A0A060XKY2_ONCMY Loading...

Mitochondrial import receptor subunit TOM22 homolog

Central receptor component of the translocase of the outer membrane of mitochondria (TOM complex) responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with the peripheral receptor TOM20 functions as the transit peptide receptor and facilitates the movement of preproteins into the translocation pore. Required for the translocation across the mitochondrial outer membrane of cytochrome P450 monooxygenases.

AlphaFold DB (A0A4W5L3Y8), UniProt , Accession A0A060XKY2, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 133 aa.

						>A0A060XKY2_ONCMY|A0A060XKY2
MAGIEELSPAVGPVDTRPPEGEIDEDEDEELDETFIERLWGLTEMFPDTLRSAAEVTVSSSVTMAKKLYSFSRAALWVGTTSFMILVLPVVFETERLQLEQQQLQQQRQILLGPNAGMSGGMPGMMPPAPVKM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.4	Very low	48.3	Very low	243 Å²	243	144.5 Å²	144.5	100%	1.197	86%	0.862	S	S	*	*				0	146.2	0	-70.8	-163	-161.1	0	0	108.1
2	A	41.9	Very low	48.9	Very low	113 Å²	113	136.6 Å²	136.6	93%	0.934	83%	0.833	S	S	*	*			trans	71.8	131.6	-177.8	0	0	0	0	0	114.7
3	G	42.7	Very low	49	Very low	74 Å²	74	136.6 Å²	136.6	76%	0.763	84%	0.837	S	S	*	*			cis	-171.6	138.1	-1.9	0	0	0	0	0	106.7
4	I	48.8	Very low	49.5	Very low	182 Å²	182	135.7 Å²	135.7	93%	0.933	83%	0.831	S	S	*	*			trans	-77.1	115.7	173.5	32.1	168.6	0	0	0	107.8
5	E	57.5	Low	49.6	Very low	195 Å²	195	136.8 Å²	136.8	91%	0.911	83%	0.83	S	S	*	*			trans	-106.8	116.2	169.1	-139	-179.9	118.5	0	0	108.1
6	E	53.6	Low	49.8	Very low	163 Å²	163	135.3 Å²	135.3	76%	0.762	82%	0.821	S	S	*	*			trans	-99.7	121.8	178.8	-161.2	-95.8	113.8	0	0	105.9
7	L	46.3	Very low	50	Low	161 Å²	161	140.5 Å²	140.5	84%	0.843	82%	0.822	S	S	*	*			trans	-164.3	101.8	158.9	-132.2	75.4	0	0	0	112.6
8	S	49.4	Very low	50.6	Low	93 Å²	93	138.4 Å²	138.4	65%	0.65	81%	0.814	S	S	*	*			trans	52.3	120.1	136.4	-152.9	0	0	0	0	121.2	A10	S8-A10 PolarHBondContact O-N 2.83Å
9	P	48.8	Very low	50.9	Low	120 Å²	120	137.6 Å²	137.6	78%	0.779	81%	0.813	S	S	*	*			trans	-76.8	120.7	166.3	30.7	-29.3	0	0	0	110.8	V11	P9-V11 PolarHBondContact O-N 3.41Å
10	A	47.6	Very low	51.3	Low	101 Å²	101	140.1 Å²	140.1	84%	0.835	82%	0.816	S	S	*	*			trans	-61	124	174.3	0	0	0	0	0	111.3	S8 G12	S8-A10 PolarHBondContact O-N 2.83Å; A10-G12 PolarHBondContact O-N 3.17Å
11	V	48.8	Very low	51.3	Low	144 Å²	144	136.5 Å²	136.5	87%	0.873	81%	0.809	S	S	*	*			trans	-53.4	110.9	172.3	167.5	0	0	0	0	110.4	P9	P9-V11 PolarHBondContact O-N 3.41Å
12	G	56.4	Low	51.7	Low	50 Å²	50	133.1 Å²	133.1	52%	0.515	79%	0.791	S	S	.	*			trans	-76.3	160	159.7	0	0	0	0	0	110.7	A10 V14	A10-G12 PolarHBondContact O-N 3.17Å; G12-V14 PolarHBondContact O-N 3.24Å
13	P	50.2	Low	52.3	Low	137 Å²	137	135 Å²	135	89%	0.89	78%	0.783	S	S	*	*			trans	-62.1	122.5	-177.3	-13.5	27.6	0	0	0	109.7	D15	P13-D15 PolarHBondContact O-N 3.46Å; P13-D15 VanDerWaalsContact O-N 3.16Å
14	V	55.3	Low	52.8	Low	124 Å²	124	137.3 Å²	137.3	75%	0.752	78%	0.778	S	S	*	*			trans	-68.5	109.3	169.3	104.6	0	0	0	0	106.3	G12 T16	G12-V14 PolarHBondContact O-N 3.24Å; V14-T16 HydrophobicContact CG1-CG2 3.87Å; V14-T16 PolarHBondContact O-N 3.37Å; V14-T16 VanDerWaalsContact O-N 3.09Å
15	D	51.8	Low	53.2	Low	152 Å²	152	137.7 Å²	137.7	81%	0.813	78%	0.776	S	S	*	*			trans	-68.1	104	164.7	-161	-38.4	0	0	0	105.6	P13 R17	P13-D15 PolarHBondContact O-N 3.46Å; P13-D15 VanDerWaalsContact O-N 3.16Å; D15-R17 VanDerWaalsContact C-N 3.33Å; D15-R17 PolarHBondContact O-N 3.14Å
16	T	51.8	Low	53.2	Low	112 Å²	112	134.7 Å²	134.7	69%	0.687	77%	0.766	S	S	*	*			trans	-66.4	94.5	177.9	46.7	0	0	0	0	108.3	V14	V14-T16 HydrophobicContact CG1-CG2 3.87Å; V14-T16 PolarHBondContact O-N 3.37Å; V14-T16 VanDerWaalsContact O-N 3.09Å
17	R	54.3	Low	53.4	Low	224 Å²	224	134.5 Å²	134.5	85%	0.845	77%	0.765	S	S	*	*	P	Polyproline II helix	trans	-49.5	131.1	159.8	-164.1	175.4	-169	164.8	0.1	107.5	D15	D15-R17 VanDerWaalsContact C-N 3.33Å; D15-R17 PolarHBondContact O-N 3.14Å
18	P	60.4	Low	53.8	Low	104 Å²	104	135 Å²	135	68%	0.675	77%	0.769	S	S	*	*	P	Polyproline II helix	trans	-54.9	148.7	176.7	-20.3	31	0	0	0	110	E20	P18-E20 PolarHBondContact O-N 3.24Å
19	P	55.4	Low	54.2	Low	123 Å²	123	136.7 Å²	136.7	80%	0.799	77%	0.767	S	S	*	*	P	Polyproline II helix	trans	-51.5	135	-177.3	22.9	-33	0	0	0	109.5	G21	P19-G21 PolarHBondContact O-N 2.98Å
20	E	58.6	Low	54.7	Low	186 Å²	186	139.7 Å²	139.7	87%	0.869	77%	0.77	S	S	*	*			trans	-44.2	108.4	169.2	-59.5	-170.1	136.3	0	0	107	P18 E22	P18-E20 PolarHBondContact O-N 3.24Å; E20-E22 PolarHBondContact O-N 3.31Å
21	G	51.6	Low	55.4	Low	65 Å²	65	141.2 Å²	141.2	67%	0.67	76%	0.764	S	S	*	*			trans	-53	126.5	167	0	0	0	0	0	105.6	P19 I23	P19-G21 PolarHBondContact O-N 2.98Å; G21-I23 PolarHBondContact O-N 3.13Å
