A0A060XGB8_ONCMY Loading...

Small nuclear ribonucleoprotein E

Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs. As part of the U7 snRNP it is involved in histone 3'-end processing.

AlphaFold DB (C1BXT1), UniProt , Accession A0A060XGB8, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene snrpe, Length 92 aa.

						>A0A060XGB8_ONCMY|A0A060XGB8|snrpe
MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEVHMKTKNRKPLGRIMLKGDNITLLQSVAT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49	Very low	58.2	Low	244 Å²	244	168.5 Å²	168.5	100%	1.202	87%	0.873	S	S	*	*				0	105.7	0	-70	173.9	-178.2	0	0	107.7
2	A	43.8	Very low	59.8	Low	102 Å²	102	171.3 Å²	171.3	84%	0.843	87%	0.873	S	S	*	*			trans	-87.4	121.8	-178.6	0	0	0	0	0	109.8	R4	A2-R4 PolarHBondContact O-N 2.88Å
3	Y	49.7	Very low	61.5	Low	239 Å²	239	167.5 Å²	167.5	94%	0.937	86%	0.863	S	S	*	*			trans	-63.1	105.3	173.6	-87.7	-94	0	0	0	109.5	G5	Y3-G5 PolarHBondContact O-N 2.82Å; Y3-G5 VanDerWaalsContact O-N 3.1Å
4	R	53.6	Low	63.3	Low	241 Å²	241	168.1 Å²	168.1	91%	0.909	86%	0.863	S	S	*	*			trans	-73.6	97.2	170.3	-156.6	177.4	-167.1	174.9	3.6	106.9	A2 Q6	A2-R4 PolarHBondContact O-N 2.88Å; R4-Q6 PolarHBondContact O-N 3.22Å
5	G	55.8	Low	65	Low	74 Å²	74	162 Å²	162	76%	0.763	84%	0.837	S	S	*	*			trans	-57.2	101.7	172.7	0	0	0	0	0	109.6	Y3 G7	Y3-G5 PolarHBondContact O-N 2.82Å; Y3-G5 VanDerWaalsContact O-N 3.1Å; G5-G7 PolarHBondContact O-N 3.35Å
6	Q	58.7	Low	66.8	Low	187 Å²	187	159.4 Å²	159.4	87%	0.874	82%	0.82	S	S	*	*			trans	-65	101.2	166.4	-78.1	178.9	-3.2	0	0	106.5	R4 Q8	R4-Q6 PolarHBondContact O-N 3.22Å; Q6-Q8 PolarHBondContact O-N 2.75Å
7	G	62.5	Low	68.4	Low	66 Å²	66	155.6 Å²	155.6	68%	0.68	81%	0.807	S	S	*	*			trans	-52.7	116.7	168.3	0	0	0	0	0	108.1	G5 K9	G5-G7 PolarHBondContact O-N 3.35Å; G7-K9 PolarHBondContact O-N 3.33Å
8	Q	62.7	Low	69.9	Low	187 Å²	187	151.6 Å²	151.6	87%	0.874	79%	0.786	S	S	*	*			trans	-53.7	111.6	173.2	-86.5	174.5	-37.4	0	0	107.2	Q6 V10	Q6-Q8 PolarHBondContact O-N 2.75Å; Q8-V10 VanDerWaalsContact C-N 3.27Å; Q8-V10 PolarHBondContact O-N 2.88Å
9	K	66	Low	71.2	Confident	203 Å²	203	147.9 Å²	147.9	88%	0.883	77%	0.768	S	S	*	*			trans	-65.3	95	170.9	-72.3	-177.4	178.3	-179.8	0	106.4	G7 Q11	G7-K9 PolarHBondContact O-N 3.33Å; K9-Q11 PolarHBondContact O-N 3Å
10	V	68.8	Low	72.4	Confident	132 Å²	132	143.9 Å²	143.9	80%	0.8	75%	0.747	S	S	*	*			trans	-61.2	107	173.1	-177	0	0	0	0	106.6	Q8 K12	Q8-V10 VanDerWaalsContact C-N 3.27Å; Q8-V10 PolarHBondContact O-N 2.88Å; V10-K12 PolarHBondContact O-N 2.91Å; V10-K12 VanDerWaalsContact O-N 3.15Å
11	Q	70.1	Confident	73.5	Confident	179 Å²	179	137.3 Å²	137.3	84%	0.836	71%	0.713	S	S	*	*			trans	-72	110.7	176	-151.3	167.6	19.5	0	0	106.6	K9 V13	K9-Q11 PolarHBondContact O-N 3Å; Q11-V13 PolarHBondContact O-N 2.89Å
12	K	77.6	Confident	75.8	Confident	201 Å²	201	130 Å²	130	87%	0.874	68%	0.675	S	S	*	*			trans	-68.3	107.5	-176.7	-158.1	174.9	-173.5	178.6	0	107.9	V10 M14	V10-K12 PolarHBondContact O-N 2.91Å; V10-K12 VanDerWaalsContact O-N 3.15Å; K12-M14 PolarHBondContact O-N 3.35Å
13	V	80.8	Confident	78.2	Confident	123 Å²	123	131.8 Å²	131.8	75%	0.745	66%	0.66	S	S	*	*			trans	-59.8	126	177	179.9	0	0	0	0	108.3	Q11	Q11-V13 PolarHBondContact O-N 2.89Å
14	M	87.2	Confident	80.5	Confident	176 Å²	176	121.7 Å²	121.7	87%	0.867	62%	0.62	S	S	*	*			trans	-75.5	124.9	173.7	-172	179.9	-69.2	0	0	108.5	K12	K12-M14 PolarHBondContact O-N 3.35Å
15	V	89.4	Confident	82.5	Confident	76 Å²	76	112.7 Å²	112.7	46%	0.461	59%	0.59	S	S	.	*			trans	-105.8	133.1	-176.6	-178.1	0	0	0	0	108.7	N19	V15-N19 HydrophobicContact CG1-CB 3.65Å
16	Q	93.8	Very high	84.4	Confident	121 Å²	121	116.3 Å²	116.3	57%	0.565	59%	0.587	S	S	*	*			trans	-64.5	140.3	173.2	-67.2	-64.1	-26	0	0	110.3	I18 N19	Q16-I18 HydrophobicContact CB-CG2 4.24Å; Q16-I18 PolarHBondContact O-N 2.9Å; Q16-N19 WeakPolarHBondContact O-CB 3.36Å; Q16-N19 PolarHBondContact O-N 3.34Å
17	P	93.5	Very high	86.2	Confident	94 Å²	94	112.4 Å²	112.4	61%	0.61	57%	0.572	S	S	*	*	H	α-helix	trans	-55.5	-37.8	-177.6	-28	35.4	0	0	0	113.8	N19 L20 I21	P17-N19 PolarHBondContact O-N 3.5Å; P17-L20 VanDerWaalsContact O-CB 3.29Å; P17-L20 WeakPolarHBondContact O-CB 3.35Å; P17-L20 PolarHBondContact O-N 2.96Å; P17-I21 PolarHBondContact O-N 3.34Å
18	I	95.9	Very high	87.7	Confident	83 Å²	83	117.9 Å²	117.9	43%	0.426	57%	0.572	S	S	.	*	H	α-helix	trans	-59.3	-36.1	177.4	-160.9	175.2	0	0	0	112	Q16 L20 I21 F22 F50	Q16-I18 HydrophobicContact CB-CG2 4.24Å; Q16-I18 PolarHBondContact O-N 2.9Å; I18-L20 PolarHBondContact O-N 3.46Å; I18-I21 PolarHBondContact O-N 3.23Å; I18-F22 HydrophobicContact CD1-CE2 3.83Å; I18-F22 HydrophobicContact CG1-CD2 3.93Å; I18-F22 HydrophobicContact CG1-CE2 3.63Å; I18-F22 WeakPolarHBondContact O-CD2 3.4Å; I18-F22 PolarHBondContact O-N 3.03Å; I18-F50 HydrophobicContact CD1-CE2 4.24Å; I18-F50 HydrophobicContact CG1-CE2 4Å; I18-F50 HydrophobicContact CG1-CZ 4.2Å
19	N	95	Very high	89.3	Confident	82 Å²	82	110.3 Å²	110.3	44%	0.439	54%	0.539	S	S	.	.	H	α-helix	trans	-67.7	-27.8	177.7	-65.4	-12.8	0	0	0	111.8	V15 Q16 P17 R23	V15-N19 HydrophobicContact CG1-CB 3.65Å; Q16-N19 WeakPolarHBondContact O-CB 3.36Å; Q16-N19 PolarHBondContact O-N 3.34Å; P17-N19 PolarHBondContact O-N 3.5Å; N19-R23 WeakPolarHBondContact O-CB 3.19Å; N19-R23 PolarHBondContact O-N 3.16Å
20	L	94.4	Very high	90.8	Very high	67 Å²	67	103.2 Å²	103.2	35%	0.351	51%	0.507	S	S	.	.	H	α-helix	trans	-70.8	-41.1	174.1	-172	67.1	0	0	0	111.1	P17 I18 R23 Y24	P17-L20 VanDerWaalsContact O-CB 3.29Å; P17-L20 WeakPolarHBondContact O-CB 3.35Å; P17-L20 PolarHBondContact O-N 2.96Å; I18-L20 PolarHBondContact O-N 3.46Å; L20-R23 WeakPolarHBondContact O-CB 3.16Å; L20-R23 PolarHBondContact O-N 2.95Å; L20-Y24 HydrophobicContact CD1-CE1 4.19Å; L20-Y24 HydrophobicContact CD1-CE2 4.43Å; L20-Y24 HydrophobicContact CD2-CE2 4.11Å; L20-Y24 HydrophobicContact CG-CD2 4.47Å; L20-Y24 HydrophobicContact CG-CE1 4.39Å; L20-Y24 HydrophobicContact CG-CE2 3.76Å; L20-Y24 WeakPolarHBondContact O-CD2 3.43Å; L20-Y24 PolarHBondContact O-N 2.98Å
