111.1	I9 Q10 V16 N17	I9-I13 HydrophobicContact CG2-CD1 3.83Å; I9-I13 VanDerWaalsContact O-CG1 3.28Å; I9-I13 WeakPolarHBondContact O-CG1 3.29Å; I9-I13 PolarHBondContact O-N 3.45Å; Q10-I13 PolarHBondContact O-N 3.42Å; I13-V16 PolarHBondContact O-N 3.28Å; I13-N17 WeakPolarHBondContact O-CB 3.48Å; I13-N17 PolarHBondContact O-N 3.42Å
14	L	69.7	Low	64.4	Low	111 Å²	111	89.4 Å²	89.4	58%	0.581	50%	0.5	S	S	*	.	H	α-helix	trans	-64.9	-39.6	176.2	-81.4	161.8	0	0	0	112.7	Q10 A11 N17 A18	Q10-L14 HydrophobicContact CG-CD1 4.43Å; Q10-L14 WeakPolarHBondContact O-CB 3.45Å; Q10-L14 PolarHBondContact O-N 3.39Å; A11-L14 PolarHBondContact O-N 3.27Å; L14-N17 PolarHBondContact O-N 3.24Å; L14-A18 WeakPolarHBondContact O-CB 3.46Å; L14-A18 PolarHBondContact O-N 3.09Å
15	C	64.6	Low	63.6	Low	81 Å²	81	89.7 Å²	89.7	55%	0.547	50%	0.498	S	S	.	.	H	α-helix	trans	-63.5	-44.1	176	-86.9	0	0	0	0	111.9	A11 V12 N17 A18 V19	A11-C15 WeakPolarHBondContact O-CB 3.39Å; A11-C15 PolarHBondContact O-N 3.09Å; A11-C15 PolarHBondContact O-SG 2.88Å; V12-C15 PolarHBondContact O-N 3.16Å; C15-N17 VanDerWaalsContact C-N 3.33Å; C15-A18 PolarHBondContact O-N 2.9Å; C15-V19 WeakPolarHBondContact O-CB 3.28Å; C15-V19 VanDerWaalsContact O-CG2 3.24Å; C15-V19 WeakPolarHBondContact O-CG2 3.45Å; C15-V19 PolarHBondContact O-N 2.86Å
16	V	62.3	Low	62.8	Low	98 Å²	98	93.3 Å²	93.3	59%	0.594	50%	0.503	S	S	*	.	H	α-helix	trans	-64.3	-40.9	176.9	173.9	0	0	0	0	110.7	V12 I13 V19 A20	V12-V16 VanDerWaalsContact O-CG2 3.31Å; V12-V16 WeakPolarHBondContact O-CG2 3.3Å; V12-V16 PolarHBondContact O-N 2.66Å; I13-V16 PolarHBondContact O-N 3.28Å; V16-V19 PolarHBondContact O-N 3.39Å; V16-A20 WeakPolarHBondContact O-CB 2.77Å; V16-A20 PolarHBondContact O-N 3.43Å
17	N	65.1	Low	61.5	Low	90 Å²	90	91.8 Å²	91.8	48%	0.481	50%	0.5	S	S	.	.	H	α-helix	trans	-61.4	-46.6	175	-170.6	-71	0	0	0	112	I13 L14 C15 V19 A20 V21	I13-N17 WeakPolarHBondContact O-CB 3.48Å; I13-N17 PolarHBondContact O-N 3.42Å; L14-N17 PolarHBondContact O-N 3.24Å; C15-N17 VanDerWaalsContact C-N 3.33Å; N17-V19 PolarHBondContact O-N 2.92Å; N17-A20 WeakPolarHBondContact O-CB 3.47Å; N17-A20 PolarHBondContact O-N 3.49Å; N17-V21 WeakPolarHBondContact O-CG2 3.43Å; N17-V21 PolarHBondContact O-N 3.47Å
18	A	59.3	Low	60.3	Low	47 Å²	47	94.2 Å²	94.2	39%	0.388	51%	0.507	S	S	.	.	H	α-helix	trans	-66.2	-37.7	178.4	0	0	0	0	0	113	L14 C15 A20 V21 L22	L14-A18 WeakPolarHBondContact O-CB 3.46Å; L14-A18 PolarHBondContact O-N 3.09Å; C15-A18 PolarHBondContact O-N 2.9Å; A18-A20 VanDerWaalsContact C-N 3.34Å; A18-V21 PolarHBondContact O-N 3.4Å; A18-L22 WeakPolarHBondContact O-CB 3.45Å; A18-L22 WeakPolarHBondContact O-CG 3.28Å; A18-L22 PolarHBondContact O-N 2.53Å
19	V	57.5	Low	58.8	Low	98 Å²	98	93.8 Å²	93.8	59%	0.594	51%	0.514	S	S	*	.	H	α-helix	trans	-66.3	-37.5	174.6	171	0	0	0	0	110.9	C15 V16 N17 H23	C15-V19 WeakPolarHBondContact O-CB 3.28Å; C15-V19 VanDerWaalsContact O-CG2 3.24Å; C15-V19 WeakPolarHBondContact O-CG2 3.45Å; C15-V19 PolarHBondContact O-N 2.86Å; V16-V19 PolarHBondContact O-N 3.39Å; N17-V19 PolarHBondContact O-N 2.92Å; V19-H23 VanDerWaalsContact O-CB 3.28Å; V19-H23 WeakPolarHBondContact O-CB 3.44Å; V19-H23 PolarHBondContact O-N 3.28Å
20	A	55.7	Low	57.6	Low	49 Å²	49	97.5 Å²	97.5	41%	0.405	53%	0.526	S	S	.	.	H	α-helix	trans	-64.1	-46.6	174.6	0	0	0	0	0	111.9	V16 N17 A18 H23 E24	V16-A20 WeakPolarHBondContact O-CB 2.77Å; V16-A20 PolarHBondContact O-N 3.43Å; N17-A20 WeakPolarHBondContact O-CB 3.47Å; N17-A20 PolarHBondContact O-N 3.49Å; A18-A20 VanDerWaalsContact C-N 3.34Å; A20-H23 PolarHBondContact O-N 3.43Å; A20-E24 PolarHBondContact O-N 2.94Å