22	E	54.2	Low	56.5	Low	172 Å²	172	141.1 Å²	141.1	80%	0.804	76%	0.758	S	S	*	*			trans	-31.2	113.6	173.3	-62.9	179.4	158.8	0	0	108.3	E20 D24	E20-E22 PolarHBondContact O-N 3.31Å; E22-D24 PolarHBondContact O-N 3.09Å
23	I	55.3	Low	57.3	Low	152 Å²	152	144 Å²	144	78%	0.779	76%	0.759	S	S	*	*			trans	-65.5	103	160.4	-49.9	167.8	0	0	0	100.9	G21 E25	G21-I23 PolarHBondContact O-N 3.13Å; I23-E25 VanDerWaalsContact C-N 3.3Å; I23-E25 PolarHBondContact O-N 3.36Å
24	D	53.4	Low	58.9	Low	123 Å²	123	140.5 Å²	140.5	66%	0.658	74%	0.735	S	S	*	*			trans	-49.9	102.3	173.3	-65.5	-53.4	0	0	0	106.2	E22 D26	E22-D24 PolarHBondContact O-N 3.09Å; D24-D26 PolarHBondContact O-N 2.96Å
25	E	57.5	Low	60.2	Low	191 Å²	191	143.1 Å²	143.1	89%	0.893	74%	0.736	S	S	*	*			trans	-75.4	35	170.3	-70.6	-176.4	170.8	0	0	109.4	I23	I23-E25 VanDerWaalsContact C-N 3.3Å; I23-E25 PolarHBondContact O-N 3.36Å
26	D	55.6	Low	61.7	Low	132 Å²	132	142.2 Å²	142.2	71%	0.706	73%	0.73	S	S	*	*			trans	-116.6	118.1	-178.5	-71.3	-41.2	0	0	0	108	D24	D24-D26 PolarHBondContact O-N 2.96Å
27	E	57.9	Low	63	Low	158 Å²	158	142 Å²	142	74%	0.738	72%	0.721	S	S	*	*			trans	83.9	56.9	173	-61.9	168.6	-169.4	0	0	116.7	E29	E27-E29 HydrophobicContact CB-CG 4.4Å; E27-E29 HydrophobicContact CG-CG 4.28Å; E27-E29 PolarHBondContact O-N 3.32Å
28	D	55.8	Low	64.3	Low	172 Å²	172	137.7 Å²	137.7	92%	0.92	71%	0.705	S	S	*	*			trans	-64.1	55	131.3	-70.7	-34.1	0	0	0	109.5	E30	D28-E30 PolarHBondContact O-N 2.92Å
29	E	57.7	Low	65.3	Low	129 Å²	129	139 Å²	139	60%	0.603	71%	0.705	S	S	*	*			trans	-67.3	91.4	154.1	-81.1	-174.5	167.1	0	0	104.5	E27 L31	E27-E29 HydrophobicContact CB-CG 4.4Å; E27-E29 HydrophobicContact CG-CG 4.28Å; E27-E29 PolarHBondContact O-N 3.32Å; E29-L31 HydrophobicContact CB-CG 4.49Å; E29-L31 PolarHBondContact O-N 3.36Å
30	E	59	Low	66.6	Low	182 Å²	182	141.3 Å²	141.3	85%	0.85	70%	0.698	S	S	*	*			trans	-54.5	75.4	156.9	-169	176.1	-153.5	0	0	106.2	D28 D32	D28-E30 PolarHBondContact O-N 2.92Å; E30-D32 VanDerWaalsContact C-N 3.3Å; E30-D32 PolarHBondContact O-N 2.77Å
31	L	63.5	Low	67.7	Low	134 Å²	134	133.9 Å²	133.9	70%	0.702	67%	0.672	S	S	*	*			trans	-57.4	104.5	170	-81.3	161.2	0	0	0	103.3	E29 E33	E29-L31 HydrophobicContact CB-CG 4.49Å; E29-L31 PolarHBondContact O-N 3.36Å; L31-E33 VanDerWaalsContact C-N 3.32Å; L31-E33 PolarHBondContact O-N 2.81Å
32	D	70.1	Confident	69.1	Low	142 Å²	142	135.6 Å²	135.6	76%	0.759	67%	0.665	S	S	*	*			trans	-45.3	102.8	176.7	-88.9	-32.9	0	0	0	107.1	E30 T34	E30-D32 VanDerWaalsContact C-N 3.3Å; E30-D32 PolarHBondContact O-N 2.77Å; D32-T34 PolarHBondContact O-N 3.47Å
33	E	73.8	Confident	70.2	Confident	111 Å²	111	129.2 Å²	129.2	52%	0.519	64%	0.638	S	S	.	*			trans	-48	117.3	-173.3	-65.6	172.1	155	0	0	107.5	L31 F35 R38	L31-E33 VanDerWaalsContact C-N 3.32Å; L31-E33 PolarHBondContact O-N 2.81Å; E33-F35 PolarHBondContact O-N 3.48Å; E33-R38 HydrophobicContact CB-CG 3.98Å; E33-R38 IonicContact OE2-CZ 3.35Å; E33-R38 IonicContact OE2-NE 2.77Å; E33-R38 PolarHBondContact OE2-NE 2.89Å; E33-R38 IonicContact OE2-NH2 3.03Å; E33-R38 PolarHBondContact OE2-NH2 3.28Å
34	T	84.4	Confident	71.2	Confident	63 Å²	63	128.9 Å²	128.9	39%	0.387	63%	0.633	S	S	.	*			trans	-64	147.5	-172.4	64.5	0	0	0	0	108.2	D32 I36 E37 R38	D32-T34 PolarHBondContact O-N 3.47Å; T34-I36 CarbonylContact O-C 3.6Å; T34-I36 PolarHBondContact O-N 3.03Å; T34-E37 WeakPolarHBondContact CG2-OE1 3.11Å; T34-E37 PolarHBondContact N-OE2 3.2Å; T34-E37 VanDerWaalsContact N-OE2 3.09Å; T34-E37 WeakPolarHBondContact O-CA 3.27Å; T34-E37 WeakPolarHBondContact O-CB 3.09Å; T34-E37 PolarHBondContact O-N 3.41Å; T34-E37 WeakPolarHBondContact OG1-CG 3.25Å; T34-E37 PolarHBondContact OG1-N 2.92Å; T34-E37 PolarHBondContact OG1-OE1 2.83Å; T34-R38 PolarHBondContact O-N 3.01Å
35	F	81.6	Confident	72.5	Confident	179 Å²	179	131 Å²	131	79%	0.785	64%	0.641	S	S	*	*	H	α-helix	trans	-52.4	-27.6	176.4	-77.7	-80	0	0	0	112.1	E33 L39	E33-F35 PolarHBondContact O-N 3.48Å; F35-L39 VanDerWaalsContact O-CB 3.31Å; F35-L39 WeakPolarHBondContact O-CB 3.38Å; F35-L39 PolarHBondContact O-N 3.41Å
36	I	84.6	Confident	73.3	Confident	133 Å²	133	126.9 Å²	126.9	68%	0.682	62%	0.62	S	S	*	*	H	α-helix	trans	-69.7	-47.4	174.4	-65.5	169.7	0	0	0	111.3	T34 R38 L39 W40	T34-I36 CarbonylContact O-C 3.6Å; T34-I36 PolarHBondContact O-N 3.03Å; I36-R38 VanDerWaalsContact C-N 3.32Å; I36-R38 PolarHBondContact O-N 3.01Å; I36-L39 PolarHBondContact O-N 3.47Å; I36-W40 WeakPolarHBondContact O-CB 3.48Å; I36-W40 PolarHBondContact O-N 3.36Å
37	E	78.8	Confident	74.4	Confident	106 Å²	106	124.1 Å²	124.1	50%	0.495	61%	0.61	S	S	.	*	H	α-helix	trans	-60.2	-40.8	175.3	-76.3	150.3	-139.2	0	0	112	T34 W40 G41	T34-E37 WeakPolarHBondContact CG2-OE1 3.11Å; T34-E37 PolarHBondContact N-OE2 3.2Å; T34-E37 VanDerWaalsContact N-OE2 3.09Å; T34-E37 WeakPolarHBondContact O-CA 3.27Å; T34-E37 WeakPolarHBondContact O-CB 3.09Å; T34-E37 PolarHBondContact O-N 3.41Å; T34-E37 WeakPolarHBondContact OG1-CG 3.25Å; T34-E37 PolarHBondContact OG1-N 2.92Å; T34-E37 PolarHBondContact OG1-OE1 2.83Å; E37-W40 PolarHBondContact O-N 2.94Å; E37-G41 PolarHBondContact O-N 3.34Å