21	I	95.7	Very high	92.1	Very high	7 Å²	7	97 Å²	97	4%	0.036	47%	0.469	C	S	.	.	H	α-helix	trans	-64.9	-44.6	175.6	-57.6	168.7	0	0	0	110.4	P17 I18 R23 Y24 L25 I47 F50 M54 L87	P17-I21 PolarHBondContact O-N 3.34Å; I18-I21 PolarHBondContact O-N 3.23Å; I21-R23 VanDerWaalsContact C-N 3.27Å; I21-R23 PolarHBondContact O-N 2.86Å; I21-Y24 PolarHBondContact O-N 2.85Å; I21-Y24 VanDerWaalsContact O-N 3.1Å; I21-L25 PolarHBondContact O-N 3.15Å; I21-I47 HydrophobicContact CG2-CD1 4.04Å; I21-F50 HydrophobicContact CG2-CB 4.49Å; I21-F50 HydrophobicContact CG2-CD1 3.66Å; I21-F50 HydrophobicContact CG2-CD2 4.29Å; I21-F50 HydrophobicContact CG2-CE1 3.83Å; I21-F50 HydrophobicContact CG2-CE2 4.44Å; I21-F50 HydrophobicContact CG2-CG 3.9Å; I21-F50 HydrophobicContact CG2-CZ 4.21Å; I21-M54 HydrophobicContact CD1-CE 3.26Å; I21-M54 HydrophobicContact CD1-SD 3.38Å; I21-M54 WeakPolarHBondContact CD1-SD 3.4Å; I21-M54 HydrophobicContact CG1-CE 4.46Å; I21-L87 HydrophobicContact CD1-CD1 4.43Å; I21-L87 HydrophobicContact CG1-CD1 4.2Å
22	F	96.5	Very high	93.4	Very high	91 Å²	91	89.1 Å²	89.1	40%	0.399	43%	0.433	S	S	.	.	H	α-helix	trans	-55.8	-42.7	172.8	-83	-61.5	0	0	0	111.9	I18 Y24 L25 Q26 F50	I18-F22 HydrophobicContact CD1-CE2 3.83Å; I18-F22 HydrophobicContact CG1-CD2 3.93Å; I18-F22 HydrophobicContact CG1-CE2 3.63Å; I18-F22 WeakPolarHBondContact O-CD2 3.4Å; I18-F22 PolarHBondContact O-N 3.03Å; F22-Y24 PolarHBondContact O-N 3.28Å; F22-L25 PolarHBondContact O-N 3.23Å; F22-Q26 WeakPolarHBondContact O-CB 3.35Å; F22-Q26 WeakPolarHBondContact O-CG 3.36Å; F22-Q26 PolarHBondContact O-N 3.49Å; F22-F50 AromaticContact CD1-CE1 3.78Å; F22-F50 HydrophobicContact CD1-CE1 3.78Å; F22-F50 AromaticContact CD1-CZ 3.76Å; F22-F50 HydrophobicContact CD1-CZ 3.76Å; F22-F50 HydrophobicContact CD2-CZ 4.09Å; F22-F50 AromaticContact CE1-CE1 3.76Å; F22-F50 HydrophobicContact CE1-CE1 3.76Å; F22-F50 AromaticContact CE1-CZ 3.48Å; F22-F50 HydrophobicContact CE1-CZ 3.48Å; F22-F50 VanDerWaalsContact CE1-CZ 3.48Å; F22-F50 AromaticContact CE2-CZ 3.83Å; F22-F50 HydrophobicContact CE2-CZ 3.83Å; F22-F50 HydrophobicContact CG-CE1 4.29Å; F22-F50 HydrophobicContact CG-CZ 4.05Å; F22-F50 HydrophobicContact CZ-CE1 4.28Å; F22-F50 HydrophobicContact CZ-CE2 4.4Å; F22-F50 AromaticContact CZ-CZ 3.52Å; F22-F50 HydrophobicContact CZ-CZ 3.52Å
23	R	95.6	Very high	94.4	Very high	138 Å²	138	79.6 Å²	79.6	52%	0.521	39%	0.391	S	S	.	.	H	α-helix	trans	-62	-42.7	175.6	-179.4	-178	-72.4	179.4	-3.7	111.9	N19 L20 I21 L25 Q26 N27	N19-R23 WeakPolarHBondContact O-CB 3.19Å; N19-R23 PolarHBondContact O-N 3.16Å; L20-R23 WeakPolarHBondContact O-CB 3.16Å; L20-R23 PolarHBondContact O-N 2.95Å; I21-R23 VanDerWaalsContact C-N 3.27Å; I21-R23 PolarHBondContact O-N 2.86Å; R23-L25 VanDerWaalsContact C-N 3.35Å; R23-Q26 PolarHBondContact O-N 2.96Å; R23-N27 VanDerWaalsContact O-CB 3.28Å; R23-N27 WeakPolarHBondContact O-CB 3.45Å; R23-N27 PolarHBondContact O-N 3.34Å
24	Y	96.1	Very high	95.2	Very high	27 Å²	27	78 Å²	78	11%	0.106	37%	0.372	C	S	.	.	H	α-helix	trans	-63.4	-40.5	177.2	-64.3	-31.5	0	0	0	112.4	L20 I21 F22 R28 S29 I31 I47	L20-Y24 HydrophobicContact CD1-CE1 4.19Å; L20-Y24 HydrophobicContact CD1-CE2 4.43Å; L20-Y24 HydrophobicContact CD2-CE2 4.11Å; L20-Y24 HydrophobicContact CG-CD2 4.47Å; L20-Y24 HydrophobicContact CG-CE1 4.39Å; L20-Y24 HydrophobicContact CG-CE2 3.76Å; L20-Y24 WeakPolarHBondContact O-CD2 3.43Å; L20-Y24 PolarHBondContact O-N 2.98Å; I21-Y24 PolarHBondContact O-N 2.85Å; I21-Y24 VanDerWaalsContact O-N 3.1Å; F22-Y24 PolarHBondContact O-N 3.28Å; Y24-R28 WeakPolarHBondContact O-CA 3.47Å; Y24-R28 PolarHBondContact O-N 3.47Å; Y24-S29 PolarHBondContact O-N 3.34Å; Y24-I31 HydrophobicContact CD1-CG2 4.19Å; Y24-I31 HydrophobicContact CD2-CG2 3.74Å; Y24-I31 HydrophobicContact CE2-CG2 4.19Å; Y24-I31 HydrophobicContact CG-CG2 3.74Å; Y24-I47 HydrophobicContact CD2-CD1 4.46Å
25	L	96.4	Very high	95.7	Very high	53 Å²	53	70.6 Å²	70.6	28%	0.277	34%	0.336	S	S	.	.	H	α-helix	trans	-64.1	-50	175.1	-175.2	156	0	0	0	111.4	I21 F22 R23 N27 R28 I47 F50	I21-L25 PolarHBondContact O-N 3.15Å; F22-L25 PolarHBondContact O-N 3.23Å; R23-L25 VanDerWaalsContact C-N 3.35Å; L25-N27 PolarHBondContact O-N 3.17Å; L25-R28 PolarHBondContact O-N 2.85Å; L25-I47 HydrophobicContact CB-CB 4.49Å; L25-I47 HydrophobicContact CB-CG2 4.36Å; L25-I47 HydrophobicContact CD1-CG2 4.29Å; L25-F50 HydrophobicContact CD1-CD1 3.93Å; L25-F50 HydrophobicContact CD1-CE1 4.12Å
26	Q	96.1	Very high	96.1	Very high	149 Å²	149	73.7 Å²	73.7	70%	0.696	34%	0.34	S	S	*	.	H	α-helix	trans	-63.4	-43.5	-178.4	-75.5	-179.9	-21.3	0	0	112.7	F22 R23 R28	F22-Q26 WeakPolarHBondContact O-CB 3.35Å; F22-Q26 WeakPolarHBondContact O-CG 3.36Å; F22-Q26 PolarHBondContact O-N 3.49Å; R23-Q26 PolarHBondContact O-N 2.96Å; Q26-R28 PolarHBondContact O-N 2.79Å
27	N	95.9	Very high	96.1	Very high	105 Å²	105	75.7 Å²	75.7	56%	0.561	35%	0.35	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.1	-2.6	-179.1	-68.1	-8.3	0	0	0	112.9	R23 L25 S29	R23-N27 VanDerWaalsContact O-CB 3.28Å; R23-N27 WeakPolarHBondContact O-CB 3.45Å; R23-N27 PolarHBondContact O-N 3.34Å; L25-N27 PolarHBondContact O-N 3.17Å; N27-S29 WeakPolarHBondContact CB-OG 3.23Å; N27-S29 PolarHBondContact O-N 3.06Å; N27-S29 VanDerWaalsContact O-N 3.15Å
