A0A060XFI5_ONCMY Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB (A0A1S3L1L9), UniProt , Accession A0A060XFI5, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 70 aa.

						>A0A060XFI5_ONCMY|A0A060XFI5
MSNNMAKIADARKTVEQLKLEVNIERMMVSKAAADLMAFCEAHAKEDPLVTPVPSSENPFREKKFFCAIL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.6	Low	83.4	Confident	227 Å²	227	108.4 Å²	108.4	100%	1.118	61%	0.61	S	S	*	*				0	-19.4	0	-68.8	180	-176.6	0	0	114.2
2	S	61.9	Low	84.6	Confident	104 Å²	104	113.8 Å²	113.8	73%	0.727	61%	0.614	S	S	*	*	H	α-helix	trans	-62.5	-39.7	-179.5	-173.3	0	0	0	0	115.6	N4 M5	S2-N4 VanDerWaalsContact C-N 3.28Å; S2-N4 PolarHBondContact O-N 3.36Å; S2-M5 PolarHBondContact O-N 3.31Å
3	N	74.9	Confident	85.5	Confident	124 Å²	124	117.4 Å²	117.4	66%	0.663	62%	0.62	S	S	*	*	H	α-helix	trans	-65.4	-21.7	-175.7	-87.3	1.8	0	0	0	115.9	K7	N3-K7 WeakPolarHBondContact O-CG 3.34Å; N3-K7 PolarHBondContact O-N 3.49Å
4	N	82	Confident	86.4	Confident	106 Å²	106	114.8 Å²	114.8	57%	0.567	61%	0.611	S	S	*	*	H	α-helix	trans	-77.7	-32.5	-179.1	-74.2	-0.3	0	0	0	111.6	S2 I8	S2-N4 VanDerWaalsContact C-N 3.28Å; S2-N4 PolarHBondContact O-N 3.36Å; N4-I8 WeakPolarHBondContact O-CD1 3.3Å; N4-I8 WeakPolarHBondContact O-CG1 3.47Å; N4-I8 PolarHBondContact O-N 2.79Å
5	M	83.4	Confident	87.2	Confident	142 Å²	142	111.8 Å²	111.8	70%	0.7	60%	0.599	S	S	*	*	H	α-helix	trans	-71	-39.4	-179.3	-156.8	67.3	83.2	0	0	111.7	S2 I8 A9	S2-M5 PolarHBondContact O-N 3.31Å; M5-I8 PolarHBondContact O-N 3.37Å; M5-A9 PolarHBondContact O-N 3.34Å
6	A	88.2	Confident	87.9	Confident	54 Å²	54	111.1 Å²	111.1	45%	0.446	59%	0.591	S	S	.	*	H	α-helix	trans	-61.7	-47.4	174.2	0	0	0	0	0	111.7	I8 A9 D10	A6-I8 VanDerWaalsContact C-N 3.3Å; A6-I8 PolarHBondContact O-N 3.14Å; A6-A9 WeakPolarHBondContact O-CB 3.43Å; A6-A9 PolarHBondContact O-N 3.44Å; A6-A9 VanDerWaalsContact O-N 3.13Å; A6-D10 PolarHBondContact O-N 3.02Å
7	K	93.6	Very high	88.5	Confident	142 Å²	142	110.1 Å²	110.1	62%	0.617	58%	0.582	S	S	*	*	H	α-helix	trans	-60.3	-38	176.4	-73	-179.7	178.6	-174.3	0	113.1	N3 A11	N3-K7 WeakPolarHBondContact O-CG 3.34Å; N3-K7 PolarHBondContact O-N 3.49Å; K7-A11 WeakPolarHBondContact O-CB 3.35Å; K7-A11 PolarHBondContact O-N 3.01Å
8	I	93.9	Very high	89	Confident	82 Å²	82	109.4 Å²	109.4	42%	0.421	58%	0.578	S	S	.	*	H	α-helix	trans	-66.7	-41.2	176.4	-70.2	163.6	0	0	0	110.7	N4 M5 A6 A11 R12	N4-I8 WeakPolarHBondContact O-CD1 3.3Å; N4-I8 WeakPolarHBondContact O-CG1 3.47Å; N4-I8 PolarHBondContact O-N 2.79Å; M5-I8 PolarHBondContact O-N 3.37Å; A6-I8 VanDerWaalsContact C-N 3.3Å; A6-I8 PolarHBondContact O-N 3.14Å; I8-A11 PolarHBondContact O-N 3.28Å; I8-R12 VanDerWaalsContact O-CG 3.3Å; I8-R12 WeakPolarHBondContact O-CG 3.45Å; I8-R12 PolarHBondContact O-N 2.73Å
9	A	94.6	Very high	89.5	Confident	56 Å²	56	109.2 Å²	109.2	46%	0.463	57%	0.571	S	S	.	*	H	α-helix	trans	-63.3	-44	176.8	0	0	0	0	0	111.8	M5 A6 R12 K13	M5-A9 PolarHBondContact O-N 3.34Å; A6-A9 WeakPolarHBondContact O-CB 3.43Å; A6-A9 PolarHBondContact O-N 3.44Å; A6-A9 VanDerWaalsContact O-N 3.13Å; A9-R12 PolarHBondContact O-N 3.46Å; A9-K13 PolarHBondContact O-N 3.32Å
10	D	95.9	Very high	89.9	Confident	101 Å²	101	109.7 Å²	109.7	54%	0.54	57%	0.574	S	S	.	*	H	α-helix	trans	-64.3	-41.9	176.9	-69	-23.8	0	0	0	112.3	A6 R12 K13 T14	A6-D10 PolarHBondContact O-N 3.02Å; D10-R12 VanDerWaalsContact C-N 3.34Å; D10-R12 PolarHBondContact O-N 3.37Å; D10-K13 PolarHBondContact O-N 3.33Å; D10-T14 PolarHBondContact O-N 2.98Å; D10-T14 PolarHBondContact O-OG1 2.96Å