38	R	82.2	Confident	75.2	Confident	134 Å²	134	122.4 Å²	122.4	51%	0.506	61%	0.606	S	S	.	*	H	α-helix	trans	-64.9	-44.2	174.6	-70.9	-176.8	168.3	158.9	6.2	112.5	E33 T34 I36 W40 G41 L42	E33-R38 HydrophobicContact CB-CG 3.98Å; E33-R38 IonicContact OE2-CZ 3.35Å; E33-R38 IonicContact OE2-NE 2.77Å; E33-R38 PolarHBondContact OE2-NE 2.89Å; E33-R38 IonicContact OE2-NH2 3.03Å; E33-R38 PolarHBondContact OE2-NH2 3.28Å; T34-R38 PolarHBondContact O-N 3.01Å; I36-R38 VanDerWaalsContact C-N 3.32Å; I36-R38 PolarHBondContact O-N 3.01Å; R38-W40 PolarHBondContact O-N 3.3Å; R38-G41 PolarHBondContact O-N 2.94Å; R38-L42 WeakPolarHBondContact O-CB 3.46Å; R38-L42 PolarHBondContact O-N 2.9Å
39	L	81	Confident	76.1	Confident	131 Å²	131	119.1 Å²	119.1	69%	0.686	59%	0.592	S	S	*	*	H	α-helix	trans	-65.1	-34.2	176.5	-145.6	76.5	0	0	0	111.1	F35 I36 T43	F35-L39 VanDerWaalsContact O-CB 3.31Å; F35-L39 WeakPolarHBondContact O-CB 3.38Å; F35-L39 PolarHBondContact O-N 3.41Å; I36-L39 PolarHBondContact O-N 3.47Å; L39-T43 PolarHBondContact O-N 3.31Å
40	W	82.6	Confident	77.1	Confident	172 Å²	172	117.2 Å²	117.2	65%	0.652	59%	0.585	S	S	*	*	H	α-helix	trans	-70.1	-47.9	176.7	-167.8	-93.4	0	0	0	112	I36 E37 R38 L42 T43 E44	I36-W40 WeakPolarHBondContact O-CB 3.48Å; I36-W40 PolarHBondContact O-N 3.36Å; E37-W40 PolarHBondContact O-N 2.94Å; R38-W40 PolarHBondContact O-N 3.3Å; W40-L42 VanDerWaalsContact C-N 3.31Å; W40-L42 PolarHBondContact O-N 2.83Å; W40-T43 HydrophobicContact CD2-CG2 4.25Å; W40-T43 HydrophobicContact CE3-CG2 4.21Å; W40-T43 HydrophobicContact CG-CG2 4.49Å; W40-T43 WeakPolarHBondContact O-CG2 3.34Å; W40-T43 PolarHBondContact O-N 3.34Å; W40-T43 VanDerWaalsContact O-N 3.08Å; W40-E44 PolarHBondContact O-N 2.82Å
41	G	82	Confident	78	Confident	30 Å²	30	112.3 Å²	112.3	31%	0.309	56%	0.559	S	S	.	*	H	α-helix	trans	-61.5	-38.4	173.5	0	0	0	0	0	112.3	E37 R38 T43 E44 M45	E37-G41 PolarHBondContact O-N 3.34Å; R38-G41 PolarHBondContact O-N 2.94Å; G41-T43 VanDerWaalsContact C-N 3.35Å; G41-T43 PolarHBondContact O-N 2.91Å; G41-E44 WeakPolarHBondContact O-CB 3.3Å; G41-E44 PolarHBondContact O-N 3.39Å; G41-E44 VanDerWaalsContact O-N 3.13Å; G41-M45 PolarHBondContact O-N 3.47Å
42	L	79.9	Confident	78.7	Confident	101 Å²	101	109 Å²	109	53%	0.529	55%	0.547	S	S	.	.	H	α-helix	trans	-61.8	-42	171.8	-122.7	74.5	0	0	0	111.6	R38 W40 E44 M45 F46	R38-L42 WeakPolarHBondContact O-CB 3.46Å; R38-L42 PolarHBondContact O-N 2.9Å; W40-L42 VanDerWaalsContact C-N 3.31Å; W40-L42 PolarHBondContact O-N 2.83Å; L42-E44 PolarHBondContact O-N 2.85Å; L42-M45 PolarHBondContact O-N 2.73Å; L42-F46 HydrophobicContact CB-CE2 4.29Å; L42-F46 HydrophobicContact CD2-CE2 4.38Å; L42-F46 HydrophobicContact CG-CE2 4.26Å; L42-F46 WeakPolarHBondContact O-CD2 3.39Å; L42-F46 VanDerWaalsContact O-CE2 3.22Å; L42-F46 WeakPolarHBondContact O-CE2 3.22Å
43	T	76.8	Confident	79.2	Confident	39 Å²	39	104.6 Å²	104.6	24%	0.239	53%	0.53	C	S	.	.	H	α-helix	trans	-65.8	-22.2	175.8	-158.4	0	0	0	0	113.4	L39 W40 G41 R51	L39-T43 PolarHBondContact O-N 3.31Å; W40-T43 HydrophobicContact CD2-CG2 4.25Å; W40-T43 HydrophobicContact CE3-CG2 4.21Å; W40-T43 HydrophobicContact CG-CG2 4.49Å; W40-T43 WeakPolarHBondContact O-CG2 3.34Å; W40-T43 PolarHBondContact O-N 3.34Å; W40-T43 VanDerWaalsContact O-N 3.08Å; G41-T43 VanDerWaalsContact C-N 3.35Å; G41-T43 PolarHBondContact O-N 2.91Å; T43-R51 VanDerWaalsContact C-NH2 3.28Å; T43-R51 VanDerWaalsContact O-CZ 3.28Å; T43-R51 PolarHBondContact O-NE 3.48Å; T43-R51 VanDerWaalsContact O-NE 3.09Å; T43-R51 PolarHBondContact O-NH2 2.75Å; T43-R51 PolarHBondContact OG1-NE 3.36Å; T43-R51 VanDerWaalsContact OG1-NE 3.08Å
44	E	77.8	Confident	79.7	Confident	145 Å²	145	101.9 Å²	101.9	68%	0.678	53%	0.527	S	S	*	.	H	α-helix	trans	-75.3	-26.6	176.3	-157.8	171.8	-166.4	0	0	113.1	W40 G41 L42	W40-E44 PolarHBondContact O-N 2.82Å; G41-E44 WeakPolarHBondContact O-CB 3.3Å; G41-E44 PolarHBondContact O-N 3.39Å; G41-E44 VanDerWaalsContact O-N 3.13Å; L42-E44 PolarHBondContact O-N 2.85Å
45	M	80.1	Confident	79.7	Confident	167 Å²	167	105 Å²	105	82%	0.823	54%	0.537	S	S	*	.	S	Bend	trans	-82.4	-10	174.3	-61.5	-173.4	86.6	0	0	113.7	G41 L42	G41-M45 PolarHBondContact O-N 3.47Å; L42-M45 PolarHBondContact O-N 2.73Å
46	F	75.3	Confident	79.9	Confident	105 Å²	105	100.6 Å²	100.6	46%	0.461	52%	0.524	S	S	.	.	S	Bend	trans	-91.8	139.3	-178.2	-70.1	-59.9	0	0	0	112.4	L42 L50	L42-F46 HydrophobicContact CB-CE2 4.29Å; L42-F46 HydrophobicContact CD2-CE2 4.38Å; L42-F46 HydrophobicContact CG-CE2 4.26Å; L42-F46 WeakPolarHBondContact O-CD2 3.39Å; L42-F46 VanDerWaalsContact O-CE2 3.22Å; L42-F46 WeakPolarHBondContact O-CE2 3.22Å; F46-L50 HydrophobicContact CB-CB 4.44Å; F46-L50 HydrophobicContact CB-CD1 4.15Å; F46-L50 HydrophobicContact CD1-CD1 3.72Å; F46-L50 HydrophobicContact CG-CD1 4.18Å