28	R	95.2	Very high	96.1	Very high	182 Å²	182	75.1 Å²	75.1	69%	0.687	34%	0.339	S	S	*	.	T	Hydrogen-bonded Turn	trans	44.4	42.8	-167.3	-63.4	-157.8	177.8	-165.1	1.5	112.1	Y24 L25 Q26 R30	Y24-R28 WeakPolarHBondContact O-CA 3.47Å; Y24-R28 PolarHBondContact O-N 3.47Å; L25-R28 PolarHBondContact O-N 2.85Å; Q26-R28 PolarHBondContact O-N 2.79Å; R28-R30 PolarHBondContact O-N 2.85Å
29	S	95.3	Very high	96	Very high	27 Å²	27	76.6 Å²	76.6	19%	0.189	35%	0.351	C	S	.	.			trans	-68.8	133.3	-179.2	-58.5	0	0	0	0	109.4	Y24 N27 I31	Y24-S29 PolarHBondContact O-N 3.34Å; N27-S29 WeakPolarHBondContact CB-OG 3.23Å; N27-S29 PolarHBondContact O-N 3.06Å; N27-S29 VanDerWaalsContact O-N 3.15Å; S29-I31 PolarHBondContact O-N 2.95Å
30	R	96.8	Very high	96	Very high	55 Å²	55	75.9 Å²	75.9	21%	0.208	35%	0.347	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.3	124.8	168.6	-163.3	171.9	-168.7	85.1	7.3	108	R28 D60 E62 V90	R28-R30 PolarHBondContact O-N 2.85Å; R30-D60 PolarHBondContact NH1-O 3.24Å; R30-D60 PolarHBondContact NH2-O 2.98Å; R30-E62 IonicContact CZ-OE2 3.97Å; R30-E62 IonicContact NE-OE2 3.85Å; R30-E62 IonicContact NH2-OE2 2.88Å; R30-E62 PolarHBondContact NH2-OE2 2.79Å; R30-V90 HydrophobicContact CB-CG2 3.75Å; R30-V90 HydrophobicContact CG-CG2 3.75Å; R30-V90 WeakPolarHBondContact O-CG2 3.28Å; R30-V90 PolarHBondContact O-N 3.12Å; R30-V90 VanDerWaalsContact O-N 3.09Å
31	I	97.5	Very high	96.1	Very high	0 Å²	0	74.2 Å²	74.2	0%	0	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.9	155.9	178.9	59.7	148.4	0	0	0	109.9	Y24 S29 V33 E44 G45 I47 L56 L58 L87 Q88	Y24-I31 HydrophobicContact CD1-CG2 4.19Å; Y24-I31 HydrophobicContact CD2-CG2 3.74Å; Y24-I31 HydrophobicContact CE2-CG2 4.19Å; Y24-I31 HydrophobicContact CG-CG2 3.74Å; S29-I31 PolarHBondContact O-N 2.95Å; I31-V33 HydrophobicContact CD1-CG2 3.86Å; I31-E44 CarbonylContact O-C 3.57Å; I31-E44 WeakPolarHBondContact O-CA 3.42Å; I31-G45 VanDerWaalsContact CG1-O 3.3Å; I31-G45 WeakPolarHBondContact CG1-O 3.46Å; I31-G45 PolarHBondContact N-O 2.79Å; I31-G45 PolarHBondContact O-N 3Å; I31-I47 HydrophobicContact CD1-CD1 3.67Å; I31-I47 HydrophobicContact CD1-CG1 3.55Å; I31-I47 HydrophobicContact CG1-CD1 4.37Å; I31-I47 HydrophobicContact CG1-CG1 3.93Å; I31-L56 HydrophobicContact CD1-CD1 4.29Å; I31-L58 HydrophobicContact CD1-CD2 4.19Å; I31-L58 HydrophobicContact CG1-CD2 4.48Å; I31-L87 HydrophobicContact CD1-CD2 3.99Å; I31-Q88 CarbonylContact C-O 3.44Å; I31-Q88 VanDerWaalsContact CA-O 3.29Å; I31-Q88 WeakPolarHBondContact CA-O 3.33Å
32	Q	97.6	Very high	96.2	Very high	15 Å²	15	76.2 Å²	76.2	7%	0.07	35%	0.345	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.1	125.8	169.6	-174.3	-178.8	84.2	0	0	108.7	R42 I43 E44 Q88 V90	Q32-R42 HydrophobicContact CG-CB 3.82Å; Q32-R42 HydrophobicContact CG-CG 4.36Å; Q32-I43 CarbonylContact C-O 3.55Å; Q32-I43 WeakPolarHBondContact CA-O 3.47Å; Q32-E44 HydrophobicContact CB-CG 3.78Å; Q32-E44 HydrophobicContact CG-CG 3.75Å; Q32-E44 PolarHBondContact NE2-OE1 3.1Å; Q32-Q88 PolarHBondContact N-O 3.26Å; Q32-Q88 PolarHBondContact O-N 2.86Å; Q32-V90 HydrophobicContact CB-CG1 3.76Å
33	V	97.9	Very high	96.2	Very high	0 Å²	0	72.3 Å²	72.3	0%	0	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102	123.2	177.4	-169.2	0	0	0	0	109	I31 R42 I43 L58 L79 I84 L86 L87	I31-V33 HydrophobicContact CD1-CG2 3.86Å; V33-R42 WeakPolarHBondContact O-CA 3.38Å; V33-R42 WeakPolarHBondContact O-CB 3.33Å; V33-I43 HydrophobicContact CB-CB 4.35Å; V33-I43 PolarHBondContact N-O 3.34Å; V33-I43 PolarHBondContact O-N 3.19Å; V33-L58 HydrophobicContact CG2-CD1 4.36Å; V33-L79 HydrophobicContact CB-CD2 4.05Å; V33-L79 HydrophobicContact CG1-CD2 3.65Å; V33-L79 HydrophobicContact CG2-CD2 4.06Å; V33-I84 HydrophobicContact CG1-CB 4.34Å; V33-I84 HydrophobicContact CG1-CG1 3.98Å; V33-I84 HydrophobicContact CG1-CG2 4.02Å; V33-L86 WeakPolarHBondContact CA-O 3.25Å; V33-L87 HydrophobicContact CB-CD2 4.2Å; V33-L87 HydrophobicContact CG1-CD2 3.9Å; V33-L87 HydrophobicContact CG2-CD2 3.66Å
34	W	97.8	Very high	96.4	Very high	89 Å²	89	66.5 Å²	66.5	34%	0.337	31%	0.307	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.6	129.8	171	-65.9	39	0	0	0	108	R42 T85 L86	W34-R42 VanDerWaalsContact CH2-NH2 3.26Å; W34-T85 WeakPolarHBondContact O-CB 3.46Å; W34-T85 PolarHBondContact O-N 3.47Å; W34-L86 HydrophobicContact CB-CB 4Å; W34-L86 HydrophobicContact CD2-CB 4.41Å; W34-L86 HydrophobicContact CG-CB 4.03Å; W34-L86 HydrophobicContact CG-CD2 4.36Å; W34-L86 PolarHBondContact N-O 3.41Å
35	L	97.8	Very high	96.4	Very high	22 Å²	22	65.2 Å²	65.2	12%	0.115	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.6	151	-175.7	-62.1	176.8	0	0	0	111.2	Q38 M41 I43 L79 N83 T85	L35-Q38 HydrophobicContact CB-CB 3.99Å; L35-Q38 HydrophobicContact CD1-CB 4.46Å; L35-Q38 HydrophobicContact CD1-CG 4.35Å; L35-M41 HydrophobicContact CD1-CE 3.46Å; L35-M41 VanDerWaalsContact CD1-CE 3.46Å; L35-I43 HydrophobicContact CD1-CG1 4.2Å; L35-I43 HydrophobicContact CD2-CG1 4.06Å; L35-I43 HydrophobicContact CG-CG1 4.43Å; L35-L79 HydrophobicContact CD2-CD1 4.17Å; L35-L79 HydrophobicContact CD2-CD2 4.48Å; L35-N83 CarbonylContact C-O 3.53Å; L35-N83 WeakPolarHBondContact CA-O 3.49Å; L35-N83 HydrophobicContact CD2-CB 4.46Å; L35-T85 VanDerWaalsContact C-OG1 3.28Å; L35-T85 PolarHBondContact O-OG1 3.06Å; L35-T85 VanDerWaalsContact O-OG1 3.09Å
36	Y	96.6	Very high	96.5	Very high	141 Å²	141	63.8 Å²	63.8	55%	0.553	30%	0.296	S	S	*	.	S	Bend	trans	-66.3	133.7	170.6	-173.1	-108	0	0	0	109.9	Q38 N83 T85	Y36-Q38 PolarHBondContact O-N 2.79Å; Y36-N83 PolarHBondContact N-O 2.9Å; Y36-T85 VanDerWaalsContact CA-OG1 3.28Å; Y36-T85 WeakPolarHBondContact CA-OG1 3.42Å; Y36-T85 PolarHBondContact N-OG1 2.82Å
37	E	94.5	Very high	96.6	Very high	163 Å²	163	56.7 Å²	56.7	76%	0.762	26%	0.263	S	S	*	.	S	Bend	trans	57.8	-16	-177.5	-68.5	178.7	170	0	0	117.3