11	A	96.6	Very high	90.2	Very high	54 Å²	54	108.1 Å²	108.1	45%	0.446	56%	0.564	S	S	.	*	H	α-helix	trans	-62.3	-42.1	176.1	0	0	0	0	0	111.4	K7 I8 T14 V15	K7-A11 WeakPolarHBondContact O-CB 3.35Å; K7-A11 PolarHBondContact O-N 3.01Å; I8-A11 PolarHBondContact O-N 3.28Å; A11-T14 PolarHBondContact O-N 2.98Å; A11-V15 WeakPolarHBondContact O-CG2 3.33Å; A11-V15 PolarHBondContact O-N 3.49Å
12	R	97	Very high	92.3	Very high	174 Å²	174	102 Å²	102	66%	0.657	54%	0.539	S	S	*	.	H	α-helix	trans	-62.1	-46	174.8	-73.5	174.5	-174.9	-81.5	0.5	111.5	I8 A9 D10 T14 V15 E16	I8-R12 VanDerWaalsContact O-CG 3.3Å; I8-R12 WeakPolarHBondContact O-CG 3.45Å; I8-R12 PolarHBondContact O-N 2.73Å; A9-R12 PolarHBondContact O-N 3.46Å; D10-R12 VanDerWaalsContact C-N 3.34Å; D10-R12 PolarHBondContact O-N 3.37Å; R12-T14 VanDerWaalsContact C-N 3.29Å; R12-T14 PolarHBondContact O-N 3.32Å; R12-V15 PolarHBondContact O-N 3.25Å; R12-V15 VanDerWaalsContact O-N 3.17Å; R12-E16 WeakPolarHBondContact O-CG 3.42Å; R12-E16 PolarHBondContact O-N 3.39Å
13	K	97.4	Very high	94	Very high	160 Å²	160	103.1 Å²	103.1	70%	0.696	54%	0.537	S	S	*	.	H	α-helix	trans	-57.7	-43.5	176.7	-174.2	-177.8	176.9	-175.3	0	111.6	A9 D10 E16 Q17	A9-K13 PolarHBondContact O-N 3.32Å; D10-K13 PolarHBondContact O-N 3.33Å; K13-E16 PolarHBondContact O-N 2.97Å; K13-Q17 PolarHBondContact O-N 3.17Å
14	T	97.6	Very high	95.1	Very high	81 Å²	81	102.1 Å²	102.1	50%	0.497	53%	0.531	S	S	.	.	H	α-helix	trans	-62.4	-43.6	176.6	-55.7	0	0	0	0	111.7	D10 A11 R12 E16 Q17 L18	D10-T14 PolarHBondContact O-N 2.98Å; D10-T14 PolarHBondContact O-OG1 2.96Å; A11-T14 PolarHBondContact O-N 2.98Å; R12-T14 VanDerWaalsContact C-N 3.29Å; R12-T14 PolarHBondContact O-N 3.32Å; T14-E16 PolarHBondContact O-N 3.43Å; T14-Q17 WeakPolarHBondContact O-CB 3.37Å; T14-Q17 PolarHBondContact O-N 3.32Å; T14-L18 HydrophobicContact CG2-CD1 4.1Å; T14-L18 HydrophobicContact CG2-CG 4.44Å; T14-L18 WeakPolarHBondContact O-CG 3.49Å; T14-L18 PolarHBondContact O-N 2.97Å
15	V	98.1	Very high	95.8	Very high	70 Å²	70	106.2 Å²	106.2	42%	0.424	55%	0.546	S	S	.	.	H	α-helix	trans	-62.7	-43.3	177.7	167.7	0	0	0	0	111.6	A11 R12 Q17 L18 K19	A11-V15 WeakPolarHBondContact O-CG2 3.33Å; A11-V15 PolarHBondContact O-N 3.49Å; R12-V15 PolarHBondContact O-N 3.25Å; R12-V15 VanDerWaalsContact O-N 3.17Å; V15-Q17 VanDerWaalsContact C-N 3.31Å; V15-Q17 PolarHBondContact O-N 3.03Å; V15-L18 PolarHBondContact O-N 3.37Å; V15-K19 HydrophobicContact CG1-CD 4.34Å; V15-K19 WeakPolarHBondContact O-CG 3.19Å; V15-K19 PolarHBondContact O-N 3.33Å
16	E	97.9	Very high	96.5	Very high	100 Å²	100	108.3 Å²	108.3	47%	0.467	55%	0.546	S	S	.	.	H	α-helix	trans	-63.4	-38.1	176.5	-64.4	-48.1	126.9	0	0	111.8	R12 K13 T14 K19 L20	R12-E16 WeakPolarHBondContact O-CG 3.42Å; R12-E16 PolarHBondContact O-N 3.39Å; K13-E16 PolarHBondContact O-N 2.97Å; T14-E16 PolarHBondContact O-N 3.43Å; E16-K19 PolarHBondContact O-N 3.29Å; E16-K19 IonicContact OE1-NZ 2.73Å; E16-K19 PolarHBondContact OE1-NZ 3.47Å; E16-K19 IonicContact OE2-NZ 3.59Å; E16-L20 WeakPolarHBondContact O-CG 3.43Å; E16-L20 PolarHBondContact O-N 3.31Å
17	Q	98.1	Very high	96.9	Very high	95 Å²	95	110.6 Å²	110.6	44%	0.444	55%	0.549	S	S	.	.	H	α-helix	trans	-61.6	-48.7	173.3	-179.3	62.6	22	0	0	112.1	K13 T14 V15 K19 L20 E21	K13-Q17 PolarHBondContact O-N 3.17Å; T14-Q17 WeakPolarHBondContact O-CB 3.37Å; T14-Q17 PolarHBondContact O-N 3.32Å; V15-Q17 VanDerWaalsContact C-N 3.31Å; V15-Q17 PolarHBondContact O-N 3.03Å; Q17-K19 VanDerWaalsContact C-N 3.28Å; Q17-K19 PolarHBondContact O-N 2.95Å; Q17-L20 WeakPolarHBondContact O-CB 3.36Å; Q17-L20 PolarHBondContact O-N 3Å; Q17-E21 HydrophobicContact CG-CG 4.48Å; Q17-E21 WeakPolarHBondContact CG-OE1 3.32Å; Q17-E21 PolarHBondContact NE2-OE1 3.13Å; Q17-E21 PolarHBondContact O-N 2.98Å