47	P	76.9	Confident	80.1	Confident	74 Å²	74	98.7 Å²	98.7	48%	0.481	52%	0.519	S	S	.	.			trans	-64.3	150	179	25.7	-35.4	0	0	0	112.4	T49 L50	P47-T49 PolarHBondContact O-N 3.47Å; P47-L50 HydrophobicContact CG-CD1 4.07Å; P47-L50 HydrophobicContact CG-CG 4.12Å; P47-L50 PolarHBondContact O-N 3.33Å
48	D	75.1	Confident	80.6	Confident	122 Å²	122	98.1 Å²	98.1	65%	0.652	52%	0.523	S	S	*	.	H	α-helix	trans	-50.1	-34.3	-176.7	-69.2	-48.3	0	0	0	113.7	L50 R51 S52	D48-L50 VanDerWaalsContact C-N 3.28Å; D48-L50 PolarHBondContact O-N 2.89Å; D48-R51 PolarHBondContact O-N 2.93Å; D48-R51 VanDerWaalsContact O-N 3.16Å; D48-S52 PolarHBondContact O-N 3.14Å; D48-S52 PolarHBondContact O-OG 2.81Å
49	T	75	Confident	80.9	Confident	102 Å²	102	94.5 Å²	94.5	63%	0.626	52%	0.518	S	S	*	.	H	α-helix	trans	-57.1	-35.9	176	57.2	0	0	0	0	114.1	P47 A53	P47-T49 PolarHBondContact O-N 3.47Å; T49-A53 WeakPolarHBondContact O-CB 3.02Å; T49-A53 PolarHBondContact O-N 3.09Å
50	L	78.2	Confident	81.2	Confident	90 Å²	90	91.6 Å²	91.6	47%	0.471	51%	0.509	S	S	.	.	H	α-helix	trans	-75.8	-36.5	177.2	-67.1	-179.2	0	0	0	111.5	F46 P47 D48 A53 A54	F46-L50 HydrophobicContact CB-CB 4.44Å; F46-L50 HydrophobicContact CB-CD1 4.15Å; F46-L50 HydrophobicContact CD1-CD1 3.72Å; F46-L50 HydrophobicContact CG-CD1 4.18Å; P47-L50 HydrophobicContact CG-CD1 4.07Å; P47-L50 HydrophobicContact CG-CG 4.12Å; P47-L50 PolarHBondContact O-N 3.33Å; D48-L50 VanDerWaalsContact C-N 3.28Å; D48-L50 PolarHBondContact O-N 2.89Å; L50-A53 PolarHBondContact O-N 2.9Å; L50-A54 WeakPolarHBondContact O-CB 3.01Å; L50-A54 PolarHBondContact O-N 3.49Å
51	R	78.7	Confident	81.6	Confident	79 Å²	79	87 Å²	87	30%	0.298	50%	0.503	S	S	.	.	H	α-helix	trans	-64	-47	172.4	-83.3	-178.3	175.2	176.8	-3	111.2	T43 D48 A53 A54 E55	T43-R51 VanDerWaalsContact C-NH2 3.28Å; T43-R51 VanDerWaalsContact O-CZ 3.28Å; T43-R51 PolarHBondContact O-NE 3.48Å; T43-R51 VanDerWaalsContact O-NE 3.09Å; T43-R51 PolarHBondContact O-NH2 2.75Å; T43-R51 PolarHBondContact OG1-NE 3.36Å; T43-R51 VanDerWaalsContact OG1-NE 3.08Å; D48-R51 PolarHBondContact O-N 2.93Å; D48-R51 VanDerWaalsContact O-N 3.16Å; R51-A53 VanDerWaalsContact C-N 3.32Å; R51-A53 PolarHBondContact O-N 2.66Å; R51-A54 PolarHBondContact O-N 2.83Å; R51-A54 VanDerWaalsContact O-N 3.17Å; R51-E55 WeakPolarHBondContact O-CB 2.9Å; R51-E55 WeakPolarHBondContact O-CG 3.33Å; R51-E55 PolarHBondContact O-N 3.03Å
52	S	77.9	Confident	82.2	Confident	63 Å²	63	88.7 Å²	88.7	44%	0.441	51%	0.507	S	S	.	.	H	α-helix	trans	-61.5	-39.5	175.6	-57.9	0	0	0	0	112.1	D48 E55 V56	D48-S52 PolarHBondContact O-N 3.14Å; D48-S52 PolarHBondContact O-OG 2.81Å; S52-E55 PolarHBondContact O-N 3.2Å; S52-V56 WeakPolarHBondContact O-CB 3.28Å; S52-V56 VanDerWaalsContact O-CG2 3.22Å; S52-V56 WeakPolarHBondContact O-CG2 3.36Å; S52-V56 PolarHBondContact O-N 3.39Å
53	A	81.4	Confident	82.7	Confident	51 Å²	51	87.6 Å²	87.6	42%	0.421	50%	0.504	S	S	.	.	H	α-helix	trans	-64.9	-40.7	174.7	0	0	0	0	0	112.3	T49 L50 R51 V56 T57	T49-A53 WeakPolarHBondContact O-CB 3.02Å; T49-A53 PolarHBondContact O-N 3.09Å; L50-A53 PolarHBondContact O-N 2.9Å; R51-A53 VanDerWaalsContact C-N 3.32Å; R51-A53 PolarHBondContact O-N 2.66Å; A53-V56 PolarHBondContact O-N 3.01Å; A53-T57 WeakPolarHBondContact O-CB 3.37Å; A53-T57 PolarHBondContact O-N 2.76Å; A53-T57 PolarHBondContact O-OG1 2.84Å
54	A	83.8	Confident	83.6	Confident	53 Å²	53	91.8 Å²	91.8	44%	0.438	52%	0.523	S	S	.	.	H	α-helix	trans	-64.3	-44	174.8	0	0	0	0	0	111.5	L50 R51 V56 T57 V58	L50-A54 WeakPolarHBondContact O-CB 3.01Å; L50-A54 PolarHBondContact O-N 3.49Å; R51-A54 PolarHBondContact O-N 2.83Å; R51-A54 VanDerWaalsContact O-N 3.17Å; A54-V56 PolarHBondContact O-N 3.49Å; A54-T57 WeakPolarHBondContact O-CB 3.32Å; A54-T57 PolarHBondContact O-N 2.75Å; A54-T57 VanDerWaalsContact O-N 3.15Å; A54-V58 WeakPolarHBondContact O-CB 3.19Å; A54-V58 VanDerWaalsContact O-CG2 3.29Å; A54-V58 WeakPolarHBondContact O-CG2 3.46Å; A54-V58 PolarHBondContact O-N 2.82Å
55	E	83.3	Confident	84.4	Confident	128 Å²	128	87.5 Å²	87.5	60%	0.598	51%	0.512	S	S	*	.	H	α-helix	trans	-61.7	-42.3	175.3	-74.3	177.8	176.9	0	0	112.3	R51 S52 T57 V58 S59	R51-E55 WeakPolarHBondContact O-CB 2.9Å; R51-E55 WeakPolarHBondContact O-CG 3.33Å; R51-E55 PolarHBondContact O-N 3.03Å; S52-E55 PolarHBondContact O-N 3.2Å; E55-T57 VanDerWaalsContact C-N 3.29Å; E55-T57 PolarHBondContact O-N 2.84Å; E55-V58 PolarHBondContact O-N 3.4Å; E55-S59 VanDerWaalsContact O-CB 3.23Å; E55-S59 WeakPolarHBondContact O-CB 3.46Å; E55-S59 PolarHBondContact O-N 3.47Å; E55-S59 PolarHBondContact O-OG 2.74Å