21	V	54.3	Low	56.5	Low	63 Å²	63	98.6 Å²	98.6	38%	0.382	53%	0.534	S	S	.	.	H	α-helix	trans	-63	-44.9	175.9	169.9	0	0	0	0	111.7	N17 A18 H23 E24 D25	N17-V21 WeakPolarHBondContact O-CG2 3.43Å; N17-V21 PolarHBondContact O-N 3.47Å; A18-V21 PolarHBondContact O-N 3.4Å; V21-H23 VanDerWaalsContact C-N 3.28Å; V21-H23 PolarHBondContact O-N 2.82Å; V21-E24 WeakPolarHBondContact O-CB 3.23Å; V21-E24 PolarHBondContact O-N 3.32Å; V21-E24 VanDerWaalsContact O-N 3.16Å; V21-D25 PolarHBondContact O-N 3.45Å
22	L	57.9	Low	55.4	Low	98 Å²	98	99 Å²	99	51%	0.513	54%	0.543	S	S	.	.	H	α-helix	trans	-65.1	-31.5	176.5	-79.9	166.7	0	0	0	112.7	A18 R26	A18-L22 WeakPolarHBondContact O-CB 3.45Å; A18-L22 WeakPolarHBondContact O-CG 3.28Å; A18-L22 PolarHBondContact O-N 2.53Å; L22-R26 WeakPolarHBondContact O-CB 3.36Å; L22-R26 PolarHBondContact O-N 3.47Å; L22-R26 VanDerWaalsContact O-N 3.1Å
23	H	50.4	Low	54.1	Low	119 Å²	119	107.7 Å²	107.7	55%	0.551	57%	0.567	S	S	*	*	H	α-helix	trans	-71.8	-38.2	173.8	-166.8	-89.5	0	0	0	110.6	V19 A20 V21 F27	V19-H23 VanDerWaalsContact O-CB 3.28Å; V19-H23 WeakPolarHBondContact O-CB 3.44Å; V19-H23 PolarHBondContact O-N 3.28Å; A20-H23 PolarHBondContact O-N 3.43Å; V21-H23 VanDerWaalsContact C-N 3.28Å; V21-H23 PolarHBondContact O-N 2.82Å; H23-F27 AromaticContact CE1-CD2 3.63Å; H23-F27 WeakPolarHBondContact O-CB 3.22Å; H23-F27 PolarHBondContact O-N 3.45Å
24	E	48.8	Very low	53.1	Low	67 Å²	67	106.5 Å²	106.5	31%	0.313	58%	0.577	S	S	.	*	H	α-helix	trans	-59.9	-50	170.4	-77.2	178.1	135.3	0	0	112.1	A20 V21 R26 F27 L28	A20-E24 PolarHBondContact O-N 2.94Å; V21-E24 WeakPolarHBondContact O-CB 3.23Å; V21-E24 PolarHBondContact O-N 3.32Å; V21-E24 VanDerWaalsContact O-N 3.16Å; E24-R26 VanDerWaalsContact C-N 3.34Å; E24-R26 PolarHBondContact O-N 3.42Å; E24-F27 PolarHBondContact O-N 2.94Å; E24-L28 HydrophobicContact CB-CD1 4.31Å; E24-L28 WeakPolarHBondContact O-CB 3.36Å; E24-L28 WeakPolarHBondContact O-CD1 3.23Å; E24-L28 VanDerWaalsContact O-CG 3.23Å; E24-L28 WeakPolarHBondContact O-CG 3.41Å; E24-L28 PolarHBondContact O-N 2.88Å
25	D	49.8	Very low	51.7	Low	98 Å²	98	108.1 Å²	108.1	52%	0.524	59%	0.591	S	S	.	*	H	α-helix	trans	-61.4	-40.4	179.4	-80.6	-51.9	0	0	0	112.3	V21 S29	V21-D25 PolarHBondContact O-N 3.45Å; D25-S29 WeakPolarHBondContact O-CB 3.44Å; D25-S29 PolarHBondContact O-N 3.31Å
26	R	51.8	Low	50.6	Low	190 Å²	190	109.6 Å²	109.6	72%	0.717	59%	0.594	S	S	*	*	H	α-helix	trans	-77.6	-25.4	-179.8	-132.8	-171.1	-65.4	-136.3	4.2	113.3	L22 E24 K30	L22-R26 WeakPolarHBondContact O-CB 3.36Å; L22-R26 PolarHBondContact O-N 3.47Å; L22-R26 VanDerWaalsContact O-N 3.1Å; E24-R26 VanDerWaalsContact C-N 3.34Å; E24-R26 PolarHBondContact O-N 3.42Å; R26-K30 WeakPolarHBondContact O-CB 3.18Å
27	F	44.3	Very low	50	Low	121 Å²	121	115 Å²	115	53%	0.531	61%	0.612	S	S	.	*	H	α-helix	trans	-84.9	-36.4	175.4	-134.9	-96.7	0	0	0	111.9	H23 E24 K30 I31	H23-F27 AromaticContact CE1-CD2 3.63Å; H23-F27 WeakPolarHBondContact O-CB 3.22Å; H23-F27 PolarHBondContact O-N 3.45Å; E24-F27 PolarHBondContact O-N 2.94Å; F27-K30 PolarHBondContact O-N 2.86Å; F27-I31 HydrophobicContact CD1-CD1 3.92Å; F27-I31 HydrophobicContact CE1-CD1 4.22Å; F27-I31 PolarHBondContact O-N 3.47Å