18	L	98.2	Very high	97.1	Very high	97 Å²	97	110.2 Å²	110.2	51%	0.508	55%	0.551	S	S	.	*	H	α-helix	trans	-63.3	-34.7	-179.2	-69.1	171.7	0	0	0	112.4	T14 V15 L20 E21 V22	T14-L18 HydrophobicContact CG2-CD1 4.1Å; T14-L18 HydrophobicContact CG2-CG 4.44Å; T14-L18 WeakPolarHBondContact O-CG 3.49Å; T14-L18 PolarHBondContact O-N 2.97Å; V15-L18 PolarHBondContact O-N 3.37Å; L18-L20 VanDerWaalsContact C-N 3.26Å; L18-L20 PolarHBondContact O-N 2.92Å; L18-E21 PolarHBondContact O-N 3.46Å; L18-V22 PolarHBondContact O-N 3.03Å
19	K	97.9	Very high	97.3	Very high	105 Å²	105	112.2 Å²	112.2	46%	0.457	57%	0.567	S	S	.	*	H	α-helix	trans	-63.9	-30.7	172.9	-74.1	172.8	-178.3	170.9	0	112.6	V15 E16 Q17 V22 N23	V15-K19 HydrophobicContact CG1-CD 4.34Å; V15-K19 WeakPolarHBondContact O-CG 3.19Å; V15-K19 PolarHBondContact O-N 3.33Å; E16-K19 PolarHBondContact O-N 3.29Å; E16-K19 IonicContact OE1-NZ 2.73Å; E16-K19 PolarHBondContact OE1-NZ 3.47Å; E16-K19 IonicContact OE2-NZ 3.59Å; Q17-K19 VanDerWaalsContact C-N 3.28Å; Q17-K19 PolarHBondContact O-N 2.95Å; K19-V22 WeakPolarHBondContact O-CG1 3.47Å; K19-N23 PolarHBondContact O-ND2 3.4Å
20	L	97.6	Very high	97.5	Very high	119 Å²	119	113.6 Å²	113.6	62%	0.623	57%	0.573	S	S	*	*	H	α-helix	trans	-75.1	-46.5	172.9	-64.5	172.4	0	0	0	110.4	E16 Q17 L18 V22 N23	E16-L20 WeakPolarHBondContact O-CG 3.43Å; E16-L20 PolarHBondContact O-N 3.31Å; Q17-L20 WeakPolarHBondContact O-CB 3.36Å; Q17-L20 PolarHBondContact O-N 3Å; L18-L20 VanDerWaalsContact C-N 3.26Å; L18-L20 PolarHBondContact O-N 2.92Å; L20-V22 VanDerWaalsContact C-N 3.32Å; L20-V22 PolarHBondContact O-N 3.33Å; L20-N23 PolarHBondContact O-N 3.35Å; L20-N23 VanDerWaalsContact O-N 3.14Å
21	E	97.3	Very high	97.6	Very high	78 Å²	78	114.8 Å²	114.8	36%	0.364	57%	0.574	S	S	.	*	H	α-helix	trans	-65	-30.8	-176.2	-71.3	177.8	-172.3	0	0	114.3	Q17 L18 N23 I24	Q17-E21 HydrophobicContact CG-CG 4.48Å; Q17-E21 WeakPolarHBondContact CG-OE1 3.32Å; Q17-E21 PolarHBondContact NE2-OE1 3.13Å; Q17-E21 PolarHBondContact O-N 2.98Å; L18-E21 PolarHBondContact O-N 3.46Å; E21-N23 PolarHBondContact O-N 3.06Å; E21-I24 HydrophobicContact CB-CD1 4.36Å; E21-I24 HydrophobicContact CG-CD1 4.32Å; E21-I24 PolarHBondContact O-N 3.02Å
22	V	97.2	Very high	97.7	Very high	97 Å²	97	113.6 Å²	113.6	59%	0.588	56%	0.564	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.8	-29.9	177.2	76.5	0	0	0	0	111.9	L18 K19 L20 I24	L18-V22 PolarHBondContact O-N 3.03Å; K19-V22 WeakPolarHBondContact O-CG1 3.47Å; L20-V22 VanDerWaalsContact C-N 3.32Å; L20-V22 PolarHBondContact O-N 3.33Å; V22-I24 VanDerWaalsContact C-N 3.3Å; V22-I24 PolarHBondContact O-N 3.06Å
23	N	96.8	Very high	97.8	Very high	129 Å²	129	107.8 Å²	107.8	69%	0.69	55%	0.553	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.2	2.8	-178.5	-67.7	-52.7	0	0	0	113.3	K19 L20 E21 E25	K19-N23 PolarHBondContact O-ND2 3.4Å; L20-N23 PolarHBondContact O-N 3.35Å; L20-N23 VanDerWaalsContact O-N 3.14Å; E21-N23 PolarHBondContact O-N 3.06Å; N23-E25 PolarHBondContact O-N 3.28Å
24	I	97.3	Very high	97.8	Very high	103 Å²	103	102.4 Å²	102.4	53%	0.528	54%	0.538	S	S	.	.	S	Bend	trans	-72.4	120.9	173.5	-61.4	174.5	0	0	0	108.9	E21 V22 R26	E21-I24 HydrophobicContact CB-CD1 4.36Å; E21-I24 HydrophobicContact CG-CD1 4.32Å; E21-I24 PolarHBondContact O-N 3.02Å; V22-I24 VanDerWaalsContact C-N 3.3Å; V22-I24 PolarHBondContact O-N 3.06Å; I24-R26 PolarHBondContact O-N 2.88Å; I24-R26 PolarHBondContact O-NH1 3.33Å
25	E	97.4	Very high	97.8	Very high	191 Å²	191	102.6 Å²	102.6	89%	0.893	54%	0.536	S	S	*	.	P	Polyproline II helix	trans	-64.7	125.5	171.7	-69.8	-173.3	176.3	0	0	110.4	N23	N23-E25 PolarHBondContact O-N 3.28Å