56	V	87.6	Confident	85.1	Confident	87 Å²	87	86.5 Å²	86.5	53%	0.527	50%	0.503	S	S	.	.	H	α-helix	trans	-63.5	-38	174.2	171.2	0	0	0	0	110.9	S52 A53 A54 S59 S60	S52-V56 WeakPolarHBondContact O-CB 3.28Å; S52-V56 VanDerWaalsContact O-CG2 3.22Å; S52-V56 WeakPolarHBondContact O-CG2 3.36Å; S52-V56 PolarHBondContact O-N 3.39Å; A53-V56 PolarHBondContact O-N 3.01Å; A54-V56 PolarHBondContact O-N 3.49Å; V56-S59 WeakPolarHBondContact CA-OG 3.38Å; V56-S59 PolarHBondContact O-OG 2.83Å; V56-S59 VanDerWaalsContact O-OG 3.05Å; V56-S60 WeakPolarHBondContact O-CB 3.45Å; V56-S60 PolarHBondContact O-N 3.39Å; V56-S60 PolarHBondContact O-OG 3.02Å
57	T	88.4	Confident	86	Confident	94 Å²	94	88.2 Å²	88.2	58%	0.577	51%	0.511	S	S	*	.	H	α-helix	trans	-69.5	-45.1	178.1	-56.3	0	0	0	0	111.4	A53 A54 E55 S60 S61	A53-T57 WeakPolarHBondContact O-CB 3.37Å; A53-T57 PolarHBondContact O-N 2.76Å; A53-T57 PolarHBondContact O-OG1 2.84Å; A54-T57 WeakPolarHBondContact O-CB 3.32Å; A54-T57 PolarHBondContact O-N 2.75Å; A54-T57 VanDerWaalsContact O-N 3.15Å; E55-T57 VanDerWaalsContact C-N 3.29Å; E55-T57 PolarHBondContact O-N 2.84Å; T57-S60 PolarHBondContact O-N 2.96Å; T57-S61 VanDerWaalsContact O-CB 3.31Å; T57-S61 WeakPolarHBondContact O-CB 3.47Å; T57-S61 PolarHBondContact O-N 3.36Å
58	V	89.5	Confident	86.9	Confident	93 Å²	93	89.2 Å²	89.2	56%	0.564	51%	0.512	S	S	*	.	H	α-helix	trans	-64.4	-47.3	177.1	171.1	0	0	0	0	110.5	A54 E55 S60 S61 V62	A54-V58 WeakPolarHBondContact O-CB 3.19Å; A54-V58 VanDerWaalsContact O-CG2 3.29Å; A54-V58 WeakPolarHBondContact O-CG2 3.46Å; A54-V58 PolarHBondContact O-N 2.82Å; E55-V58 PolarHBondContact O-N 3.4Å; V58-S60 VanDerWaalsContact C-N 3.35Å; V58-S60 PolarHBondContact O-N 3.44Å; V58-S61 WeakPolarHBondContact O-CB 3.34Å; V58-S61 PolarHBondContact O-N 3.35Å; V58-V62 HydrophobicContact CG1-CG2 4.47Å; V58-V62 VanDerWaalsContact O-CG2 3.31Å; V58-V62 WeakPolarHBondContact O-CG2 3.41Å; V58-V62 PolarHBondContact O-N 3.38Å
59	S	87.9	Confident	87.9	Confident	59 Å²	59	91.3 Å²	91.3	41%	0.413	51%	0.511	S	S	.	.	H	α-helix	trans	-64.9	-37.8	177.5	59.6	0	0	0	0	112.3	E55 V56 T63	E55-S59 VanDerWaalsContact O-CB 3.23Å; E55-S59 WeakPolarHBondContact O-CB 3.46Å; E55-S59 PolarHBondContact O-N 3.47Å; E55-S59 PolarHBondContact O-OG 2.74Å; V56-S59 WeakPolarHBondContact CA-OG 3.38Å; V56-S59 PolarHBondContact O-OG 2.83Å; V56-S59 VanDerWaalsContact O-OG 3.05Å; S59-T63 VanDerWaalsContact O-CB 3.29Å; S59-T63 WeakPolarHBondContact O-CB 3.32Å; S59-T63 PolarHBondContact O-N 2.73Å; S59-T63 PolarHBondContact O-OG1 2.99Å
60	S	86.7	Confident	88.8	Confident	69 Å²	69	89.5 Å²	89.5	48%	0.483	50%	0.503	S	S	.	.	H	α-helix	trans	-63.2	-44	171.8	-68.8	0	0	0	0	111.6	V56 T57 V58 T63 M64	V56-S60 WeakPolarHBondContact O-CB 3.45Å; V56-S60 PolarHBondContact O-N 3.39Å; V56-S60 PolarHBondContact O-OG 3.02Å; T57-S60 PolarHBondContact O-N 2.96Å; V58-S60 VanDerWaalsContact C-N 3.35Å; V58-S60 PolarHBondContact O-N 3.44Å; S60-T63 PolarHBondContact O-N 3.22Å; S60-M64 WeakPolarHBondContact O-CB 3.44Å; S60-M64 PolarHBondContact O-N 3.12Å
61	S	91.8	Very high	89.6	Confident	76 Å²	76	91.8 Å²	91.8	53%	0.531	51%	0.509	S	S	.	.	H	α-helix	trans	-62.7	-46.5	177.4	-174.4	0	0	0	0	111.7	T57 V58 T63 M64 A65	T57-S61 VanDerWaalsContact O-CB 3.31Å; T57-S61 WeakPolarHBondContact O-CB 3.47Å; T57-S61 PolarHBondContact O-N 3.36Å; V58-S61 WeakPolarHBondContact O-CB 3.34Å; V58-S61 PolarHBondContact O-N 3.35Å; S61-T63 VanDerWaalsContact C-N 3.31Å; S61-T63 PolarHBondContact O-N 3.48Å; S61-M64 PolarHBondContact O-N 2.63Å; S61-A65 WeakPolarHBondContact O-CB 3.42Å; S61-A65 PolarHBondContact O-N 2.8Å
62	V	93.5	Very high	90.5	Very high	66 Å²	66	90.8 Å²	90.8	40%	0.4	51%	0.514	S	S	.	.	H	α-helix	trans	-62.6	-39.8	175.9	172.1	0	0	0	0	111.1	V58 A65 K66	V58-V62 HydrophobicContact CG1-CG2 4.47Å; V58-V62 VanDerWaalsContact O-CG2 3.31Å; V58-V62 WeakPolarHBondContact O-CG2 3.41Å; V58-V62 PolarHBondContact O-N 3.38Å; V62-A65 PolarHBondContact O-N 2.81Å; V62-K66 HydrophobicContact CG1-CD 4.19Å; V62-K66 WeakPolarHBondContact O-CB 2.94Å; V62-K66 VanDerWaalsContact O-CG 3.31Å; V62-K66 WeakPolarHBondContact O-CG 3.47Å; V62-K66 PolarHBondContact O-N 3.02Å
63	T	91.8	Very high	91.3	Very high	77 Å²	77	96.3 Å²	96.3	47%	0.472	53%	0.525	S	S	.	.	H	α-helix	trans	-66.2	-43.1	176.7	-59.7	0	0	0	0	111.2	S59 S60 S61 K66 K67	S59-T63 VanDerWaalsContact O-CB 3.29Å; S59-T63 WeakPolarHBondContact O-CB 3.32Å; S59-T63 PolarHBondContact O-N 2.73Å; S59-T63 PolarHBondContact O-OG1 2.99Å; S60-T63 PolarHBondContact O-N 3.22Å; S61-T63 VanDerWaalsContact C-N 3.31Å; S61-T63 PolarHBondContact O-N 3.48Å; T63-K66 PolarHBondContact O-N 3.21Å; T63-K67 HydrophobicContact CG2-CG 4.46Å; T63-K67 WeakPolarHBondContact O-CB 3.36Å; T63-K67 WeakPolarHBondContact O-CG 3.32Å; T63-K67 PolarHBondContact O-N 2.81Å