28	L	47.3	Very low	48.9	Very low	111 Å²	111	114.4 Å²	114.4	58%	0.581	62%	0.615	S	S	*	*	H	α-helix	trans	-70.4	-40	174.2	-74.3	163.5	0	0	0	112	E24 K30 I31	E24-L28 HydrophobicContact CB-CD1 4.31Å; E24-L28 WeakPolarHBondContact O-CB 3.36Å; E24-L28 WeakPolarHBondContact O-CD1 3.23Å; E24-L28 VanDerWaalsContact O-CG 3.23Å; E24-L28 WeakPolarHBondContact O-CG 3.41Å; E24-L28 PolarHBondContact O-N 2.88Å; L28-K30 PolarHBondContact O-N 3.26Å; L28-I31 PolarHBondContact O-N 3.32Å
29	S	45.7	Very low	47.9	Very low	101 Å²	101	119.1 Å²	119.1	71%	0.706	64%	0.639	S	S	*	*	H	α-helix	trans	-64.9	-28.3	174.4	176	0	0	0	0	112.7	D25	D25-S29 WeakPolarHBondContact O-CB 3.44Å; D25-S29 PolarHBondContact O-N 3.31Å
30	K	44.3	Very low	46.9	Very low	183 Å²	183	117.6 Å²	117.6	80%	0.796	64%	0.644	S	S	*	*	H	α-helix	trans	-84.6	-14	178.5	-161.5	169.4	-178.1	-175.4	0	113.6	R26 F27 L28 G32	R26-K30 WeakPolarHBondContact O-CB 3.18Å; F27-K30 PolarHBondContact O-N 2.86Å; L28-K30 PolarHBondContact O-N 3.26Å; K30-G32 VanDerWaalsContact C-N 3.25Å; K30-G32 PolarHBondContact O-N 3.29Å
31	I	48.3	Very low	46.7	Very low	123 Å²	123	118.8 Å²	118.8	63%	0.631	66%	0.66	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.6	41.2	177	-73	169.4	0	0	0	111.3	F27 L28	F27-I31 HydrophobicContact CD1-CD1 3.92Å; F27-I31 HydrophobicContact CE1-CD1 4.22Å; F27-I31 PolarHBondContact O-N 3.47Å; L28-I31 PolarHBondContact O-N 3.32Å
32	G	49.5	Very low	46.3	Very low	58 Å²	58	126 Å²	126	60%	0.598	69%	0.687	S	S	*	*	T	Hydrogen-bonded Turn	trans	78.2	71.7	149.3	0	0	0	0	0	115.8	K30	K30-G32 VanDerWaalsContact C-N 3.25Å; K30-G32 PolarHBondContact O-N 3.29Å
33	W	46.1	Very low	46.2	Very low	264 Å²	264	123.6 Å²	123.6	100%	1	69%	0.686	S	S	*	*			trans	-75.7	121.3	131.9	-91.7	11.1	0	0	0	108.5
34	G	42.9	Very low	45.9	Very low	67 Å²	67	124.5 Å²	124.5	69%	0.691	70%	0.695	S	S	*	*			trans	-167.6	91.1	175.2	0	0	0	0	0	110.3
35	V	40.3	Very low	45.7	Very low	144 Å²	144	128.3 Å²	128.3	87%	0.873	71%	0.713	S	S	*	*	S	Bend	trans	84.9	88.9	160.3	-168.4	0	0	0	0	115.7
36	D	40.3	Very low	45.8	Very low	113 Å²	113	129.7 Å²	129.7	60%	0.604	73%	0.727	S	S	*	*				96.7	113.8	123.3	-138.5	-90.6	0	0	0	118.8	S38	D36-S38 PolarHBondContact O-N 2.81Å; D36-S38 VanDerWaalsContact OD1-CA 3.28Å; D36-S38 WeakPolarHBondContact OD1-CA 3.22Å; D36-S38 VanDerWaalsContact OD1-CB 3.28Å; D36-S38 WeakPolarHBondContact OD1-CB 3.42Å; D36-S38 PolarHBondContact OD1-N 2.96Å; D36-S38 VanDerWaalsContact OD1-O 3.09Å; D36-S38 PolarHBondContact OD1-OG 3.26Å
37	Q	49.3	Very low	45.9	Very low	210 Å²	210	122.5 Å²	122.5	98%	0.981	71%	0.712	S	S	*	*	S	Bend	trans	-77.5	12.1	169.7	-86.6	-178.4	-35.9	0	0	113.2
38	S	42.8	Very low	46.4	Very low	78 Å²	78	122.5 Å²	122.5	55%	0.545	72%	0.716	S	S	.	*			trans	-142.6	154.1	-171	77.5	0	0	0	0	114.4	D36	D36-S38 PolarHBondContact O-N 2.81Å; D36-S38 VanDerWaalsContact OD1-CA 3.28Å; D36-S38 WeakPolarHBondContact OD1-CA 3.22Å; D36-S38 VanDerWaalsContact OD1-CB 3.28Å; D36-S38 WeakPolarHBondContact OD1-CB 3.42Å; D36-S38 PolarHBondContact OD1-N 2.96Å; D36-S38 VanDerWaalsContact OD1-O 3.09Å; D36-S38 PolarHBondContact OD1-OG 3.26Å
39	V	37.8	Very low	46.6	Very low	146 Å²	146	123.3 Å²	123.3	89%	0.885	72%	0.715	S	S	*	*			trans	95.6	104.7	168.7	-164.3	0	0	0	0	116.5
40	G	37.8	Very low	47.3	Very low	67 Å²	67	122.1 Å²	122.1	69%	0.691	70%	0.704	S	S	*	*			trans	108.7	88.1	151.2	0	0	0	0	0	113.5