26	R	97.1	Very high	97.9	Very high	187 Å²	187	104.9 Å²	104.9	71%	0.706	55%	0.545	S	S	*	.	P	Polyproline II helix	trans	-100.5	141.1	178.9	-66.6	176	-177.4	72.9	2.9	109.6	I24	I24-R26 PolarHBondContact O-N 2.88Å; I24-R26 PolarHBondContact O-NH1 3.33Å
27	M	96.9	Very high	97.9	Very high	101 Å²	101	105.4 Å²	105.4	50%	0.498	55%	0.549	S	S	.	.	P	Polyproline II helix	trans	-83	156.2	168.2	78.7	-171.9	-60.6	0	0	111.1	V29 K31 A32	M27-V29 PolarHBondContact O-N 3.44Å; M27-K31 HydrophobicContact CE-CB 4.19Å; M27-K31 HydrophobicContact CE-CD 3.97Å; M27-K31 HydrophobicContact CE-CG 3.76Å; M27-A32 HydrophobicContact CE-CB 4.05Å; M27-A32 HydrophobicContact CG-CB 4.01Å; M27-A32 HydrophobicContact SD-CB 3.7Å
28	M	98.3	Very high	97.9	Very high	135 Å²	135	103.3 Å²	103.3	67%	0.665	55%	0.548	S	S	*	.	P	Polyproline II helix	trans	-61.4	133.1	172.9	-67.5	-64.3	-72.8	0	0	110.5	S30 K31 A32	M28-S30 PolarHBondContact O-N 2.92Å; M28-K31 HydrophobicContact CB-CB 4.2Å; M28-K31 WeakPolarHBondContact O-CB 3.37Å; M28-K31 PolarHBondContact O-N 3.4Å; M28-A32 PolarHBondContact O-N 3Å
29	V	98.4	Very high	97.9	Very high	123 Å²	123	104.9 Å²	104.9	75%	0.745	55%	0.551	S	S	*	*	H	α-helix	trans	-58.2	-38.3	177.5	177.5	0	0	0	0	111.2	M27 K31 A32 A33	M27-V29 PolarHBondContact O-N 3.44Å; V29-K31 VanDerWaalsContact C-N 3.31Å; V29-K31 PolarHBondContact O-N 3.31Å; V29-A32 PolarHBondContact O-N 2.91Å; V29-A33 VanDerWaalsContact O-CB 3.32Å; V29-A33 WeakPolarHBondContact O-CB 3.35Å; V29-A33 PolarHBondContact O-N 2.77Å
30	S	98.3	Very high	97.9	Very high	86 Å²	86	103.7 Å²	103.7	60%	0.601	56%	0.555	S	S	*	*	H	α-helix	trans	-60.4	-39.2	175.9	52.3	0	0	0	0	112.8	M28 A34	M28-S30 PolarHBondContact O-N 2.92Å; S30-A34 WeakPolarHBondContact O-CB 3.35Å; S30-A34 PolarHBondContact O-N 2.97Å
31	K	98.3	Very high	97.8	Very high	126 Å²	126	104 Å²	104	55%	0.548	55%	0.554	S	S	.	*	H	α-helix	trans	-69	-48.6	176	-178.1	175.8	176.1	174.4	0	110.9	M27 M28 V29 A33 A34 D35	M27-K31 HydrophobicContact CE-CB 4.19Å; M27-K31 HydrophobicContact CE-CD 3.97Å; M27-K31 HydrophobicContact CE-CG 3.76Å; M28-K31 HydrophobicContact CB-CB 4.2Å; M28-K31 WeakPolarHBondContact O-CB 3.37Å; M28-K31 PolarHBondContact O-N 3.4Å; V29-K31 VanDerWaalsContact C-N 3.31Å; V29-K31 PolarHBondContact O-N 3.31Å; K31-A33 VanDerWaalsContact C-N 3.27Å; K31-A33 PolarHBondContact O-N 3.32Å; K31-A34 PolarHBondContact O-N 2.89Å; K31-A34 VanDerWaalsContact O-N 3.14Å; K31-D35 VanDerWaalsContact O-CG 3.26Å; K31-D35 PolarHBondContact O-N 3.18Å
32	A	98.4	Very high	97.8	Very high	29 Å²	29	103.5 Å²	103.5	24%	0.24	56%	0.562	C	S	.	*	H	α-helix	trans	-57	-42.9	177.8	0	0	0	0	0	111.8	M27 M28 V29 D35 L36	M27-A32 HydrophobicContact CE-CB 4.05Å; M27-A32 HydrophobicContact CG-CB 4.01Å; M27-A32 HydrophobicContact SD-CB 3.7Å; M28-A32 PolarHBondContact O-N 3Å; V29-A32 PolarHBondContact O-N 2.91Å; A32-D35 PolarHBondContact O-N 3.45Å; A32-L36 WeakPolarHBondContact O-CB 3.26Å; A32-L36 VanDerWaalsContact O-CG 3.26Å; A32-L36 WeakPolarHBondContact O-CG 3.46Å; A32-L36 PolarHBondContact O-N 2.99Å
33	A	98.4	Very high	97.8	Very high	52 Å²	52	102.7 Å²	102.7	43%	0.43	55%	0.552	S	S	.	*	H	α-helix	trans	-64.9	-41.7	177.3	0	0	0	0	0	112.3	V29 K31 L36 M37	V29-A33 VanDerWaalsContact O-CB 3.32Å; V29-A33 WeakPolarHBondContact O-CB 3.35Å; V29-A33 PolarHBondContact O-N 2.77Å; K31-A33 VanDerWaalsContact C-N 3.27Å; K31-A33 PolarHBondContact O-N 3.32Å; A33-L36 PolarHBondContact O-N 2.92Å; A33-M37 WeakPolarHBondContact O-CB 3.48Å; A33-M37 PolarHBondContact O-N 3.01Å
34	A	98.5	Very high	97.7	Very high	47 Å²	47	98.1 Å²	98.1	39%	0.388	53%	0.532	S	S	.	.	H	α-helix	trans	-63.9	-43.3	176.3	0	0	0	0	0	111.9	S30 K31 L36 M37 A38	S30-A34 WeakPolarHBondContact O-CB 3.35Å; S30-A34 PolarHBondContact O-N 2.97Å; K31-A34 PolarHBondContact O-N 2.89Å; K31-A34 VanDerWaalsContact O-N 3.14Å; A34-L36 PolarHBondContact O-N 3.5Å; A34-M37 PolarHBondContact O-N 3.44Å; A34-A38 WeakPolarHBondContact O-CB 3.35Å; A34-A38 PolarHBondContact O-N 3.14Å