64	M	94.4	Very high	92	Very high	127 Å²	127	96.3 Å²	96.3	63%	0.626	53%	0.526	S	S	*	.	H	α-helix	trans	-62.5	-45.4	175.8	-172.3	173.8	-175.4	0	0	111.2	S60 S61 K66 K67 L68	S60-M64 WeakPolarHBondContact O-CB 3.44Å; S60-M64 PolarHBondContact O-N 3.12Å; S61-M64 PolarHBondContact O-N 2.63Å; M64-K66 PolarHBondContact O-N 2.9Å; M64-K67 PolarHBondContact O-N 3.45Å; M64-L68 HydrophobicContact CG-CD1 4.17Å; M64-L68 WeakPolarHBondContact O-CB 3.34Å; M64-L68 WeakPolarHBondContact O-CG 3.31Å; M64-L68 PolarHBondContact O-N 3.34Å
65	A	94.8	Very high	92.6	Very high	55 Å²	55	95.9 Å²	95.9	46%	0.455	52%	0.522	S	S	.	.	H	α-helix	trans	-60.6	-45.3	176	0	0	0	0	0	111.8	S61 V62 K67 L68 Y69	S61-A65 WeakPolarHBondContact O-CB 3.42Å; S61-A65 PolarHBondContact O-N 2.8Å; V62-A65 PolarHBondContact O-N 2.81Å; A65-K67 VanDerWaalsContact C-N 3.33Å; A65-K67 PolarHBondContact O-N 3.31Å; A65-L68 PolarHBondContact O-N 3.24Å; A65-Y69 WeakPolarHBondContact O-CB 3.43Å; A65-Y69 PolarHBondContact O-N 2.92Å
66	K	95.2	Very high	93.2	Very high	146 Å²	146	95.2 Å²	95.2	64%	0.635	52%	0.522	S	S	*	.	H	α-helix	trans	-60.7	-42.1	174.8	-76.9	174.2	-179.5	174.4	0	111.9	V62 T63 M64 Y69 S70	V62-K66 HydrophobicContact CG1-CD 4.19Å; V62-K66 WeakPolarHBondContact O-CB 2.94Å; V62-K66 VanDerWaalsContact O-CG 3.31Å; V62-K66 WeakPolarHBondContact O-CG 3.47Å; V62-K66 PolarHBondContact O-N 3.02Å; T63-K66 PolarHBondContact O-N 3.21Å; M64-K66 PolarHBondContact O-N 2.9Å; K66-Y69 PolarHBondContact O-N 3.44Å; K66-S70 WeakPolarHBondContact O-CB 3.42Å; K66-S70 PolarHBondContact O-N 3.46Å; K66-S70 PolarHBondContact O-OG 3.46Å
67	K	94.8	Very high	93.6	Very high	142 Å²	142	99.9 Å²	99.9	62%	0.617	53%	0.53	S	S	*	.	H	α-helix	trans	-65.9	-46.8	178.3	-72.9	-79.1	175	173.1	0	111.3	T63 M64 A65 Y69 S70 F71	T63-K67 HydrophobicContact CG2-CG 4.46Å; T63-K67 WeakPolarHBondContact O-CB 3.36Å; T63-K67 WeakPolarHBondContact O-CG 3.32Å; T63-K67 PolarHBondContact O-N 2.81Å; M64-K67 PolarHBondContact O-N 3.45Å; A65-K67 VanDerWaalsContact C-N 3.33Å; A65-K67 PolarHBondContact O-N 3.31Å; K67-Y69 VanDerWaalsContact C-N 3.35Å; K67-Y69 PolarHBondContact O-N 2.75Å; K67-S70 WeakPolarHBondContact CA-OG 3.31Å; K67-S70 PolarHBondContact O-N 3.41Å; K67-S70 PolarHBondContact O-OG 2.95Å; K67-F71 VanDerWaalsContact O-CB 3.31Å; K67-F71 WeakPolarHBondContact O-CB 3.15Å; K67-F71 PolarHBondContact O-N 3.41Å
68	L	95.6	Very high	94	Very high	95 Å²	95	99.5 Å²	99.5	50%	0.497	53%	0.528	S	S	.	.	H	α-helix	trans	-59.1	-45.6	174.8	-74.4	171.5	0	0	0	111.3	M64 A65 S70 F71 S72	M64-L68 HydrophobicContact CG-CD1 4.17Å; M64-L68 WeakPolarHBondContact O-CB 3.34Å; M64-L68 WeakPolarHBondContact O-CG 3.31Å; M64-L68 PolarHBondContact O-N 3.34Å; A65-L68 PolarHBondContact O-N 3.24Å; L68-S70 PolarHBondContact O-N 2.83Å; L68-F71 PolarHBondContact O-N 2.8Å; L68-S72 WeakPolarHBondContact O-CB 3.32Å; L68-S72 PolarHBondContact O-N 3.28Å; L68-S72 PolarHBondContact O-OG 2.89Å
69	Y	96	Very high	94.4	Very high	166 Å²	166	96.9 Å²	96.9	65%	0.651	52%	0.519	S	S	*	.	H	α-helix	trans	-59.5	-47.3	175.5	177.9	-100.1	0	0	0	111.9	A65 K66 K67 F71 S72 R73	A65-Y69 WeakPolarHBondContact O-CB 3.43Å; A65-Y69 PolarHBondContact O-N 2.92Å; K66-Y69 PolarHBondContact O-N 3.44Å; K67-Y69 VanDerWaalsContact C-N 3.35Å; K67-Y69 PolarHBondContact O-N 2.75Å; Y69-F71 VanDerWaalsContact C-N 3.34Å; Y69-F71 PolarHBondContact O-N 2.77Å; Y69-S72 PolarHBondContact O-N 2.74Å; Y69-R73 WeakPolarHBondContact O-CB 3.15Å; Y69-R73 PolarHBondContact O-N 3.48Å
70	S	93.8	Very high	94.7	Very high	63 Å²	63	97.5 Å²	97.5	44%	0.441	52%	0.521	S	S	.	.	H	α-helix	trans	-63.8	-39.2	178.5	71.3	0	0	0	0	112.6	K66 K67 L68 R73 A74	K66-S70 WeakPolarHBondContact O-CB 3.42Å; K66-S70 PolarHBondContact O-N 3.46Å; K66-S70 PolarHBondContact O-OG 3.46Å; K67-S70 WeakPolarHBondContact CA-OG 3.31Å; K67-S70 PolarHBondContact O-N 3.41Å; K67-S70 PolarHBondContact O-OG 2.95Å; L68-S70 PolarHBondContact O-N 2.83Å; S70-R73 PolarHBondContact O-N 3.47Å; S70-A74 WeakPolarHBondContact O-CB 3.27Å; S70-A74 PolarHBondContact O-N 3.37Å
71	F	95.6	Very high	95.2	Very high	139 Å²	139	96.9 Å²	96.9	61%	0.61	51%	0.514	S	S	*	.	H	α-helix	trans	-66.6	-48.4	176.5	175.4	-96.8	0	0	0	110.8	K67 L68 Y69 R73 A74 A75	K67-F71 VanDerWaalsContact O-CB 3.31Å; K67-F71 WeakPolarHBondContact O-CB 3.15Å; K67-F71 PolarHBondContact O-N 3.41Å; L68-F71 PolarHBondContact O-N 2.8Å; Y69-F71 VanDerWaalsContact C-N 3.34Å; Y69-F71 PolarHBondContact O-N 2.77Å; F71-R73 VanDerWaalsContact C-N 3.28Å; F71-R73 PolarHBondContact O-N 2.81Å; F71-A74 CarbonylContact O-C 3.59Å; F71-A74 PolarHBondContact O-N 2.93Å; F71-A74 VanDerWaalsContact O-N 3.12Å; F71-A75 HydrophobicContact CE1-CB 4.27Å; F71-A75 HydrophobicContact CZ-CB 4.44Å; F71-A75 VanDerWaalsContact O-CB 3.28Å; F71-A75 WeakPolarHBondContact O-CB 3.34Å; F71-A75 PolarHBondContact O-N 2.82Å