41	G	51.6	Low	47.9	Very low	73 Å²	73	120.1 Å²	120.1	75%	0.753	70%	0.697	S	S	*	*			cis	57.6	95	38.9	0	0	0	0	0	108.9
42	F	45.4	Very low	48.4	Very low	214 Å²	214	119 Å²	119	94%	0.939	69%	0.692	S	S	*	*	S	Bend	trans	81.2	123.8	161.1	-145.6	-99	0	0	0	117.5
43	G	54.8	Low	48.8	Very low	49 Å²	49	122.1 Å²	122.1	51%	0.505	69%	0.692	S	S	.	*			trans	82.1	128.8	146.9	0	0	0	0	0	117
44	D	45.2	Very low	49.6	Very low	138 Å²	138	113.9 Å²	113.9	74%	0.738	67%	0.668	S	S	*	*			trans	78	130.9	149.5	-92.6	-113	0	0	0	122.8	K49	D44-K49 PolarHBondContact O-NZ 3.35Å
45	E	43.6	Very low	50.3	Low	146 Å²	146	116 Å²	116	68%	0.682	66%	0.663	S	S	*	*			trans	76.1	97.7	167.4	-97.1	160.7	59	0	0	121	G47	E45-G47 PolarHBondContact O-N 3.28Å
46	P	52.4	Low	51.1	Low	127 Å²	127	113.7 Å²	113.7	83%	0.825	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.9	104.3	173.6	33.8	-28.8	0	0	0	110.1
47	G	54.6	Low	51.9	Low	39 Å²	39	117.1 Å²	117.1	40%	0.402	65%	0.653	S	S	.	*	T	Hydrogen-bonded Turn	trans	176.3	-57.6	169	0	0	0	0	0	111.7	E45 Q51	E45-G47 PolarHBondContact O-N 3.28Å; G47-Q51 PolarHBondContact O-N 3.43Å
48	I	53.7	Low	52.1	Low	121 Å²	121	110.4 Å²	110.4	62%	0.621	63%	0.629	S	S	*	*	H	α-helix	trans	-78.5	-40.6	-176.9	-59.4	168.3	0	0	0	110.8	V50 Q51 L52	I48-V50 VanDerWaalsContact C-N 3.34Å; I48-V50 PolarHBondContact O-N 3.45Å; I48-Q51 PolarHBondContact O-N 2.97Å; I48-L52 HydrophobicContact CG2-CD1 3.56Å; I48-L52 WeakPolarHBondContact O-CB 3.23Å; I48-L52 WeakPolarHBondContact O-CD1 3.46Å; I48-L52 PolarHBondContact O-N 2.96Å
49	K	52.2	Low	52.6	Low	129 Å²	129	110.2 Å²	110.2	56%	0.561	63%	0.625	S	S	*	*	H	α-helix	trans	-61.2	-38.6	178.6	-66.8	177.2	178.6	168.3	0	112.8	D44 M53	D44-K49 PolarHBondContact O-NZ 3.35Å; K49-M53 WeakPolarHBondContact O-CB 3.31Å; K49-M53 PolarHBondContact O-N 2.95Å
50	V	59.8	Low	53.2	Low	75 Å²	75	111.7 Å²	111.7	46%	0.455	62%	0.615	S	S	.	*	H	α-helix	trans	-72.5	-40.2	178.4	177.6	0	0	0	0	111.2	I48 M53 N54	I48-V50 VanDerWaalsContact C-N 3.34Å; I48-V50 PolarHBondContact O-N 3.45Å; V50-M53 PolarHBondContact O-N 3.41Å; V50-N54 PolarHBondContact O-N 3.42Å
51	Q	56.7	Low	54	Low	142 Å²	142	112.8 Å²	112.8	66%	0.664	61%	0.608	S	S	*	*	H	α-helix	trans	-66.3	-39.1	176.9	-166	170	4.7	0	0	111.9	G47 I48 N54 L55	G47-Q51 PolarHBondContact O-N 3.43Å; I48-Q51 PolarHBondContact O-N 2.97Å; Q51-N54 PolarHBondContact O-N 3.46Å; Q51-L55 WeakPolarHBondContact O-CB 3.42Å; Q51-L55 PolarHBondContact O-N 3.36Å
52	L	59.5	Low	54	Low	100 Å²	100	114 Å²	114	52%	0.524	60%	0.6	S	S	.	*	H	α-helix	trans	-62.4	-43.9	170.1	-98.4	120.3	0	0	0	112.2	I48 N54 L55 V56	I48-L52 HydrophobicContact CG2-CD1 3.56Å; I48-L52 WeakPolarHBondContact O-CB 3.23Å; I48-L52 WeakPolarHBondContact O-CD1 3.46Å; I48-L52 PolarHBondContact O-N 2.96Å; L52-N54 VanDerWaalsContact C-N 3.32Å; L52-N54 PolarHBondContact O-N 3.37Å; L52-L55 WeakPolarHBondContact O-CB 3.21Å; L52-L55 PolarHBondContact O-N 2.91Å; L52-L55 VanDerWaalsContact O-N 3.16Å; L52-V56 VanDerWaalsContact O-CG2 3.29Å; L52-V56 WeakPolarHBondContact O-CG2 3.46Å; L52-V56 PolarHBondContact O-N 3.25Å
53	M	58.2	Low	54.2	Low	122 Å²	122	109.2 Å²	109.2	60%	0.601	58%	0.582	S	S	*	*	H	α-helix	trans	-64.9	-35.9	179.2	-165.2	165.7	62.3	0	0	112.4	K49 V50 R57	K49-M53 WeakPolarHBondContact O-CB 3.31Å; K49-M53 PolarHBondContact O-N 2.95Å; V50-M53 PolarHBondContact O-N 3.41Å; M53-R57 PolarHBondContact O-N 3.41Å; M53-R57 VanDerWaalsContact O-N 3.1Å