35	D	98.3	Very high	97.5	Very high	85 Å²	85	101.6 Å²	101.6	46%	0.455	54%	0.544	S	S	.	.	H	α-helix	trans	-62.8	-43.1	178	-65.5	-19.4	0	0	0	110.9	K31 A32 F39	K31-D35 VanDerWaalsContact O-CG 3.26Å; K31-D35 PolarHBondContact O-N 3.18Å; A32-D35 PolarHBondContact O-N 3.45Å; D35-F39 WeakPolarHBondContact O-CB 3.45Å; D35-F39 PolarHBondContact O-N 3.32Å
36	L	98.4	Very high	97.4	Very high	118 Å²	118	99.6 Å²	99.6	62%	0.618	53%	0.534	S	S	*	.	H	α-helix	trans	-63.7	-44.1	175.4	-72.8	172.4	0	0	0	112.2	A32 A33 A34 F39 C40	A32-L36 WeakPolarHBondContact O-CB 3.26Å; A32-L36 VanDerWaalsContact O-CG 3.26Å; A32-L36 WeakPolarHBondContact O-CG 3.46Å; A32-L36 PolarHBondContact O-N 2.99Å; A33-L36 PolarHBondContact O-N 2.92Å; A34-L36 PolarHBondContact O-N 3.5Å; L36-F39 PolarHBondContact O-N 2.99Å; L36-C40 PolarHBondContact O-N 3.5Å; L36-C40 PolarHBondContact O-SG 3.32Å; L36-C40 VanDerWaalsContact O-SG 3.32Å
37	M	98	Very high	97.3	Very high	110 Å²	110	93.8 Å²	93.8	54%	0.542	52%	0.517	S	S	.	.	H	α-helix	trans	-62.7	-47.6	178.3	-174.3	177.2	76.8	0	0	111.1	A33 A34 F39 C40 E41	A33-M37 WeakPolarHBondContact O-CB 3.48Å; A33-M37 PolarHBondContact O-N 3.01Å; A34-M37 PolarHBondContact O-N 3.44Å; M37-F39 VanDerWaalsContact C-N 3.29Å; M37-F39 PolarHBondContact O-N 3.2Å; M37-C40 PolarHBondContact O-N 3.37Å; M37-E41 HydrophobicContact CG-CG 4.46Å; M37-E41 WeakPolarHBondContact O-CG 3.36Å; M37-E41 PolarHBondContact O-N 2.88Å
38	A	98.4	Very high	97.1	Very high	52 Å²	52	92.4 Å²	92.4	43%	0.43	52%	0.516	S	S	.	.	H	α-helix	trans	-59.9	-40.6	177.7	0	0	0	0	0	111.9	A34 A42	A34-A38 WeakPolarHBondContact O-CB 3.35Å; A34-A38 PolarHBondContact O-N 3.14Å; A38-A42 VanDerWaalsContact O-CB 3.31Å; A38-A42 WeakPolarHBondContact O-CB 3.31Å; A38-A42 PolarHBondContact O-N 3.23Å
39	F	98.3	Very high	96.9	Very high	129 Å²	129	93.8 Å²	93.8	57%	0.566	53%	0.525	S	S	*	.	H	α-helix	trans	-61.8	-49	175.2	-179.6	-92.8	0	0	0	111.6	D35 L36 M37 E41 A42 H43	D35-F39 WeakPolarHBondContact O-CB 3.45Å; D35-F39 PolarHBondContact O-N 3.32Å; L36-F39 PolarHBondContact O-N 2.99Å; M37-F39 VanDerWaalsContact C-N 3.29Å; M37-F39 PolarHBondContact O-N 3.2Å; F39-E41 PolarHBondContact O-N 3Å; F39-A42 PolarHBondContact O-N 2.82Å; F39-H43 AromaticContact CD2-CE1 3.57Å; F39-H43 AromaticContact CD2-ND1 3.72Å; F39-H43 AromaticContact CE2-CE1 3.29Å; F39-H43 WeakPolarHBondContact CE2-CE1 3.29Å; F39-H43 AromaticContact CE2-ND1 3.61Å; F39-H43 AromaticContact CE2-NE2 3.98Å; F39-H43 AromaticContact CZ-CE1 3.86Å; F39-H43 AromaticContact CZ-ND1 3.81Å; F39-H43 PolarHBondContact O-N 3.45Å; F39-H43 PolarHBondContact O-ND1 3.38Å
40	C	97.9	Very high	96.7	Very high	81 Å²	81	92.3 Å²	92.3	55%	0.547	52%	0.516	S	S	.	.	H	α-helix	trans	-60.8	-45.7	178.4	-70.1	0	0	0	0	111.7	L36 M37 A42 H43 A44	L36-C40 PolarHBondContact O-N 3.5Å; L36-C40 PolarHBondContact O-SG 3.32Å; L36-C40 VanDerWaalsContact O-SG 3.32Å; M37-C40 PolarHBondContact O-N 3.37Å; C40-A42 VanDerWaalsContact C-N 3.35Å; C40-A42 PolarHBondContact O-N 3.37Å; C40-H43 PolarHBondContact O-N 2.84Å; C40-A44 WeakPolarHBondContact O-CA 3.26Å; C40-A44 VanDerWaalsContact O-CB 3.26Å; C40-A44 WeakPolarHBondContact O-CB 3.49Å; C40-A44 PolarHBondContact O-N 2.94Å
41	E	96.5	Very high	96.4	Very high	126 Å²	126	91.2 Å²	91.2	59%	0.589	51%	0.506	S	S	*	.	H	α-helix	trans	-62.6	-40	179.1	-73.1	177	172.7	0	0	112.6	M37 F39 H43	M37-E41 HydrophobicContact CG-CG 4.46Å; M37-E41 WeakPolarHBondContact O-CG 3.36Å; M37-E41 PolarHBondContact O-N 2.88Å; F39-E41 PolarHBondContact O-N 3Å; E41-H43 VanDerWaalsContact C-N 3.31Å; E41-H43 PolarHBondContact O-N 3.43Å