72	S	95.9	Very high	95.4	Very high	58 Å²	58	95.8 Å²	95.8	41%	0.406	51%	0.506	S	S	.	.	H	α-helix	trans	-58	-42.5	176.6	-66	0	0	0	0	111.3	L68 Y69 A75 L76	L68-S72 WeakPolarHBondContact O-CB 3.32Å; L68-S72 PolarHBondContact O-N 3.28Å; L68-S72 PolarHBondContact O-OG 2.89Å; Y69-S72 PolarHBondContact O-N 2.74Å; S72-A75 PolarHBondContact O-N 3.24Å; S72-L76 VanDerWaalsContact O-CB 3.24Å; S72-L76 WeakPolarHBondContact O-CB 3.42Å; S72-L76 PolarHBondContact O-N 3.4Å
73	R	96.1	Very high	95.5	Very high	178 Å²	178	98.9 Å²	98.9	67%	0.672	51%	0.514	S	S	*	.	H	α-helix	trans	-61.7	-45.1	175.5	-168.5	179.3	109.1	152.1	4.3	111.8	Y69 S70 F71 W77	Y69-R73 WeakPolarHBondContact O-CB 3.15Å; Y69-R73 PolarHBondContact O-N 3.48Å; S70-R73 PolarHBondContact O-N 3.47Å; F71-R73 VanDerWaalsContact C-N 3.28Å; F71-R73 PolarHBondContact O-N 2.81Å; R73-W77 WeakPolarHBondContact O-CB 3.3Å; R73-W77 PolarHBondContact O-N 3.15Å
74	A	95.4	Very high	95.6	Very high	52 Å²	52	100.4 Å²	100.4	43%	0.43	52%	0.518	S	S	.	.	H	α-helix	trans	-65.8	-45.3	177.6	0	0	0	0	0	111.8	S70 F71 W77 V78	S70-A74 WeakPolarHBondContact O-CB 3.27Å; S70-A74 PolarHBondContact O-N 3.37Å; F71-A74 CarbonylContact O-C 3.59Å; F71-A74 PolarHBondContact O-N 2.93Å; F71-A74 VanDerWaalsContact O-N 3.12Å; A74-W77 PolarHBondContact O-N 3.48Å; A74-V78 WeakPolarHBondContact O-CB 3.28Å; A74-V78 VanDerWaalsContact O-CG2 3.29Å; A74-V78 WeakPolarHBondContact O-CG2 3.48Å; A74-V78 PolarHBondContact O-N 3.05Å
75	A	96.2	Very high	95.6	Very high	43 Å²	43	100.2 Å²	100.2	36%	0.355	52%	0.518	S	S	.	.	H	α-helix	trans	-64	-41.1	178.4	0	0	0	0	0	111.7	F71 S72 G79	F71-A75 HydrophobicContact CE1-CB 4.27Å; F71-A75 HydrophobicContact CZ-CB 4.44Å; F71-A75 VanDerWaalsContact O-CB 3.28Å; F71-A75 WeakPolarHBondContact O-CB 3.34Å; F71-A75 PolarHBondContact O-N 2.82Å; S72-A75 PolarHBondContact O-N 3.24Å; A75-G79 WeakPolarHBondContact O-CA 3.41Å; A75-G79 PolarHBondContact O-N 2.74Å
76	L	96.3	Very high	95.5	Very high	114 Å²	114	103.5 Å²	103.5	60%	0.597	53%	0.527	S	S	*	.	H	α-helix	trans	-62.3	-45	172.2	-92.8	153.8	0	0	0	111	S72 T80	S72-L76 VanDerWaalsContact O-CB 3.24Å; S72-L76 WeakPolarHBondContact O-CB 3.42Å; S72-L76 PolarHBondContact O-N 3.4Å; L76-T80 WeakPolarHBondContact O-CB 3.29Å; L76-T80 PolarHBondContact O-N 2.87Å; L76-T80 PolarHBondContact O-OG1 2.93Å
77	W	96.5	Very high	95.3	Very high	186 Å²	186	98.9 Å²	98.9	71%	0.705	51%	0.511	S	S	*	.	H	α-helix	trans	-65.6	-48.4	-179.4	-161.8	-118.4	0	0	0	112.2	R73 A74 T81	R73-W77 WeakPolarHBondContact O-CB 3.3Å; R73-W77 PolarHBondContact O-N 3.15Å; A74-W77 PolarHBondContact O-N 3.48Å; W77-T81 WeakPolarHBondContact O-CB 3.41Å; W77-T81 VanDerWaalsContact O-CG2 3.3Å; W77-T81 WeakPolarHBondContact O-CG2 3.29Å; W77-T81 PolarHBondContact O-N 3.45Å; W77-T81 PolarHBondContact O-OG1 3.44Å
78	V	96.6	Very high	95	Very high	86 Å²	86	95.9 Å²	95.9	52%	0.521	50%	0.501	S	S	.	.	H	α-helix	trans	-65.4	-44.6	176.7	174.9	0	0	0	0	110.7	A74 T81 S82	A74-V78 WeakPolarHBondContact O-CB 3.28Å; A74-V78 VanDerWaalsContact O-CG2 3.29Å; A74-V78 WeakPolarHBondContact O-CG2 3.48Å; A74-V78 PolarHBondContact O-N 3.05Å; V78-T81 WeakPolarHBondContact CA-OG1 3.31Å; V78-T81 PolarHBondContact O-N 2.85Å; V78-T81 PolarHBondContact O-OG1 2.83Å; V78-S82 WeakPolarHBondContact O-CB 3.33Å; V78-S82 PolarHBondContact O-N 3.42Å; V78-S82 PolarHBondContact O-OG 2.86Å
79	G	96.5	Very high	94.6	Very high	37 Å²	37	95 Å²	95	38%	0.381	50%	0.501	S	S	.	.	H	α-helix	trans	-63.7	-44	179	0	0	0	0	0	112.1	A75 F83	A75-G79 WeakPolarHBondContact O-CA 3.41Å; A75-G79 PolarHBondContact O-N 2.74Å; G79-F83 WeakPolarHBondContact O-CB 3.38Å; G79-F83 PolarHBondContact O-N 3.01Å
80	T	95.8	Very high	94.3	Very high	73 Å²	73	91.1 Å²	91.1	45%	0.448	50%	0.495	S	S	.	.	H	α-helix	trans	-64.9	-48.7	177.4	-57.1	0	0	0	0	110.7	L76 S82 F83 M84	L76-T80 WeakPolarHBondContact O-CB 3.29Å; L76-T80 PolarHBondContact O-N 2.87Å; L76-T80 PolarHBondContact O-OG1 2.93Å; T80-S82 PolarHBondContact O-N 2.82Å; T80-F83 PolarHBondContact O-N 3.41Å; T80-M84 VanDerWaalsContact O-CB 3.29Å; T80-M84 WeakPolarHBondContact O-CB 3.12Å; T80-M84 PolarHBondContact O-N 3.48Å
81	T	96.6	Very high	94.1	Very high	55 Å²	55	90.8 Å²	90.8	34%	0.337	49%	0.49	S	S	.	.	H	α-helix	trans	-64	-41.4	178.6	50.3	0	0	0	0	112.1	W77 V78 M84 I85	W77-T81 WeakPolarHBondContact O-CB 3.41Å; W77-T81 VanDerWaalsContact O-CG2 3.3Å; W77-T81 WeakPolarHBondContact O-CG2 3.29Å; W77-T81 PolarHBondContact O-N 3.45Å; W77-T81 PolarHBondContact O-OG1 3.44Å; V78-T81 WeakPolarHBondContact CA-OG1 3.31Å; V78-T81 PolarHBondContact O-N 2.85Å; V78-T81 PolarHBondContact O-OG1 2.83Å; T81-M84 PolarHBondContact O-N 2.91Å; T81-I85 VanDerWaalsContact O-CG1 3.31Å; T81-I85 WeakPolarHBondContact O-CG1 3.47Å; T81-I85 PolarHBondContact O-N 2.75Å