54	N	62	Low	54	Low	92 Å²	92	115.7 Å²	115.7	49%	0.492	59%	0.591	S	S	.	*	H	α-helix	trans	-68.9	-38.1	171.6	-80.3	-12.6	0	0	0	112.5	V50 Q51 L52 R57 S58	V50-N54 PolarHBondContact O-N 3.42Å; Q51-N54 PolarHBondContact O-N 3.46Å; L52-N54 VanDerWaalsContact C-N 3.32Å; L52-N54 PolarHBondContact O-N 3.37Å; N54-R57 WeakPolarHBondContact O-CB 3.38Å; N54-R57 PolarHBondContact O-N 2.94Å; N54-S58 PolarHBondContact O-N 2.92Å; N54-S58 PolarHBondContact O-OG 3.38Å
55	L	59.2	Low	54.5	Low	111 Å²	111	113.7 Å²	113.7	58%	0.581	58%	0.584	S	S	*	*	H	α-helix	trans	-64.6	-41.9	175.1	-172	63.4	0	0	0	111.5	Q51 L52 R57 S58 V59	Q51-L55 WeakPolarHBondContact O-CB 3.42Å; Q51-L55 PolarHBondContact O-N 3.36Å; L52-L55 WeakPolarHBondContact O-CB 3.21Å; L52-L55 PolarHBondContact O-N 2.91Å; L52-L55 VanDerWaalsContact O-N 3.16Å; L55-R57 VanDerWaalsContact C-N 3.3Å; L55-R57 PolarHBondContact O-N 3.16Å; L55-S58 PolarHBondContact O-N 3.29Å; L55-V59 WeakPolarHBondContact O-CB 3.42Å; L55-V59 VanDerWaalsContact O-CG2 3.25Å; L55-V59 WeakPolarHBondContact O-CG2 3.47Å; L55-V59 PolarHBondContact O-N 2.94Å
56	V	56.4	Low	54.9	Low	95 Å²	95	109.7 Å²	109.7	58%	0.576	57%	0.571	S	S	*	*	H	α-helix	trans	-60.3	-40.3	173.4	170.7	0	0	0	0	111.3	L52 V59 R60	L52-V56 VanDerWaalsContact O-CG2 3.29Å; L52-V56 WeakPolarHBondContact O-CG2 3.46Å; L52-V56 PolarHBondContact O-N 3.25Å; V56-V59 PolarHBondContact O-N 2.9Å; V56-R60 WeakPolarHBondContact O-CB 3.07Å; V56-R60 PolarHBondContact O-N 3.1Å
57	R	57.5	Low	54.8	Low	186 Å²	186	109.3 Å²	109.3	70%	0.702	56%	0.561	S	S	*	*	H	α-helix	trans	-63	-46.6	173.4	-98.5	-176.8	179.8	-173.7	0.3	112.3	M53 N54 L55 V59 R60 T61	M53-R57 PolarHBondContact O-N 3.41Å; M53-R57 VanDerWaalsContact O-N 3.1Å; N54-R57 WeakPolarHBondContact O-CB 3.38Å; N54-R57 PolarHBondContact O-N 2.94Å; L55-R57 VanDerWaalsContact C-N 3.3Å; L55-R57 PolarHBondContact O-N 3.16Å; R57-V59 VanDerWaalsContact C-N 3.34Å; R57-V59 PolarHBondContact O-N 3.26Å; R57-R60 WeakPolarHBondContact O-CB 3.28Å; R57-R60 PolarHBondContact O-N 2.9Å; R57-T61 PolarHBondContact O-N 3.38Å; R57-T61 VanDerWaalsContact O-N 3.09Å; R57-T61 PolarHBondContact O-OG1 3.5Å
58	S	53.3	Low	54.9	Low	68 Å²	68	112.8 Å²	112.8	48%	0.476	57%	0.57	S	S	.	*	H	α-helix	trans	-63.3	-38.7	176.6	-70	0	0	0	0	112.4	N54 L55 T61 V62	N54-S58 PolarHBondContact O-N 2.92Å; N54-S58 PolarHBondContact O-OG 3.38Å; L55-S58 PolarHBondContact O-N 3.29Å; S58-T61 VanDerWaalsContact C-OG1 3.31Å; S58-T61 WeakPolarHBondContact CA-OG1 3.4Å; S58-T61 PolarHBondContact O-N 3.36Å; S58-T61 PolarHBondContact O-OG1 3Å; S58-V62 VanDerWaalsContact O-CG2 3.3Å; S58-V62 WeakPolarHBondContact O-CG2 3.16Å; S58-V62 PolarHBondContact O-N 2.89Å
59	V	52.9	Low	55.1	Low	75 Å²	75	109.4 Å²	109.4	46%	0.455	56%	0.559	S	S	.	*	H	α-helix	trans	-65.8	-39.3	174.8	167.1	0	0	0	0	111.1	L55 V56 R57 T61 V62 M63	L55-V59 WeakPolarHBondContact O-CB 3.42Å; L55-V59 VanDerWaalsContact O-CG2 3.25Å; L55-V59 WeakPolarHBondContact O-CG2 3.47Å; L55-V59 PolarHBondContact O-N 2.94Å; V56-V59 PolarHBondContact O-N 2.9Å; R57-V59 VanDerWaalsContact C-N 3.34Å; R57-V59 PolarHBondContact O-N 3.26Å; V59-T61 VanDerWaalsContact C-N 3.29Å; V59-T61 PolarHBondContact O-N 3.11Å; V59-V62 CarbonylContact O-C 3.49Å; V59-V62 WeakPolarHBondContact O-CA 3.36Å; V59-V62 WeakPolarHBondContact O-CB 3.34Å; V59-V62 PolarHBondContact O-N 3.36Å; V59-V62 VanDerWaalsContact O-N 3.09Å; V59-M63 PolarHBondContact O-N 2.94Å