42	A	97.3	Very high	96	Very high	66 Å²	66	90.4 Å²	90.4	55%	0.545	51%	0.514	S	S	.	.	H	α-helix	trans	-63.6	-36	178.3	0	0	0	0	0	112.4	A38 F39 C40	A38-A42 VanDerWaalsContact O-CB 3.31Å; A38-A42 WeakPolarHBondContact O-CB 3.31Å; A38-A42 PolarHBondContact O-N 3.23Å; F39-A42 PolarHBondContact O-N 2.82Å; C40-A42 VanDerWaalsContact C-N 3.35Å; C40-A42 PolarHBondContact O-N 3.37Å
43	H	96.8	Very high	95.7	Very high	80 Å²	80	91.7 Å²	91.7	37%	0.37	52%	0.518	S	S	.	.	H	α-helix	trans	-103.1	-7.7	-174.5	-59.7	85.2	0	0	0	114.1	F39 C40 E41 K45 E46 D47	F39-H43 AromaticContact CD2-CE1 3.57Å; F39-H43 AromaticContact CD2-ND1 3.72Å; F39-H43 AromaticContact CE2-CE1 3.29Å; F39-H43 WeakPolarHBondContact CE2-CE1 3.29Å; F39-H43 AromaticContact CE2-ND1 3.61Å; F39-H43 AromaticContact CE2-NE2 3.98Å; F39-H43 AromaticContact CZ-CE1 3.86Å; F39-H43 AromaticContact CZ-ND1 3.81Å; F39-H43 PolarHBondContact O-N 3.45Å; F39-H43 PolarHBondContact O-ND1 3.38Å; C40-H43 PolarHBondContact O-N 2.84Å; E41-H43 VanDerWaalsContact C-N 3.31Å; E41-H43 PolarHBondContact O-N 3.43Å; H43-K45 PolarHBondContact O-N 2.9Å; H43-K45 VanDerWaalsContact O-N 3.08Å; H43-E46 PolarHBondContact O-N 3.29Å; H43-D47 PolarHBondContact O-N 3.24Å
44	A	95.4	Very high	95.3	Very high	33 Å²	33	92.5 Å²	92.5	27%	0.273	52%	0.519	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.4	-28.6	-176.9	0	0	0	0	0	114	C40 E46 V50 T51	C40-A44 WeakPolarHBondContact O-CA 3.26Å; C40-A44 VanDerWaalsContact O-CB 3.26Å; C40-A44 WeakPolarHBondContact O-CB 3.49Å; C40-A44 PolarHBondContact O-N 2.94Å; A44-E46 VanDerWaalsContact C-N 3.34Å; A44-V50 HydrophobicContact CB-CG1 4.36Å; A44-T51 PolarHBondContact O-OG1 3.26Å
45	K	93	Very high	94.7	Very high	177 Å²	177	93.6 Å²	93.6	77%	0.77	52%	0.524	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.4	-25	177.8	-66.4	-178.5	-178.5	174	0	113.2	H43	H43-K45 PolarHBondContact O-N 2.9Å; H43-K45 VanDerWaalsContact O-N 3.08Å
46	E	93.6	Very high	94.3	Very high	149 Å²	149	93.9 Å²	93.9	70%	0.696	53%	0.533	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.5	-16.6	-178.7	-61.8	179.4	-175.5	0	0	111.8	H43 A44 P48	H43-E46 PolarHBondContact O-N 3.29Å; A44-E46 VanDerWaalsContact C-N 3.34Å; E46-P48 WeakPolarHBondContact O-CD 3.48Å
47	D	95.8	Very high	93.8	Very high	64 Å²	64	94.5 Å²	94.5	34%	0.342	53%	0.532	S	S	.	.			trans	-76.2	110.3	175.1	-173.3	-27.5	0	0	0	110.5	H43 L49 V50 T51	H43-D47 PolarHBondContact O-N 3.24Å; D47-L49 PolarHBondContact O-N 2.85Å; D47-L49 VanDerWaalsContact O-N 3.17Å; D47-L49 WeakPolarHBondContact OD1-CA 3.31Å; D47-L49 VanDerWaalsContact OD1-CB 3.31Å; D47-L49 WeakPolarHBondContact OD1-CB 3.47Å; D47-L49 PolarHBondContact OD1-N 3.08Å; D47-V50 HydrophobicContact CB-CB 4.06Å; D47-V50 HydrophobicContact CB-CG2 4.05Å; D47-V50 PolarHBondContact O-N 3.2Å; D47-V50 PolarHBondContact OD1-N 3.37Å; D47-V50 WeakPolarHBondContact OD2-CG2 3.15Å; D47-T51 PolarHBondContact O-N 3.17Å
48	P	93.6	Very high	93.5	Very high	72 Å²	72	92.2 Å²	92.2	47%	0.468	52%	0.522	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67	-15.8	-178	-21.3	36.4	0	0	0	114.3	E46 T51 V53	E46-P48 WeakPolarHBondContact O-CD 3.48Å; P48-T51 CarbonylContact C-O 3.59Å; P48-T51 WeakPolarHBondContact CA-O 3.49Å; P48-V53 HydrophobicContact CB-CG1 3.88Å; P48-V53 HydrophobicContact CB-CG2 4.39Å; P48-V53 HydrophobicContact CG-CG1 4.3Å
49	L	93.4	Very high	93.1	Very high	164 Å²	164	95 Å²	95	86%	0.859	54%	0.536	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.7	-28.7	178.4	-58.1	179.5	0	0	0	111.8	D47	D47-L49 PolarHBondContact O-N 2.85Å; D47-L49 VanDerWaalsContact O-N 3.17Å; D47-L49 WeakPolarHBondContact OD1-CA 3.31Å; D47-L49 VanDerWaalsContact OD1-CB 3.31Å; D47-L49 WeakPolarHBondContact OD1-CB 3.47Å; D47-L49 PolarHBondContact OD1-N 3.08Å