38	Q	93.1	Very high	96.7	Very high	81 Å²	81	54.7 Å²	54.7	38%	0.379	25%	0.252	S	S	.	.			trans	-101	92.9	-179.5	-179.6	62.6	-77.3	0	0	111.4	L35 Y36 M41	L35-Q38 HydrophobicContact CB-CB 3.99Å; L35-Q38 HydrophobicContact CD1-CB 4.46Å; L35-Q38 HydrophobicContact CD1-CG 4.35Å; Y36-Q38 PolarHBondContact O-N 2.79Å; Q38-M41 HydrophobicContact CG-CB 3.83Å; Q38-M41 HydrophobicContact CG-CE 4.4Å
39	V	93.8	Very high	96.8	Very high	114 Å²	114	47 Å²	47	69%	0.691	23%	0.229	S	C	*	.			trans	-82.8	-19.9	-179.3	-62.3	0	0	0	0	114.2
40	N	95.3	Very high	97	Very high	67 Å²	67	48.1 Å²	48.1	36%	0.358	23%	0.231	S	C	.	.	S	Bend	trans	-85.1	-14.7	-174.1	-65.1	-59	0	0	0	113.3	H65 M66 K67	N40-H65 CarbonylContact O-C 3.52Å; N40-H65 WeakPolarHBondContact O-CA 3.4Å; N40-M66 PolarHBondContact O-N 3.41Å; N40-K67 VanDerWaalsContact OD1-CE 3.25Å; N40-K67 WeakPolarHBondContact OD1-CE 3.3Å
41	M	96.7	Very high	97	Very high	32 Å²	32	47.7 Å²	47.7	16%	0.158	23%	0.232	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-132.5	141.8	-174.5	-173.1	179	76.3	0	0	109.6	L35 Q38 E63 V64	L35-M41 HydrophobicContact CD1-CE 3.46Å; L35-M41 VanDerWaalsContact CD1-CE 3.46Å; Q38-M41 HydrophobicContact CG-CB 3.83Å; Q38-M41 HydrophobicContact CG-CE 4.4Å; M41-E63 HydrophobicContact CG-CB 4.28Å; M41-E63 HydrophobicContact SD-CB 4.07Å; M41-E63 HydrophobicContact SD-CG 4.13Å; M41-V64 WeakPolarHBondContact CA-O 3.25Å
42	R	97.6	Very high	96.9	Very high	49 Å²	49	54.9 Å²	54.9	19%	0.185	27%	0.266	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.9	155.8	173	-61.1	-174.8	-175.8	171	0.5	108.8	Q32 V33 W34 V64 M66	Q32-R42 HydrophobicContact CG-CB 3.82Å; Q32-R42 HydrophobicContact CG-CG 4.36Å; V33-R42 WeakPolarHBondContact O-CA 3.38Å; V33-R42 WeakPolarHBondContact O-CB 3.33Å; W34-R42 VanDerWaalsContact CH2-NH2 3.26Å; R42-V64 PolarHBondContact N-O 3.26Å; R42-V64 PolarHBondContact O-N 2.95Å; R42-M66 HydrophobicContact CB-CE 4.29Å; R42-M66 VanDerWaalsContact CD-SD 3.55Å; R42-M66 HydrophobicContact CG-CE 4.12Å; R42-M66 HydrophobicContact CG-CG 4.19Å; R42-M66 HydrophobicContact CG-SD 4.01Å; R42-M66 VanDerWaalsContact CZ-SD 3.55Å; R42-M66 PolarHBondContact NE-SD 2.91Å; R42-M66 VanDerWaalsContact NE-SD 3.38Å
43	I	97.9	Very high	96.8	Very high	9 Å²	9	62.1 Å²	62.1	5%	0.046	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.4	128.7	171.7	-59.8	-60.5	0	0	0	107.9	Q32 V33 L35 L58 E62 E63 L74 I77	Q32-I43 CarbonylContact C-O 3.55Å; Q32-I43 WeakPolarHBondContact CA-O 3.47Å; V33-I43 HydrophobicContact CB-CB 4.35Å; V33-I43 PolarHBondContact N-O 3.34Å; V33-I43 PolarHBondContact O-N 3.19Å; L35-I43 HydrophobicContact CD1-CG1 4.2Å; L35-I43 HydrophobicContact CD2-CG1 4.06Å; L35-I43 HydrophobicContact CG-CG1 4.43Å; I43-L58 HydrophobicContact CG2-CD1 3.67Å; I43-E62 WeakPolarHBondContact CA-O 3.45Å; I43-E63 HydrophobicContact CD1-CB 4.4Å; I43-E63 HydrophobicContact CD1-CG 3.8Å; I43-L74 HydrophobicContact CD1-CD1 4.11Å; I43-I77 HydrophobicContact CG2-CD1 4.05Å
44	E	97.9	Very high	96.8	Very high	17 Å²	17	65.5 Å²	65.5	8%	0.079	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.7	146.5	169.9	-72.9	-178.6	-172.1	0	0	110.4	I31 Q32 A61 E62 V64 R71	I31-E44 CarbonylContact O-C 3.57Å; I31-E44 WeakPolarHBondContact O-CA 3.42Å; Q32-E44 HydrophobicContact CB-CG 3.78Å; Q32-E44 HydrophobicContact CG-CG 3.75Å; Q32-E44 PolarHBondContact NE2-OE1 3.1Å; E44-A61 CarbonylContact O-C 3.48Å; E44-A61 WeakPolarHBondContact O-CA 3.29Å; E44-E62 PolarHBondContact N-O 2.88Å; E44-E62 PolarHBondContact O-N 3.01Å; E44-V64 HydrophobicContact CB-CG2 4.15Å; E44-V64 HydrophobicContact CG-CG2 3.82Å; E44-R71 IonicContact OE2-CZ 3.75Å; E44-R71 IonicContact OE2-NH2 3.01Å; E44-R71 PolarHBondContact OE2-NH2 3.28Å
45	G	97.6	Very high	96.8	Very high	0 Å²	0	62.7 Å²	62.7	0%	0	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	175.4	178.9	178.2	0	0	0	0	0	112.3	I31	I31-G45 VanDerWaalsContact CG1-O 3.3Å; I31-G45 WeakPolarHBondContact CG1-O 3.46Å; I31-G45 PolarHBondContact N-O 2.79Å; I31-G45 PolarHBondContact O-N 3Å
46	C	97.8	Very high	96.8	Very high	22 Å²	22	61.6 Å²	61.6	15%	0.149	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.5	127	176.7	-65.9	0	0	0	0	109.7	I48 L58 D59	C46-I48 PolarHBondContact O-N 2.81Å; C46-L58 CarbonylContact O-C 3.43Å; C46-L58 WeakPolarHBondContact O-CA 3.3Å; C46-D59 PolarHBondContact N-O 3.18Å; C46-D59 PolarHBondContact O-N 3.09Å
47	I	98.1	Very high	96.9	Very high	1 Å²	1	57.2 Å²	57.2	1%	0.005	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-69.1	125.4	178.5	-49.7	179.8	0	0	0	109.5	I21 Y24 L25 I31 L56 L58	I21-I47 HydrophobicContact CG2-CD1 4.04Å; Y24-I47 HydrophobicContact CD2-CD1 4.46Å; L25-I47 HydrophobicContact CB-CB 4.49Å; L25-I47 HydrophobicContact CB-CG2 4.36Å; L25-I47 HydrophobicContact CD1-CG2 4.29Å; I31-I47 HydrophobicContact CD1-CD1 3.67Å; I31-I47 HydrophobicContact CD1-CG1 3.55Å; I31-I47 HydrophobicContact CG1-CD1 4.37Å; I31-I47 HydrophobicContact CG1-CG1 3.93Å; I47-L56 HydrophobicContact CD1-CD1 4.48Å; I47-L58 HydrophobicContact CB-CD2 4.45Å; I47-L58 HydrophobicContact CG1-CD2 3.92Å
48	I	98.1	Very high	97.1	Very high	62 Å²	62	49.5 Å²	49.5	32%	0.318	25%	0.248	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-113.5	-11.1	172.3	59.5	168.1	0	0	0	113.1	C46 V57 D59 R76	C46-I48 PolarHBondContact O-N 2.81Å; I48-V57 HydrophobicContact CD1-CB 4.48Å; I48-V57 HydrophobicContact CD1-CG1 3.64Å; I48-V57 HydrophobicContact CG1-CB 3.89Å; I48-V57 HydrophobicContact CG1-CG1 3.57Å; I48-V57 WeakPolarHBondContact CG1-O 3.5Å; I48-V57 PolarHBondContact N-O 3.19Å; I48-D59 HydrophobicContact CD1-CB 4.25Å; I48-D59 HydrophobicContact CG2-CB 3.8Å; I48-R76 HydrophobicContact CD1-CG 4.29Å
49	G	97.9	Very high	97.3	Very high	20 Å²	20	47 Å²	47	21%	0.206	24%	0.238	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-169.7	156.6	173.9	0	0	0	0	0	111.8	V57	G49-V57 PolarHBondContact O-N 3.25Å