60	R	50.8	Low	55	Low	177 Å²	177	106.6 Å²	106.6	67%	0.668	55%	0.553	S	S	*	*	H	α-helix	trans	-63.7	-34.3	175.2	-159.8	-176.8	-139.4	-170	7	112.4	V56 R57 M63	V56-R60 WeakPolarHBondContact O-CB 3.07Å; V56-R60 PolarHBondContact O-N 3.1Å; R57-R60 WeakPolarHBondContact O-CB 3.28Å; R57-R60 PolarHBondContact O-N 2.9Å; R60-M63 HydrophobicContact CG-CE 4.33Å
61	T	54.4	Low	54.7	Low	90 Å²	90	107.9 Å²	107.9	55%	0.552	56%	0.557	S	S	*	*	H	α-helix	trans	-72	-35.9	171.4	50.1	0	0	0	0	112	R57 S58 V59 M63 R64	R57-T61 PolarHBondContact O-N 3.38Å; R57-T61 VanDerWaalsContact O-N 3.09Å; R57-T61 PolarHBondContact O-OG1 3.5Å; S58-T61 VanDerWaalsContact C-OG1 3.31Å; S58-T61 WeakPolarHBondContact CA-OG1 3.4Å; S58-T61 PolarHBondContact O-N 3.36Å; S58-T61 PolarHBondContact O-OG1 3Å; V59-T61 VanDerWaalsContact C-N 3.29Å; V59-T61 PolarHBondContact O-N 3.11Å; T61-M63 VanDerWaalsContact C-N 3.29Å; T61-M63 PolarHBondContact O-N 2.91Å; T61-R64 PolarHBondContact O-N 3.25Å
62	V	51.9	Low	54.6	Low	97 Å²	97	104.2 Å²	104.2	59%	0.588	55%	0.547	S	S	*	.	H	α-helix	trans	-65.7	-29	173.7	165.7	0	0	0	0	111.9	S58 V59 R64 P66	S58-V62 VanDerWaalsContact O-CG2 3.3Å; S58-V62 WeakPolarHBondContact O-CG2 3.16Å; S58-V62 PolarHBondContact O-N 2.89Å; V59-V62 CarbonylContact O-C 3.49Å; V59-V62 WeakPolarHBondContact O-CA 3.36Å; V59-V62 WeakPolarHBondContact O-CB 3.34Å; V59-V62 PolarHBondContact O-N 3.36Å; V59-V62 VanDerWaalsContact O-N 3.09Å; V62-R64 VanDerWaalsContact C-N 3.33Å; V62-R64 PolarHBondContact O-N 3.46Å; V62-P66 WeakPolarHBondContact O-CD 3.46Å; V62-P66 WeakPolarHBondContact O-CG 3.42Å
63	M	48.1	Very low	54.6	Low	114 Å²	114	103.5 Å²	103.5	56%	0.562	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.6	-21.2	175.3	-81.3	-161.2	-72.6	0	0	114.8	V59 R60 T61	V59-M63 PolarHBondContact O-N 2.94Å; R60-M63 HydrophobicContact CG-CE 4.33Å; T61-M63 VanDerWaalsContact C-N 3.29Å; T61-M63 PolarHBondContact O-N 2.91Å
64	R	52.5	Low	54.2	Low	185 Å²	185	100.3 Å²	100.3	70%	0.698	54%	0.536	S	S	*	.	H	α-helix	trans	-85.9	-33.5	-179.1	-67.9	-171.7	178.4	-169.4	-1.3	113.5	T61 V62 L67 I68	T61-R64 PolarHBondContact O-N 3.25Å; V62-R64 VanDerWaalsContact C-N 3.33Å; V62-R64 PolarHBondContact O-N 3.46Å; R64-L67 PolarHBondContact O-N 2.98Å; R64-I68 PolarHBondContact O-N 3.45Å
65	V	53.8	Low	54	Low	97 Å²	97	100.3 Å²	100.3	59%	0.588	54%	0.535	S	S	*	.	H	α-helix	trans	-61.5	-43.5	179.5	179.4	0	0	0	0	114.1	L67 I68 A69	V65-L67 VanDerWaalsContact C-N 3.32Å; V65-L67 PolarHBondContact O-N 2.93Å; V65-I68 PolarHBondContact O-N 2.92Å; V65-A69 WeakPolarHBondContact O-CB 3.33Å; V65-A69 PolarHBondContact O-N 3.01Å
66	P	52.5	Low	54	Low	62 Å²	62	98.9 Å²	98.9	40%	0.403	53%	0.531	S	S	.	.	H	α-helix	trans	-67.5	-35.2	179	25.2	-33.5	0	0	0	111.2	V62 I68 A69 V70	V62-P66 WeakPolarHBondContact O-CD 3.46Å; V62-P66 WeakPolarHBondContact O-CG 3.42Å; P66-I68 VanDerWaalsContact C-N 3.26Å; P66-I68 PolarHBondContact O-N 3.45Å; P66-A69 PolarHBondContact O-N 2.9Å; P66-V70 WeakPolarHBondContact O-CB 3.43Å; P66-V70 WeakPolarHBondContact O-CG2 3.45Å; P66-V70 PolarHBondContact O-N 3.37Å
67	L	50.3	Low	53.9	Low	118 Å²	118	99 Å²	99	62%	0.618	53%	0.527	S	S	*	.	H	α-helix	trans	-60.5	-36.8	176.7	-136.5	79	0	0	0	111.8	R64 V65 N71	R64-L67 PolarHBondContact O-N 2.98Å; V65-L67 VanDerWaalsContact C-N 3.32Å; V65-L67 PolarHBondContact O-N 2.93Å; L67-N71 WeakPolarHBondContact O-CB 3.38Å; L67-N71 PolarHBondContact O-N 3.38Å