50	V	94.1	Very high	92.6	Very high	93 Å²	93	97.8 Å²	97.8	56%	0.564	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.7	-46.7	175	178.1	0	0	0	0	110.5	A44 D47 P52	A44-V50 HydrophobicContact CB-CG1 4.36Å; D47-V50 HydrophobicContact CB-CB 4.06Å; D47-V50 HydrophobicContact CB-CG2 4.05Å; D47-V50 PolarHBondContact O-N 3.2Å; D47-V50 PolarHBondContact OD1-N 3.37Å; D47-V50 WeakPolarHBondContact OD2-CG2 3.15Å; V50-P52 WeakPolarHBondContact O-CD 3.43Å
51	T	92.4	Very high	92	Very high	62 Å²	62	100.5 Å²	100.5	38%	0.38	55%	0.547	S	S	.	.	T	Hydrogen-bonded Turn	trans	-112.4	99.5	176.2	-54.1	0	0	0	0	108.8	A44 D47 P48 V53	A44-T51 PolarHBondContact O-OG1 3.26Å; D47-T51 PolarHBondContact O-N 3.17Å; P48-T51 CarbonylContact C-O 3.59Å; P48-T51 WeakPolarHBondContact CA-O 3.49Å; T51-V53 PolarHBondContact O-N 2.84Å
52	P	89.8	Confident	91.3	Very high	110 Å²	110	102.8 Å²	102.8	71%	0.714	56%	0.558	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.1	127.8	-175.6	-25.8	34.6	0	0	0	112.4	V50	V50-P52 WeakPolarHBondContact O-CD 3.43Å
53	V	91.1	Very high	90.2	Very high	55 Å²	55	107.6 Å²	107.6	33%	0.333	57%	0.566	S	S	.	*	P	Polyproline II helix	trans	-76.9	154.2	175.3	-64	0	0	0	0	111.4	P48 T51 E57 N58	P48-V53 HydrophobicContact CB-CG1 3.88Å; P48-V53 HydrophobicContact CB-CG2 4.39Å; P48-V53 HydrophobicContact CG-CG1 4.3Å; T51-V53 PolarHBondContact O-N 2.84Å; V53-E57 HydrophobicContact CB-CB 4.35Å; V53-E57 HydrophobicContact CG2-CB 4.47Å; V53-N58 HydrophobicContact CG2-CB 4.2Å
54	P	91.1	Very high	88.8	Confident	69 Å²	69	112.6 Å²	112.6	45%	0.448	59%	0.587	S	S	.	*	P	Polyproline II helix	trans	-54.4	148.5	173.4	-25	34.4	0	0	0	112.2	S56 E57 N58	P54-S56 PolarHBondContact O-N 2.94Å; P54-E57 PolarHBondContact O-N 3.06Å; P54-N58 PolarHBondContact O-N 3.49Å; P54-N58 VanDerWaalsContact O-N 3.16Å
55	S	86.4	Confident	87.3	Confident	70 Å²	70	119.7 Å²	119.7	49%	0.49	61%	0.612	S	S	.	*	T	Hydrogen-bonded Turn	trans	-56.1	-30	-179.8	-57.6	0	0	0	0	113.6	E57 N58 R61	S55-E57 VanDerWaalsContact C-N 3.31Å; S55-E57 PolarHBondContact O-N 3.16Å; S55-N58 PolarHBondContact O-N 3.49Å; S55-R61 VanDerWaalsContact O-CB 3.29Å; S55-R61 WeakPolarHBondContact O-CB 3.23Å; S55-R61 WeakPolarHBondContact O-CD 3.41Å; S55-R61 WeakPolarHBondContact O-CG 3.17Å
56	S	88	Confident	85.5	Confident	92 Å²	92	120.3 Å²	120.3	64%	0.643	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.1	-30	176.2	44.8	0	0	0	0	114	P54	P54-S56 PolarHBondContact O-N 2.94Å
57	E	88.8	Confident	83.6	Confident	130 Å²	130	118.2 Å²	118.2	61%	0.607	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.6	-19	-179.4	-68.1	170.9	-144.6	0	0	111.7	V53 P54 S55 P59	V53-E57 HydrophobicContact CB-CB 4.35Å; V53-E57 HydrophobicContact CG2-CB 4.47Å; P54-E57 PolarHBondContact O-N 3.06Å; S55-E57 VanDerWaalsContact C-N 3.31Å; S55-E57 PolarHBondContact O-N 3.16Å; E57-P59 VanDerWaalsContact O-CD 3.23Å; E57-P59 WeakPolarHBondContact O-CD 3.4Å
58	N	91.3	Very high	82.1	Confident	63 Å²	63	119 Å²	119	34%	0.337	63%	0.631	S	S	.	*			trans	-73.7	112.8	175.8	-175.1	-7.4	0	0	0	111.2	V53 P54 S55 F60 R61	V53-N58 HydrophobicContact CG2-CB 4.2Å; P54-N58 PolarHBondContact O-N 3.49Å; P54-N58 VanDerWaalsContact O-N 3.16Å; S55-N58 PolarHBondContact O-N 3.49Å; N58-F60 PolarHBondContact O-N 3.09Å; N58-F60 VanDerWaalsContact O-N 3.16Å; N58-F60 WeakPolarHBondContact OD1-CA 3.29Å; N58-F60 WeakPolarHBondContact OD1-CB 3.33Å; N58-F60 PolarHBondContact OD1-N 2.86Å; N58-R61 WeakPolarHBondContact O-CB 3.46Å; N58-R61 PolarHBondContact O-N 3.16Å; N58-R61 VanDerWaalsContact O-N 3.09Å