50	F	98	Very high	97.4	Very high	52 Å²	52	46.5 Å²	46.5	23%	0.228	23%	0.231	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-150.7	164.1	171.6	69.8	-85.4	0	0	0	111	I18 I21 F22 L25 N55 L56	I18-F50 HydrophobicContact CD1-CE2 4.24Å; I18-F50 HydrophobicContact CG1-CE2 4Å; I18-F50 HydrophobicContact CG1-CZ 4.2Å; I21-F50 HydrophobicContact CG2-CB 4.49Å; I21-F50 HydrophobicContact CG2-CD1 3.66Å; I21-F50 HydrophobicContact CG2-CD2 4.29Å; I21-F50 HydrophobicContact CG2-CE1 3.83Å; I21-F50 HydrophobicContact CG2-CE2 4.44Å; I21-F50 HydrophobicContact CG2-CG 3.9Å; I21-F50 HydrophobicContact CG2-CZ 4.21Å; F22-F50 AromaticContact CD1-CE1 3.78Å; F22-F50 HydrophobicContact CD1-CE1 3.78Å; F22-F50 AromaticContact CD1-CZ 3.76Å; F22-F50 HydrophobicContact CD1-CZ 3.76Å; F22-F50 HydrophobicContact CD2-CZ 4.09Å; F22-F50 AromaticContact CE1-CE1 3.76Å; F22-F50 HydrophobicContact CE1-CE1 3.76Å; F22-F50 AromaticContact CE1-CZ 3.48Å; F22-F50 HydrophobicContact CE1-CZ 3.48Å; F22-F50 VanDerWaalsContact CE1-CZ 3.48Å; F22-F50 AromaticContact CE2-CZ 3.83Å; F22-F50 HydrophobicContact CE2-CZ 3.83Å; F22-F50 HydrophobicContact CG-CE1 4.29Å; F22-F50 HydrophobicContact CG-CZ 4.05Å; F22-F50 HydrophobicContact CZ-CE1 4.28Å; F22-F50 HydrophobicContact CZ-CE2 4.4Å; F22-F50 AromaticContact CZ-CZ 3.52Å; F22-F50 HydrophobicContact CZ-CZ 3.52Å; L25-F50 HydrophobicContact CD1-CD1 3.93Å; L25-F50 HydrophobicContact CD1-CE1 4.12Å; F50-N55 WeakPolarHBondContact CA-O 3.12Å; F50-L56 HydrophobicContact CB-CD2 3.53Å
51	D	97.2	Very high	97.6	Very high	45 Å²	45	43.4 Å²	43.4	24%	0.241	21%	0.214	C	C	.	.			trans	-124.9	-177.9	178.1	69.6	11.3	0	0	0	112.8	Y53 M54 N55	D51-Y53 PolarHBondContact O-N 3.35Å; D51-Y53 WeakPolarHBondContact OD1-CA 3.29Å; D51-Y53 PolarHBondContact OD1-N 3.01Å; D51-M54 PolarHBondContact O-N 2.71Å; D51-M54 VanDerWaalsContact O-N 3.12Å; D51-M54 PolarHBondContact OD1-N 2.69Å; D51-N55 PolarHBondContact N-O 3.01Å; D51-N55 WeakPolarHBondContact OD1-CB 3.14Å; D51-N55 PolarHBondContact OD1-N 2.64Å; D51-N55 WeakPolarHBondContact OD2-CB 3.3Å; D51-N55 PolarHBondContact OD2-ND2 2.86Å
52	E	95.9	Very high	97.6	Very high	152 Å²	152	43.7 Å²	43.7	71%	0.71	22%	0.215	S	C	*	.	T	Hydrogen-bonded Turn	trans	-63.7	-20.3	178.4	63.2	-87.5	-161.4	0	0	114.3	M54	E52-M54 VanDerWaalsContact C-N 3.33Å
53	Y	96.1	Very high	97.6	Very high	167 Å²	167	43.1 Å²	43.1	66%	0.655	22%	0.215	S	C	*	.	T	Hydrogen-bonded Turn	trans	-93.2	4.9	177.4	-57.1	-66.9	0	0	0	112.6	D51 N55	D51-Y53 PolarHBondContact O-N 3.35Å; D51-Y53 WeakPolarHBondContact OD1-CA 3.29Å; D51-Y53 PolarHBondContact OD1-N 3.01Å; Y53-N55 PolarHBondContact O-N 2.71Å
54	M	96.8	Very high	97.6	Very high	71 Å²	71	43.1 Å²	43.1	35%	0.35	22%	0.215	S	C	.	.			trans	63.5	22.5	-175.6	-58.3	-82.4	-61.1	0	0	113.4	I21 D51 E52 L56 G81 I84 L87	I21-M54 HydrophobicContact CD1-CE 3.26Å; I21-M54 HydrophobicContact CD1-SD 3.38Å; I21-M54 WeakPolarHBondContact CD1-SD 3.4Å; I21-M54 HydrophobicContact CG1-CE 4.46Å; D51-M54 PolarHBondContact O-N 2.71Å; D51-M54 VanDerWaalsContact O-N 3.12Å; D51-M54 PolarHBondContact OD1-N 2.69Å; E52-M54 VanDerWaalsContact C-N 3.33Å; M54-L56 PolarHBondContact O-N 3.35Å; M54-G81 VanDerWaalsContact O-CA 3.3Å; M54-G81 WeakPolarHBondContact O-CA 3.24Å; M54-I84 VanDerWaalsContact O-CD1 3.25Å; M54-I84 WeakPolarHBondContact O-CD1 3.21Å; M54-L87 HydrophobicContact CE-CD1 4.2Å
55	N	97.8	Very high	97.5	Very high	29 Å²	29	45.4 Å²	45.4	16%	0.155	23%	0.226	C	C	.	.			trans	-65.7	132.1	165.5	-58.1	-47.2	0	0	0	107.9	F50 D51 Y53 M78 L79 K80 G81	F50-N55 WeakPolarHBondContact CA-O 3.12Å; D51-N55 PolarHBondContact N-O 3.01Å; D51-N55 WeakPolarHBondContact OD1-CB 3.14Å; D51-N55 PolarHBondContact OD1-N 2.64Å; D51-N55 WeakPolarHBondContact OD2-CB 3.3Å; D51-N55 PolarHBondContact OD2-ND2 2.86Å; Y53-N55 PolarHBondContact O-N 2.71Å; N55-M78 HydrophobicContact CB-CE 3.62Å; N55-L79 CarbonylContact C-O 3.59Å; N55-L79 VanDerWaalsContact CA-O 3.3Å; N55-L79 WeakPolarHBondContact CA-O 3.44Å; N55-K80 VanDerWaalsContact OD1-CA 3.25Å; N55-K80 WeakPolarHBondContact OD1-CA 2.99Å; N55-G81 PolarHBondContact OD1-N 3.09Å
56	L	98.1	Very high	97.3	Very high	0 Å²	0	47.1 Å²	47.1	0%	0	23%	0.234	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-113	131	-176.7	-58	-176.5	0	0	0	110	I31 I47 F50 M54 L58 M78 L79 I84 L87	I31-L56 HydrophobicContact CD1-CD1 4.29Å; I47-L56 HydrophobicContact CD1-CD1 4.48Å; F50-L56 HydrophobicContact CB-CD2 3.53Å; M54-L56 PolarHBondContact O-N 3.35Å; L56-L58 HydrophobicContact CB-CD2 4.16Å; L56-L58 HydrophobicContact CB-CG 4.33Å; L56-M78 CarbonylContact O-C 3.57Å; L56-M78 WeakPolarHBondContact O-CA 3.44Å; L56-L79 PolarHBondContact N-O 2.95Å; L56-L79 PolarHBondContact O-N 2.85Å; L56-I84 HydrophobicContact CD1-CD1 3.71Å; L56-I84 HydrophobicContact CG-CD1 3.81Å; L56-L87 HydrophobicContact CD1-CD1 4.27Å; L56-L87 HydrophobicContact CD1-CD2 3.84Å
57	V	98.3	Very high	97.1	Very high	49 Å²	49	54.2 Å²	54.2	30%	0.297	26%	0.263	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.8	117.4	163.9	-170.5	0	0	0	0	107.5	I48 G49 R76 I77	I48-V57 HydrophobicContact CD1-CB 4.48Å; I48-V57 HydrophobicContact CD1-CG1 3.64Å; I48-V57 HydrophobicContact CG1-CB 3.89Å; I48-V57 HydrophobicContact CG1-CG1 3.57Å; I48-V57 WeakPolarHBondContact CG1-O 3.5Å; I48-V57 PolarHBondContact N-O 3.19Å; G49-V57 PolarHBondContact O-N 3.25Å; V57-R76 HydrophobicContact CG1-CG 4.37Å; V57-I77 WeakPolarHBondContact CA-O 3.4Å