68	I	57.6	Low	53.7	Low	113 Å²	113	95.3 Å²	95.3	58%	0.579	52%	0.521	S	S	*	.	H	α-helix	trans	-78	-42.2	176.5	-69.4	160.7	0	0	0	111.3	R64 V65 P66 V70 N71 S72	R64-I68 PolarHBondContact O-N 3.45Å; V65-I68 PolarHBondContact O-N 2.92Å; P66-I68 VanDerWaalsContact C-N 3.26Å; P66-I68 PolarHBondContact O-N 3.45Å; I68-V70 VanDerWaalsContact C-N 3.35Å; I68-V70 PolarHBondContact O-N 3.38Å; I68-N71 PolarHBondContact O-N 3.03Å; I68-S72 WeakPolarHBondContact O-CB 3.4Å; I68-S72 PolarHBondContact O-N 3.31Å; I68-S72 PolarHBondContact O-OG 2.86Å
69	A	56.4	Low	53.9	Low	49 Å²	49	98.6 Å²	98.6	41%	0.405	53%	0.533	S	S	.	.	H	α-helix	trans	-62.1	-43.3	179.5	0	0	0	0	0	111.7	V65 P66 S72 V73	V65-A69 WeakPolarHBondContact O-CB 3.33Å; V65-A69 PolarHBondContact O-N 3.01Å; P66-A69 PolarHBondContact O-N 2.9Å; A69-S72 PolarHBondContact O-N 2.83Å; A69-V73 WeakPolarHBondContact O-CB 3.45Å; A69-V73 VanDerWaalsContact O-CG2 3.23Å; A69-V73 WeakPolarHBondContact O-CG2 3.28Å; A69-V73 PolarHBondContact O-N 3.32Å
70	V	51.5	Low	53.7	Low	71 Å²	71	101.4 Å²	101.4	43%	0.43	54%	0.544	S	S	.	.	H	α-helix	trans	-68.2	-40.7	177.5	175.4	0	0	0	0	110.9	P66 I68 V73 C74	P66-V70 WeakPolarHBondContact O-CB 3.43Å; P66-V70 WeakPolarHBondContact O-CG2 3.45Å; P66-V70 PolarHBondContact O-N 3.37Å; I68-V70 VanDerWaalsContact C-N 3.35Å; I68-V70 PolarHBondContact O-N 3.38Å; V70-V73 PolarHBondContact O-N 3.42Å; V70-C74 WeakPolarHBondContact O-CB 3.31Å; V70-C74 PolarHBondContact O-N 2.95Å
71	N	53.5	Low	53.3	Low	101 Å²	101	101.8 Å²	101.8	54%	0.54	55%	0.551	S	S	.	*	H	α-helix	trans	-63.6	-43.2	175.5	-139.3	-69.5	0	0	0	112	L67 I68 C74 I75	L67-N71 WeakPolarHBondContact O-CB 3.38Å; L67-N71 PolarHBondContact O-N 3.38Å; I68-N71 PolarHBondContact O-N 3.03Å; N71-C74 WeakPolarHBondContact O-CB 3.24Å; N71-C74 PolarHBondContact O-N 2.96Å; N71-I75 VanDerWaalsContact O-CG1 3.31Å; N71-I75 WeakPolarHBondContact O-CG1 3.49Å; N71-I75 PolarHBondContact O-N 3.47Å
72	S	55.2	Low	52.6	Low	65 Å²	65	102.9 Å²	102.9	46%	0.455	58%	0.58	S	S	.	*	H	α-helix	trans	-64.9	-44.1	175.9	-78	0	0	0	0	112.7	I68 A69 C74 I75 V76	I68-S72 WeakPolarHBondContact O-CB 3.4Å; I68-S72 PolarHBondContact O-N 3.31Å; I68-S72 PolarHBondContact O-OG 2.86Å; A69-S72 PolarHBondContact O-N 2.83Å; S72-C74 VanDerWaalsContact C-N 3.29Å; S72-C74 PolarHBondContact O-N 2.95Å; S72-I75 PolarHBondContact O-N 3.24Å; S72-V76 WeakPolarHBondContact O-CB 3.4Å; S72-V76 VanDerWaalsContact O-CG2 3.23Å; S72-V76 WeakPolarHBondContact O-CG2 3.33Å; S72-V76 PolarHBondContact O-N 3.5Å
73	V	58.1	Low	52.6	Low	86 Å²	86	103.2 Å²	103.2	52%	0.521	58%	0.58	S	S	.	*	H	α-helix	trans	-64.1	-38	176.6	171.1	0	0	0	0	110.9	A69 V70 V76 L77	A69-V73 WeakPolarHBondContact O-CB 3.45Å; A69-V73 VanDerWaalsContact O-CG2 3.23Å; A69-V73 WeakPolarHBondContact O-CG2 3.28Å; A69-V73 PolarHBondContact O-N 3.32Å; V70-V73 PolarHBondContact O-N 3.42Å; V73-V76 PolarHBondContact O-N 2.94Å; V73-L77 HydrophobicContact CG1-CD1 3.88Å; V73-L77 HydrophobicContact CG1-CG 4.45Å; V73-L77 WeakPolarHBondContact O-CB 3.42Å; V73-L77 WeakPolarHBondContact O-CG 3.24Å; V73-L77 PolarHBondContact O-N 2.98Å
74	C	50.7	Low	52.9	Low	54 Å²	54	102.6 Å²	102.6	37%	0.365	58%	0.581	S	S	.	*	H	α-helix	trans	-61.7	-48.8	174.9	-169.6	0	0	0	0	111.6	V70 N71 S72 V76 L77 L78	V70-C74 WeakPolarHBondContact O-CB 3.31Å; V70-C74 PolarHBondContact O-N 2.95Å; N71-C74 WeakPolarHBondContact O-CB 3.24Å; N71-C74 PolarHBondContact O-N 2.96Å; S72-C74 VanDerWaalsContact C-N 3.29Å; S72-C74 PolarHBondContact O-N 2.95Å; C74-V76 VanDerWaalsContact C-N 3.35Å; C74-V76 PolarHBondContact O-N 3.36Å; C74-L77 PolarHBondContact O-N 3.24Å; C74-L78 WeakPolarHBondContact O-CB 3.44Å; C74-L78 PolarHBondContact O-N 2.82Å