59	P	89.8	Confident	80.4	Confident	109 Å²	109	123 Å²	123	71%	0.708	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.8	-18.6	178.4	28	-34.7	0	0	0	113.3	E57	E57-P59 VanDerWaalsContact O-CD 3.23Å; E57-P59 WeakPolarHBondContact O-CD 3.4Å
60	F	88.9	Confident	78.5	Confident	188 Å²	188	126.2 Å²	126.2	83%	0.825	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.9	11.5	177.2	-55.1	-77.2	0	0	0	113.5	N58	N58-F60 PolarHBondContact O-N 3.09Å; N58-F60 VanDerWaalsContact O-N 3.16Å; N58-F60 WeakPolarHBondContact OD1-CA 3.29Å; N58-F60 WeakPolarHBondContact OD1-CB 3.33Å; N58-F60 PolarHBondContact OD1-N 2.86Å
61	R	85.1	Confident	77.7	Confident	138 Å²	138	127.9 Å²	127.9	52%	0.521	67%	0.669	S	S	.	*	S	Bend	trans	-58.2	141.6	174.3	-170.7	-156.8	-170.7	155.7	-3.8	111	S55 N58 K63	S55-R61 VanDerWaalsContact O-CB 3.29Å; S55-R61 WeakPolarHBondContact O-CB 3.23Å; S55-R61 WeakPolarHBondContact O-CD 3.41Å; S55-R61 WeakPolarHBondContact O-CG 3.17Å; N58-R61 WeakPolarHBondContact O-CB 3.46Å; N58-R61 PolarHBondContact O-N 3.16Å; N58-R61 VanDerWaalsContact O-N 3.09Å; R61-K63 PolarHBondContact O-N 3.44Å; R61-K63 VanDerWaalsContact O-N 3.08Å
62	E	81	Confident	76.9	Confident	175 Å²	175	131.4 Å²	131.4	82%	0.818	68%	0.684	S	S	*	*	P	Polyproline II helix	trans	-51.9	116.4	164.3	-69.3	-175.3	175.4	0	0	111.1	K64	E62-K64 PolarHBondContact O-N 3.08Å
63	K	75.6	Confident	76.2	Confident	166 Å²	166	132.6 Å²	132.6	72%	0.722	68%	0.682	S	S	*	*	P	Polyproline II helix	trans	-78.3	116.4	167.2	-65.5	-178.9	-177.2	176.9	0	106.8	R61 F65	R61-K63 PolarHBondContact O-N 3.44Å; R61-K63 VanDerWaalsContact O-N 3.08Å; K63-F65 VanDerWaalsContact C-N 3.26Å; K63-F65 HydrophobicContact CB-CE2 4.34Å; K63-F65 WeakPolarHBondContact O-CD2 3.46Å; K63-F65 PolarHBondContact O-N 3.08Å
64	K	67	Low	75.3	Confident	185 Å²	185	137.1 Å²	137.1	80%	0.804	70%	0.703	S	S	*	*			trans	-63.5	94.8	164.2	-71.3	-169.3	177	-174.6	0	107.3	E62 F66	E62-K64 PolarHBondContact O-N 3.08Å; K64-F66 PolarHBondContact O-N 2.84Å; K64-F66 VanDerWaalsContact O-N 3.08Å
65	F	63.4	Low	74.3	Confident	182 Å²	182	141.4 Å²	141.4	80%	0.798	72%	0.719	S	S	*	*			trans	-65.6	106.6	167	-73	-81.7	0	0	0	107	K63 C67	K63-F65 VanDerWaalsContact C-N 3.26Å; K63-F65 HydrophobicContact CB-CE2 4.34Å; K63-F65 WeakPolarHBondContact O-CD2 3.46Å; K63-F65 PolarHBondContact O-N 3.08Å; F65-C67 PolarHBondContact O-N 2.97Å
66	F	55.6	Low	73.5	Confident	191 Å²	191	146.1 Å²	146.1	84%	0.838	73%	0.734	S	S	*	*			trans	-73.3	83.9	162	-70.6	-83.1	0	0	0	107.1	K64 A68	K64-F66 PolarHBondContact O-N 2.84Å; K64-F66 VanDerWaalsContact O-N 3.08Å; F66-A68 VanDerWaalsContact C-N 3.33Å; F66-A68 PolarHBondContact O-N 3.15Å; F66-A68 VanDerWaalsContact O-N 3.15Å
67	C	54.2	Low	72.5	Confident	104 Å²	104	150 Å²	150	70%	0.703	74%	0.74	S	S	*	*			trans	-73.7	96.3	160.5	-173.8	0	0	0	0	106.6	F65 I69	F65-C67 PolarHBondContact O-N 2.97Å; C67-I69 PolarHBondContact O-N 3.2Å
68	A	63	Low	71.2	Confident	81 Å²	81	151.5 Å²	151.5	67%	0.669	75%	0.75	S	S	*	*			trans	-79.6	107.6	155.9	0	0	0	0	0	106	F66 L70	F66-A68 VanDerWaalsContact C-N 3.33Å; F66-A68 PolarHBondContact O-N 3.15Å; F66-A68 VanDerWaalsContact O-N 3.15Å; A68-L70 PolarHBondContact O-N 3.48Å
69	I	58.9	Low	69.5	Low	157 Å²	157	158.9 Å²	158.9	81%	0.805	79%	0.785	S	S	*	*			trans	-70.6	107.4	162.7	-57.2	175.8	0	0	0	104.9	C67	C67-I69 PolarHBondContact O-N 3.2Å
70	L	51.9	Low	67.7	Low	231 Å²	231	163.5 Å²	163.5	100%	1.209	79%	0.792	S	S	*	*			trans	-77.9	0	169.1	-81.7	160.1	0	0	0	109.9	A68	A68-L70 PolarHBondContact O-N 3.48Å

Retrieved 70 of 70 residues in 54.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).