58	L	98.3	Very high	96.9	Very high	0 Å²	0	59 Å²	59	0%	0	29%	0.292	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	133.2	-178.9	-58.6	178.4	0	0	0	110	I31 V33 I43 C46 I47 L56 A61 R76 I77 L79	I31-L58 HydrophobicContact CD1-CD2 4.19Å; I31-L58 HydrophobicContact CG1-CD2 4.48Å; V33-L58 HydrophobicContact CG2-CD1 4.36Å; I43-L58 HydrophobicContact CG2-CD1 3.67Å; C46-L58 CarbonylContact O-C 3.43Å; C46-L58 WeakPolarHBondContact O-CA 3.3Å; I47-L58 HydrophobicContact CB-CD2 4.45Å; I47-L58 HydrophobicContact CG1-CD2 3.92Å; L56-L58 HydrophobicContact CB-CD2 4.16Å; L56-L58 HydrophobicContact CB-CG 4.33Å; L58-A61 HydrophobicContact CB-CB 4.09Å; L58-R76 WeakPolarHBondContact O-CA 3.43Å; L58-I77 HydrophobicContact CB-CG1 4.14Å; L58-I77 PolarHBondContact N-O 3.38Å; L58-I77 PolarHBondContact O-N 2.93Å; L58-L79 HydrophobicContact CD1-CD2 4.49Å
59	D	98.1	Very high	96.6	Very high	30 Å²	30	63 Å²	63	16%	0.16	31%	0.307	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.2	156	168.8	-137.1	11.8	0	0	0	110.4	C46 I48 A61 R76	C46-D59 PolarHBondContact N-O 3.18Å; C46-D59 PolarHBondContact O-N 3.09Å; I48-D59 HydrophobicContact CD1-CB 4.25Å; I48-D59 HydrophobicContact CG2-CB 3.8Å; D59-A61 PolarHBondContact O-N 3.28Å; D59-A61 VanDerWaalsContact O-N 3.16Å; D59-R76 IonicContact OD1-CZ 3.49Å; D59-R76 IonicContact OD1-NE 2.88Å; D59-R76 PolarHBondContact OD1-NE 2.91Å; D59-R76 IonicContact OD1-NH2 3.22Å; D59-R76 PolarHBondContact OD1-NH2 3.15Å; D59-R76 IonicContact OD2-CZ 3.72Å; D59-R76 IonicContact OD2-NE 3.79Å; D59-R76 IonicContact OD2-NH2 2.82Å; D59-R76 PolarHBondContact OD2-NH2 2.95Å
60	D	96.8	Very high	96.5	Very high	103 Å²	103	66.9 Å²	66.9	55%	0.551	32%	0.323	S	S	*	.	E	Extended strand (participates in β ladder)	trans	47.8	39.9	-176.1	-60.3	-40.8	0	0	0	113	R30	R30-D60 PolarHBondContact NH1-O 3.24Å; R30-D60 PolarHBondContact NH2-O 2.98Å
61	A	98.1	Very high	96.5	Very high	1 Å²	1	69.4 Å²	69.4	1%	0.008	33%	0.331	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.9	145.1	-172.9	0	0	0	0	0	111.9	E44 L58 D59 L74 G75 I77	E44-A61 CarbonylContact O-C 3.48Å; E44-A61 WeakPolarHBondContact O-CA 3.29Å; L58-A61 HydrophobicContact CB-CB 4.09Å; D59-A61 PolarHBondContact O-N 3.28Å; D59-A61 VanDerWaalsContact O-N 3.16Å; A61-L74 HydrophobicContact CB-CB 4.3Å; A61-L74 WeakPolarHBondContact O-CB 3.22Å; A61-L74 PolarHBondContact O-N 3.09Å; A61-G75 VanDerWaalsContact CB-O 3.23Å; A61-G75 WeakPolarHBondContact CB-O 3.45Å; A61-G75 PolarHBondContact N-O 2.83Å; A61-G75 PolarHBondContact O-N 2.86Å; A61-I77 HydrophobicContact CB-CD1 3.77Å; A61-I77 HydrophobicContact CB-CG1 3.77Å
62	E	98.1	Very high	96.5	Very high	38 Å²	38	72.4 Å²	72.4	18%	0.178	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.7	141.3	178.5	-65.2	168.4	128.2	0	0	110.9	R30 I43 E44 R71 K72	R30-E62 IonicContact CZ-OE2 3.97Å; R30-E62 IonicContact NE-OE2 3.85Å; R30-E62 IonicContact NH2-OE2 2.88Å; R30-E62 PolarHBondContact NH2-OE2 2.79Å; I43-E62 WeakPolarHBondContact CA-O 3.45Å; E44-E62 PolarHBondContact N-O 2.88Å; E44-E62 PolarHBondContact O-N 3.01Å; E62-R71 IonicContact OE1-CZ 3.57Å; E62-R71 IonicContact OE1-NH1 2.64Å; E62-R71 PolarHBondContact OE1-NH1 2.89Å; E62-R71 IonicContact OE2-CZ 2.71Å; E62-R71 IonicContact OE2-NE 3.61Å; E62-R71 IonicContact OE2-NH1 3.97Å; E62-R71 PolarHBondContact OE2-NH1 2.72Å; E62-R71 IonicContact OE2-NH2 3.8Å; E62-R71 PolarHBondContact OE2-NH2 2.75Å; E62-K72 CarbonylContact C-O 3.55Å; E62-K72 WeakPolarHBondContact CA-O 3.28Å
63	E	97.4	Very high	96.6	Very high	38 Å²	38	70 Å²	70	18%	0.178	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.7	126.6	163.1	-57	174.8	174.4	0	0	108.4	M41 I43 R71 K72 L74	M41-E63 HydrophobicContact CG-CB 4.28Å; M41-E63 HydrophobicContact SD-CB 4.07Å; M41-E63 HydrophobicContact SD-CG 4.13Å; I43-E63 HydrophobicContact CD1-CB 4.4Å; I43-E63 HydrophobicContact CD1-CG 3.8Å; E63-R71 CarbonylContact O-C 3.6Å; E63-R71 VanDerWaalsContact O-CA 3.26Å; E63-R71 WeakPolarHBondContact O-CA 3.26Å; E63-K72 HydrophobicContact CB-CB 4.28Å; E63-K72 PolarHBondContact N-O 3.06Å; E63-K72 PolarHBondContact O-N 3.26Å; E63-K72 IonicContact OE1-NZ 2.69Å; E63-K72 WeakPolarHBondContact OE2-CD 3.47Å; E63-K72 IonicContact OE2-NZ 2.71Å; E63-L74 HydrophobicContact CG-CD1 3.63Å; E63-L74 HydrophobicContact CG-CD2 4.02Å; E63-L74 HydrophobicContact CG-CG 3.96Å
64	V	96.9	Very high	96.6	Very high	9 Å²	9	64.8 Å²	64.8	6%	0.055	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.3	112.6	176.8	-171	0	0	0	0	109.1	M41 R42 E44 M66 R71	M41-V64 WeakPolarHBondContact CA-O 3.25Å; R42-V64 PolarHBondContact N-O 3.26Å; R42-V64 PolarHBondContact O-N 2.95Å; E44-V64 HydrophobicContact CB-CG2 4.15Å; E44-V64 HydrophobicContact CG-CG2 3.82Å; V64-M66 HydrophobicContact CB-CE 3.88Å; V64-M66 HydrophobicContact CG1-CE 3.36Å; V64-R71 HydrophobicContact CG1-CG 4.32Å; V64-R71 HydrophobicContact CG2-CG 4.31Å
65	H	96.5	Very high	96.7	Very high	64 Å²	64	62.9 Å²	62.9	30%	0.296	32%	0.322	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.8	119.5	174.6	-70	-82	0	0	0	110.5	N40 K67 T68 K69 N70	N40-H65 CarbonylContact O-C 3.52Å; N40-H65 WeakPolarHBondContact O-CA 3.4Å; H65-K67 PolarHBondContact O-N 2.93Å; H65-T68 VanDerWaalsContact CB-OG1 3.24Å; H65-T68 WeakPolarHBondContact CB-OG1 3.44Å; H65-K69 WeakPolarHBondContact O-CA 3.2Å; H65-K69 PolarHBondContact O-N 2.74Å; H65-N70 PolarHBondContact N-O 2.69Å
66	M	93.3	Very high	96.7	Very high	36 Å²	36	69.3 Å²	69.3	18%	0.177	34%	0.343	C	S	.	.	T	Hydrogen-bonded Turn	trans	-65.9	-34.5	-171.1	-67.8	-65.9	93.5	0	0	114.1	N40 R42 V64 K69	N40-M66 PolarHBondContact O-N 3.41Å; R42-M66 HydrophobicContact CB-CE 4.29Å; R42-M66 VanDerWaalsContact CD-SD 3.55Å; R42-M66 HydrophobicContact CG-CE 4.12Å; R42-M66 HydrophobicContact CG-CG 4.19Å; R42-M66 HydrophobicContact CG-SD 4.01Å; R42-M66 VanDerWaalsContact CZ-SD 3.55Å; R42-M66 PolarHBondContact NE-SD 2.91Å; R42-M66 VanDerWaalsContact NE-SD 3.38Å; V64-M66 HydrophobicContact CB-CE 3.88Å; V64-M66 HydrophobicContact CG1-CE 3.36Å; M66-K69 WeakPolarHBondContact O-CE 3.42Å; M66-K69 PolarHBondContact O-NZ 3.39Å