75	I	57.8	Low	52.9	Low	93 Å²	93	98 Å²	98	48%	0.477	57%	0.574	S	S	.	*	H	α-helix	trans	-60.4	-43.6	176.3	-68.4	165.3	0	0	0	111.2	N71 S72 L78 L79	N71-I75 VanDerWaalsContact O-CG1 3.31Å; N71-I75 WeakPolarHBondContact O-CG1 3.49Å; N71-I75 PolarHBondContact O-N 3.47Å; S72-I75 PolarHBondContact O-N 3.24Å; I75-L78 PolarHBondContact O-N 2.94Å; I75-L79 WeakPolarHBondContact O-CB 3.33Å; I75-L79 PolarHBondContact O-N 2.91Å
76	V	59.3	Low	52.8	Low	81 Å²	81	98.1 Å²	98.1	49%	0.491	57%	0.574	S	S	.	*	H	α-helix	trans	-66.9	-42.1	-179.3	170.3	0	0	0	0	111.6	S72 V73 C74 L79 L80	S72-V76 WeakPolarHBondContact O-CB 3.4Å; S72-V76 VanDerWaalsContact O-CG2 3.23Å; S72-V76 WeakPolarHBondContact O-CG2 3.33Å; S72-V76 PolarHBondContact O-N 3.5Å; V73-V76 PolarHBondContact O-N 2.94Å; C74-V76 VanDerWaalsContact C-N 3.35Å; C74-V76 PolarHBondContact O-N 3.36Å; V76-L79 PolarHBondContact O-N 3.43Å; V76-L80 HydrophobicContact CG1-CD1 4.03Å; V76-L80 WeakPolarHBondContact O-CB 3.32Å; V76-L80 PolarHBondContact O-N 3.19Å
77	L	53.2	Low	52.9	Low	96 Å²	96	100.3 Å²	100.3	50%	0.503	58%	0.584	S	S	.	*	H	α-helix	trans	-67.6	-39.7	175.5	-79.7	170.1	0	0	0	112	V73 C74 L79 L80 F81	V73-L77 HydrophobicContact CG1-CD1 3.88Å; V73-L77 HydrophobicContact CG1-CG 4.45Å; V73-L77 WeakPolarHBondContact O-CB 3.42Å; V73-L77 WeakPolarHBondContact O-CG 3.24Å; V73-L77 PolarHBondContact O-N 2.98Å; C74-L77 PolarHBondContact O-N 3.24Å; L77-L79 PolarHBondContact O-N 3.39Å; L77-L80 PolarHBondContact O-N 3.37Å; L77-F81 HydrophobicContact CD2-CD2 4.45Å; L77-F81 WeakPolarHBondContact O-CB 3.26Å; L77-F81 PolarHBondContact O-N 3.39Å
78	L	54.7	Low	53	Low	109 Å²	109	99.1 Å²	99.1	57%	0.571	58%	0.582	S	S	*	*	H	α-helix	trans	-62.5	-28.9	172.3	-111	147.4	0	0	0	112.7	C74 I75 G82	C74-L78 WeakPolarHBondContact O-CB 3.44Å; C74-L78 PolarHBondContact O-N 2.82Å; I75-L78 PolarHBondContact O-N 2.94Å; L78-G82 WeakPolarHBondContact O-CA 3.27Å; L78-G82 PolarHBondContact O-N 3.06Å; L78-G82 VanDerWaalsContact O-N 3.11Å
79	L	57.5	Low	52.7	Low	138 Å²	138	98.1 Å²	98.1	72%	0.723	58%	0.582	S	S	*	*	H	α-helix	trans	-82.7	-34.3	176.8	-114.1	165.6	0	0	0	113.4	I75 V76 L77	I75-L79 WeakPolarHBondContact O-CB 3.33Å; I75-L79 PolarHBondContact O-N 2.91Å; V76-L79 PolarHBondContact O-N 3.43Å; L77-L79 PolarHBondContact O-N 3.39Å
80	L	47.5	Very low	52.4	Low	133 Å²	133	101.9 Å²	101.9	70%	0.696	60%	0.596	S	S	*	*	H	α-helix	trans	-83.9	-35.6	-178.2	-102	159.3	0	0	0	113.2	V76 L77	V76-L80 HydrophobicContact CG1-CD1 4.03Å; V76-L80 WeakPolarHBondContact O-CB 3.32Å; V76-L80 PolarHBondContact O-N 3.19Å; L77-L80 PolarHBondContact O-N 3.37Å
81	F	42.7	Very low	52.5	Low	185 Å²	185	104.5 Å²	104.5	81%	0.811	61%	0.61	S	S	*	*			trans	-111.3	3.9	-178.9	-88.3	-89.2	0	0	0	113.2	L77	L77-F81 HydrophobicContact CD2-CD2 4.45Å; L77-F81 WeakPolarHBondContact O-CB 3.26Å; L77-F81 PolarHBondContact O-N 3.39Å
82	G	39.9	Very low	52.4	Low	113 Å²	113	104.8 Å²	104.8	100%	1.165	62%	0.616	S	S	*	*			trans	-81.1	0	166.9	0	0	0	0	0	112	L78	L78-G82 WeakPolarHBondContact O-CA 3.27Å; L78-G82 PolarHBondContact O-N 3.06Å; L78-G82 VanDerWaalsContact O-N 3.11Å

Retrieved 82 of 82 residues in 185.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).