67	K	93.4	Very high	96.7	Very high	172 Å²	172	71.3 Å²	71.3	75%	0.748	35%	0.354	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.9	-49.2	-178.8	-66.2	-176.8	178.4	176.4	0	112.7	N40 H65	N40-K67 VanDerWaalsContact OD1-CE 3.25Å; N40-K67 WeakPolarHBondContact OD1-CE 3.3Å; H65-K67 PolarHBondContact O-N 2.93Å
68	T	94.5	Very high	96.7	Very high	101 Å²	101	74.8 Å²	74.8	62%	0.62	37%	0.368	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.8	-13.4	-174.7	54.4	0	0	0	0	113.1	H65 N70	H65-T68 VanDerWaalsContact CB-OG1 3.24Å; H65-T68 WeakPolarHBondContact CB-OG1 3.44Å; T68-N70 PolarHBondContact O-N 2.99Å; T68-N70 PolarHBondContact OG1-N 2.92Å
69	K	91.3	Very high	96.7	Very high	147 Å²	147	75.7 Å²	75.7	64%	0.639	37%	0.373	S	S	*	.			trans	56.7	15.8	-171	-55	-60.5	-174.5	-176.2	0	113.6	H65 M66	H65-K69 WeakPolarHBondContact O-CA 3.2Å; H65-K69 PolarHBondContact O-N 2.74Å; M66-K69 WeakPolarHBondContact O-CE 3.42Å; M66-K69 PolarHBondContact O-NZ 3.39Å
70	N	95.9	Very high	96.7	Very high	101 Å²	101	80.4 Å²	80.4	54%	0.54	39%	0.392	S	S	.	.			trans	-69.5	137.8	174.8	-167.3	3	0	0	0	109.3	H65 T68	H65-N70 PolarHBondContact N-O 2.69Å; T68-N70 PolarHBondContact O-N 2.99Å; T68-N70 PolarHBondContact OG1-N 2.92Å
71	R	97	Very high	96.7	Very high	105 Å²	105	76.1 Å²	76.1	40%	0.396	37%	0.372	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.8	120.9	-178.6	-58.1	178.2	95.1	-121.7	1.3	108.1	E44 E62 E63 V64	E44-R71 IonicContact OE2-CZ 3.75Å; E44-R71 IonicContact OE2-NH2 3.01Å; E44-R71 PolarHBondContact OE2-NH2 3.28Å; E62-R71 IonicContact OE1-CZ 3.57Å; E62-R71 IonicContact OE1-NH1 2.64Å; E62-R71 PolarHBondContact OE1-NH1 2.89Å; E62-R71 IonicContact OE2-CZ 2.71Å; E62-R71 IonicContact OE2-NE 3.61Å; E62-R71 IonicContact OE2-NH1 3.97Å; E62-R71 PolarHBondContact OE2-NH1 2.72Å; E62-R71 IonicContact OE2-NH2 3.8Å; E62-R71 PolarHBondContact OE2-NH2 2.75Å; E63-R71 CarbonylContact O-C 3.6Å; E63-R71 VanDerWaalsContact O-CA 3.26Å; E63-R71 WeakPolarHBondContact O-CA 3.26Å; V64-R71 HydrophobicContact CG1-CG 4.32Å; V64-R71 HydrophobicContact CG2-CG 4.31Å
72	K	97.5	Very high	96.7	Very high	107 Å²	107	81.5 Å²	81.5	47%	0.465	40%	0.401	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.5	118.8	179.8	179.9	-176	164.1	-156.3	0	109.4	E62 E63	E62-K72 CarbonylContact C-O 3.55Å; E62-K72 WeakPolarHBondContact CA-O 3.28Å; E63-K72 HydrophobicContact CB-CB 4.28Å; E63-K72 PolarHBondContact N-O 3.06Å; E63-K72 PolarHBondContact O-N 3.26Å; E63-K72 IonicContact OE1-NZ 2.69Å; E63-K72 WeakPolarHBondContact OE2-CD 3.47Å; E63-K72 IonicContact OE2-NZ 2.71Å
73	P	97.9	Very high	96.7	Very high	101 Å²	101	82.7 Å²	82.7	66%	0.656	41%	0.409	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.6	135.1	178.5	28.8	-33.8	0	0	0	110.9
74	L	97.8	Very high	96.7	Very high	58 Å²	58	82.5 Å²	82.5	30%	0.304	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.4	-23.6	174.4	-60.8	-178.6	0	0	0	112.1	I43 A61 E63 I77	I43-L74 HydrophobicContact CD1-CD1 4.11Å; A61-L74 HydrophobicContact CB-CB 4.3Å; A61-L74 WeakPolarHBondContact O-CB 3.22Å; A61-L74 PolarHBondContact O-N 3.09Å; E63-L74 HydrophobicContact CG-CD1 3.63Å; E63-L74 HydrophobicContact CG-CD2 4.02Å; E63-L74 HydrophobicContact CG-CG 3.96Å; L74-I77 HydrophobicContact CB-CG2 3.82Å; L74-I77 HydrophobicContact CD1-CD1 3.83Å; L74-I77 HydrophobicContact CD1-CG2 4.41Å
75	G	97.8	Very high	96.7	Very high	32 Å²	32	86.1 Å²	86.1	33%	0.33	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	76.5	-132	-174.7	0	0	0	0	0	111	A61	A61-G75 VanDerWaalsContact CB-O 3.23Å; A61-G75 WeakPolarHBondContact CB-O 3.45Å; A61-G75 PolarHBondContact N-O 2.83Å; A61-G75 PolarHBondContact O-N 2.86Å
76	R	98.3	Very high	96.7	Very high	163 Å²	163	86.5 Å²	86.5	62%	0.615	43%	0.434	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-91.7	122.2	-179.3	-172.6	172.8	-67	176.4	-2.4	111.2	I48 V57 L58 D59	I48-R76 HydrophobicContact CD1-CG 4.29Å; V57-R76 HydrophobicContact CG1-CG 4.37Å; L58-R76 WeakPolarHBondContact O-CA 3.43Å; D59-R76 IonicContact OD1-CZ 3.49Å; D59-R76 IonicContact OD1-NE 2.88Å; D59-R76 PolarHBondContact OD1-NE 2.91Å; D59-R76 IonicContact OD1-NH2 3.22Å; D59-R76 PolarHBondContact OD1-NH2 3.15Å; D59-R76 IonicContact OD2-CZ 3.72Å; D59-R76 IonicContact OD2-NE 3.79Å; D59-R76 IonicContact OD2-NH2 2.82Å; D59-R76 PolarHBondContact OD2-NH2 2.95Å
77	I	98.4	Very high	96.9	Very high	42 Å²	42	86.5 Å²	86.5	22%	0.215	44%	0.435	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.8	159.3	-178.3	66.9	173.5	0	0	0	111.8	I43 V57 L58 A61 L74	I43-I77 HydrophobicContact CG2-CD1 4.05Å; V57-I77 WeakPolarHBondContact CA-O 3.4Å; L58-I77 HydrophobicContact CB-CG1 4.14Å; L58-I77 PolarHBondContact N-O 3.38Å; L58-I77 PolarHBondContact O-N 2.93Å; A61-I77 HydrophobicContact CB-CD1 3.77Å; A61-I77 HydrophobicContact CB-CG1 3.77Å; L74-I77 HydrophobicContact CB-CG2 3.82Å; L74-I77 HydrophobicContact CD1-CD1 3.83Å; L74-I77 HydrophobicContact CD1-CG2 4.41Å
78	M	98.1	Very high	97	Very high	122 Å²	122	82.4 Å²	82.4	60%	0.601	42%	0.419	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-107	117.3	164.1	-176.5	-175.5	-179.9	0	0	108.5	N55 L56	N55-M78 HydrophobicContact CB-CE 3.62Å; L56-M78 CarbonylContact O-C 3.57Å; L56-M78 WeakPolarHBondContact O-CA 3.44Å
79	L	98	Very high	97	Very high	20 Å²	20	80 Å²	80	11%	0.105	41%	0.405	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.7	128	174.7	-177.4	64.8	0	0	0	109.2	V33 L35 N55 L56 L58 N83 I84	V33-L79 HydrophobicContact CB-CD2 4.05Å; V33-L79 HydrophobicContact CG1-CD2 3.65Å; V33-L79 HydrophobicContact CG2-CD2 4.06Å; L35-L79 HydrophobicContact CD2-CD1 4.17Å; L35-L79 HydrophobicContact CD2-CD2 4.48Å; N55-L79 CarbonylContact C-O 3.59Å; N55-L79 VanDerWaalsContact CA-O 3.3Å; N55-L79 WeakPolarHBondContact CA-O 3.44Å; L56-L79 PolarHBondContact N-O 2.95Å; L56-L79 PolarHBondContact O-N 2.85Å; L58-L79 HydrophobicContact CD1-CD2 4.49Å; L79-N83 HydrophobicContact CD1-CB 4.43Å; L79-I84 HydrophobicContact CD2-CD1 4.49Å; L79-I84 HydrophobicContact CD2-CG1 4.18Å
80	K	98.2	Very high	97	Very high	128 Å²	128	74.6 Å²	74.6	56%	0.557	39%	0.385	S	S	*	.			trans	-73.3	140	177.4	-66.2	-173	176.4	-175.3	0	111.5	N55 D82 N83	N55-K80 VanDerWaalsContact OD1-CA 3.25Å; N55-K80 WeakPolarHBondContact OD1-CA 2.99Å; K80-D82 VanDerWaalsContact C-N 3.29Å; K80-D82 WeakPolarHBondContact CB-OD1 3.2Å; K80-D82 PolarHBondContact O-N 2.86Å; K80-N83 PolarHBondContact O-N 3.04Å
81	G	97.4	Very high	96	Very high	13 Å²	13	74.5 Å²	74.5	13%	0.134	40%	0.398	C	S	.	.	G	3₁₀ helix	trans	-65.5	-28	-175.6	0	0	0	0	0	114.4	M54 N55 N83 I84	M54-G81 VanDerWaalsContact O-CA 3.3Å; M54-G81 WeakPolarHBondContact O-CA 3.24Å; N55-G81 PolarHBondContact OD1-N 3.09Å; G81-N83 PolarHBondContact O-N 2.98Å; G81-I84 WeakPolarHBondContact O-CB 3.25Å; G81-I84 PolarHBondContact O-N 3.35Å; G81-I84 VanDerWaalsContact O-N 3.09Å
82	D	97.5	Very high	94	Very high	114 Å²	114	79.1 Å²	79.1	61%	0.61	44%	0.438	S	S	*	.	G	3₁₀ helix	trans	-61.6	-24.5	174.7	59.9	-6.4	0	0	0	113.6	K80 I84	K80-D82 VanDerWaalsContact C-N 3.29Å; K80-D82 WeakPolarHBondContact CB-OD1 3.2Å; K80-D82 PolarHBondContact O-N 2.86Å; D82-I84 VanDerWaalsContact C-N 3.34Å
83	N	96.9	Very high	93.9	Very high	64 Å²	64	77.7 Å²	77.7	34%	0.342	44%	0.437	S	S	.	.	G	3₁₀ helix	trans	-87.2	-1.6	178.2	-72.1	-78.6	0	0	0	112.9	L35 Y36 L79 K80 G81	L35-N83 CarbonylContact C-O 3.53Å; L35-N83 WeakPolarHBondContact CA-O 3.49Å; L35-N83 HydrophobicContact CD2-CB 4.46Å; Y36-N83 PolarHBondContact N-O 2.9Å; L79-N83 HydrophobicContact CD1-CB 4.43Å; K80-N83 PolarHBondContact O-N 3.04Å; G81-N83 PolarHBondContact O-N 2.98Å
84	I	97.5	Very high	93.7	Very high	34 Å²	34	76.5 Å²	76.5	17%	0.174	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.9	114.7	-173.9	-57.4	-179.3	0	0	0	110.6	V33 M54 L56 L79 G81 D82 L87	V33-I84 HydrophobicContact CG1-CB 4.34Å; V33-I84 HydrophobicContact CG1-CG1 3.98Å; V33-I84 HydrophobicContact CG1-CG2 4.02Å; M54-I84 VanDerWaalsContact O-CD1 3.25Å; M54-I84 WeakPolarHBondContact O-CD1 3.21Å; L56-I84 HydrophobicContact CD1-CD1 3.71Å; L56-I84 HydrophobicContact CG-CD1 3.81Å; L79-I84 HydrophobicContact CD2-CD1 4.49Å; L79-I84 HydrophobicContact CD2-CG1 4.18Å; G81-I84 WeakPolarHBondContact O-CB 3.25Å; G81-I84 PolarHBondContact O-N 3.35Å; G81-I84 VanDerWaalsContact O-N 3.09Å; D82-I84 VanDerWaalsContact C-N 3.34Å; I84-L87 HydrophobicContact CG2-CD2 3.81Å; I84-L87 HydrophobicContact CG2-CG 3.97Å
85	T	97.6	Very high	93.4	Very high	84 Å²	84	77.5 Å²	77.5	52%	0.515	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.6	-44	171.3	-58.6	0	0	0	0	111.7	W34 L35 Y36	W34-T85 WeakPolarHBondContact O-CB 3.46Å; W34-T85 PolarHBondContact O-N 3.47Å; L35-T85 VanDerWaalsContact C-OG1 3.28Å; L35-T85 PolarHBondContact O-OG1 3.06Å; L35-T85 VanDerWaalsContact O-OG1 3.09Å; Y36-T85 VanDerWaalsContact CA-OG1 3.28Å; Y36-T85 WeakPolarHBondContact CA-OG1 3.42Å; Y36-T85 PolarHBondContact N-OG1 2.82Å
86	L	97	Very high	93.2	Very high	72 Å²	72	80.2 Å²	80.2	38%	0.377	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.7	140.2	-175.4	-173.7	150.1	0	0	0	110.6	V33 W34 Q88	V33-L86 WeakPolarHBondContact CA-O 3.25Å; W34-L86 HydrophobicContact CB-CB 4Å; W34-L86 HydrophobicContact CD2-CB 4.41Å; W34-L86 HydrophobicContact CG-CB 4.03Å; W34-L86 HydrophobicContact CG-CD2 4.36Å; W34-L86 PolarHBondContact N-O 3.41Å; L86-Q88 HydrophobicContact CD2-CB 3.65Å
87	L	96.7	Very high	92.9	Very high	37 Å²	37	75 Å²	75	19%	0.194	43%	0.427	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.4	124	169.6	-60.7	179.1	0	0	0	109.7	I21 I31 V33 M54 L56 I84	I21-L87 HydrophobicContact CD1-CD1 4.43Å; I21-L87 HydrophobicContact CG1-CD1 4.2Å; I31-L87 HydrophobicContact CD1-CD2 3.99Å; V33-L87 HydrophobicContact CB-CD2 4.2Å; V33-L87 HydrophobicContact CG1-CD2 3.9Å; V33-L87 HydrophobicContact CG2-CD2 3.66Å; M54-L87 HydrophobicContact CE-CD1 4.2Å; L56-L87 HydrophobicContact CD1-CD1 4.27Å; L56-L87 HydrophobicContact CD1-CD2 3.84Å; I84-L87 HydrophobicContact CG2-CD2 3.81Å; I84-L87 HydrophobicContact CG2-CG 3.97Å
88	Q	95.8	Very high	92.5	Very high	86 Å²	86	77.2 Å²	77.2	40%	0.402	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.6	130	179.7	-177.1	175.8	-6	0	0	109.8	I31 Q32 L86 V90	I31-Q88 CarbonylContact C-O 3.44Å; I31-Q88 VanDerWaalsContact CA-O 3.29Å; I31-Q88 WeakPolarHBondContact CA-O 3.33Å; Q32-Q88 PolarHBondContact N-O 3.26Å; Q32-Q88 PolarHBondContact O-N 2.86Å; L86-Q88 HydrophobicContact CD2-CB 3.65Å; Q88-V90 PolarHBondContact O-N 3.1Å
89	S	94.5	Very high	92.1	Very high	49 Å²	49	74 Å²	74	34%	0.343	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.2	128.9	165.2	-168	0	0	0	0	109.2
90	V	92.4	Very high	91.6	Very high	34 Å²	34	78.2 Å²	78.2	21%	0.206	46%	0.455	C	S	.	.			trans	-85.7	121.4	166.1	-76.9	0	0	0	0	107.6	R30 Q32 Q88 T92	R30-V90 HydrophobicContact CB-CG2 3.75Å; R30-V90 HydrophobicContact CG-CG2 3.75Å; R30-V90 WeakPolarHBondContact O-CG2 3.28Å; R30-V90 PolarHBondContact O-N 3.12Å; R30-V90 VanDerWaalsContact O-N 3.09Å; Q32-V90 HydrophobicContact CB-CG1 3.76Å; Q88-V90 PolarHBondContact O-N 3.1Å; V90-T92 PolarHBondContact O-N 3.04Å
91	A	74.6	Confident	91.1	Very high	100 Å²	100	74 Å²	74	83%	0.826	45%	0.446	S	S	*	.			trans	-73.3	111.4	168.6	0	0	0	0	0	106.8
92	T	55.1	Low	90.5	Very high	201 Å²	201	79.5 Å²	79.5	100%	1.233	48%	0.475	S	S	*	.			trans	-66	0	158.3	19.2	0	0	0	0	110.3	V90	V90-T92 PolarHBondContact O-N 3.04Å

Retrieved 92 of 92 residues in 106.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).