82	S	95.6	Very high	93.6	Very high	54 Å²	54	89.8 Å²	89.8	38%	0.378	49%	0.485	S	S	.	.	H	α-helix	trans	-64.4	-46.2	176.4	-57.6	0	0	0	0	111.5	V78 T80 M84 I85 L86	V78-S82 WeakPolarHBondContact O-CB 3.33Å; V78-S82 PolarHBondContact O-N 3.42Å; V78-S82 PolarHBondContact O-OG 2.86Å; T80-S82 PolarHBondContact O-N 2.82Å; S82-M84 VanDerWaalsContact C-N 3.34Å; S82-M84 PolarHBondContact O-N 3.22Å; S82-I85 PolarHBondContact O-N 3.47Å; S82-L86 WeakPolarHBondContact O-CG 3.24Å; S82-L86 PolarHBondContact O-N 2.9Å; S82-L86 VanDerWaalsContact O-N 3.14Å
83	F	95.1	Very high	93.2	Very high	130 Å²	130	93.4 Å²	93.4	57%	0.57	50%	0.496	S	S	*	.	H	α-helix	trans	-59.1	-46.4	174.8	177.9	-93.2	0	0	0	110.9	G79 T80 I85 L86 V87	G79-F83 WeakPolarHBondContact O-CB 3.38Å; G79-F83 PolarHBondContact O-N 3.01Å; T80-F83 PolarHBondContact O-N 3.41Å; F83-I85 VanDerWaalsContact C-N 3.35Å; F83-I85 PolarHBondContact O-N 3.39Å; F83-L86 PolarHBondContact O-N 3.17Å; F83-V87 HydrophobicContact CD1-CB 4.4Å; F83-V87 HydrophobicContact CD1-CG2 4.19Å; F83-V87 HydrophobicContact CD2-CG2 3.66Å; F83-V87 HydrophobicContact CE1-CB 4.11Å; F83-V87 HydrophobicContact CE1-CG1 4.19Å; F83-V87 HydrophobicContact CE1-CG2 3.97Å; F83-V87 HydrophobicContact CE2-CB 4.43Å; F83-V87 HydrophobicContact CE2-CG2 3.44Å; F83-V87 VanDerWaalsContact CE2-CG2 3.44Å; F83-V87 HydrophobicContact CG-CG2 4.05Å; F83-V87 HydrophobicContact CZ-CB 4.13Å; F83-V87 HydrophobicContact CZ-CG1 4.07Å; F83-V87 HydrophobicContact CZ-CG2 3.61Å; F83-V87 VanDerWaalsContact O-CB 3.27Å; F83-V87 WeakPolarHBondContact O-CB 3.2Å; F83-V87 WeakPolarHBondContact O-CG2 3.36Å; F83-V87 PolarHBondContact O-N 3.24Å
84	M	94.1	Very high	92.9	Very high	110 Å²	110	88 Å²	88	54%	0.542	48%	0.483	S	S	.	.	H	α-helix	trans	-58.3	-46.1	-179.8	-154.4	76.8	172.1	0	0	111.5	T80 T81 S82 L86 L88	T80-M84 VanDerWaalsContact O-CB 3.29Å; T80-M84 WeakPolarHBondContact O-CB 3.12Å; T80-M84 PolarHBondContact O-N 3.48Å; T81-M84 PolarHBondContact O-N 2.91Å; S82-M84 VanDerWaalsContact C-N 3.34Å; S82-M84 PolarHBondContact O-N 3.22Å; M84-L86 VanDerWaalsContact C-N 3.34Å; M84-L86 PolarHBondContact O-N 3.44Å; M84-L88 HydrophobicContact CE-CD1 3.96Å; M84-L88 HydrophobicContact CG-CD1 3.68Å; M84-L88 VanDerWaalsContact O-CB 3.32Å; M84-L88 WeakPolarHBondContact O-CB 3.41Å; M84-L88 WeakPolarHBondContact O-CD1 3.47Å; M84-L88 PolarHBondContact O-N 2.97Å; M84-L88 VanDerWaalsContact O-N 3.09Å; M84-L88 HydrophobicContact SD-CD1 4.18Å
85	I	94.3	Very high	92.3	Very high	123 Å²	123	90.1 Å²	90.1	63%	0.631	48%	0.484	S	S	*	.	H	α-helix	trans	-66.4	-36	-179.1	-68.6	167.5	0	0	0	111.9	T81 S82 F83 P89	T81-I85 VanDerWaalsContact O-CG1 3.31Å; T81-I85 WeakPolarHBondContact O-CG1 3.47Å; T81-I85 PolarHBondContact O-N 2.75Å; S82-I85 PolarHBondContact O-N 3.47Å; F83-I85 VanDerWaalsContact C-N 3.35Å; F83-I85 PolarHBondContact O-N 3.39Å; I85-P89 WeakPolarHBondContact O-CD 3.36Å; I85-P89 WeakPolarHBondContact O-CG 3.42Å
86	L	93.1	Very high	91.7	Very high	124 Å²	124	96.3 Å²	96.3	65%	0.649	50%	0.498	S	S	*	.	H	α-helix	trans	-83.2	-36.2	-177.6	-65.9	176.2	0	0	0	112.8	S82 F83 M84 V90	S82-L86 WeakPolarHBondContact O-CG 3.24Å; S82-L86 PolarHBondContact O-N 2.9Å; S82-L86 VanDerWaalsContact O-N 3.14Å; F83-L86 PolarHBondContact O-N 3.17Å; M84-L86 VanDerWaalsContact C-N 3.34Å; M84-L86 PolarHBondContact O-N 3.44Å; L86-V90 WeakPolarHBondContact O-CG2 3.29Å
87	V	91.4	Very high	90.8	Very high	48 Å²	48	95.5 Å²	95.5	29%	0.291	49%	0.494	S	S	.	.	H	α-helix	trans	-84.7	-32.8	-174.4	174.8	0	0	0	0	112.2	F83 V90 V91	F83-V87 HydrophobicContact CD1-CB 4.4Å; F83-V87 HydrophobicContact CD1-CG2 4.19Å; F83-V87 HydrophobicContact CD2-CG2 3.66Å; F83-V87 HydrophobicContact CE1-CB 4.11Å; F83-V87 HydrophobicContact CE1-CG1 4.19Å; F83-V87 HydrophobicContact CE1-CG2 3.97Å; F83-V87 HydrophobicContact CE2-CB 4.43Å; F83-V87 HydrophobicContact CE2-CG2 3.44Å; F83-V87 VanDerWaalsContact CE2-CG2 3.44Å; F83-V87 HydrophobicContact CG-CG2 4.05Å; F83-V87 HydrophobicContact CZ-CB 4.13Å; F83-V87 HydrophobicContact CZ-CG1 4.07Å; F83-V87 HydrophobicContact CZ-CG2 3.61Å; F83-V87 VanDerWaalsContact O-CB 3.27Å; F83-V87 WeakPolarHBondContact O-CB 3.2Å; F83-V87 WeakPolarHBondContact O-CG2 3.36Å; F83-V87 PolarHBondContact O-N 3.24Å; V87-V90 PolarHBondContact O-N 2.85Å; V87-V91 HydrophobicContact CG1-CG2 3.67Å; V87-V91 WeakPolarHBondContact O-CG2 3.33Å; V87-V91 PolarHBondContact O-N 2.8Å
88	L	88.1	Confident	90.1	Very high	79 Å²	79	92.4 Å²	92.4	41%	0.414	49%	0.487	S	S	.	.	H	α-helix	trans	-51.7	-55.2	176.4	-115.4	106.4	0	0	0	112.1	M84 V90 V91 F92	M84-L88 HydrophobicContact CE-CD1 3.96Å; M84-L88 HydrophobicContact CG-CD1 3.68Å; M84-L88 VanDerWaalsContact O-CB 3.32Å; M84-L88 WeakPolarHBondContact O-CB 3.41Å; M84-L88 WeakPolarHBondContact O-CD1 3.47Å; M84-L88 PolarHBondContact O-N 2.97Å; M84-L88 VanDerWaalsContact O-N 3.09Å; M84-L88 HydrophobicContact SD-CD1 4.18Å; L88-V90 VanDerWaalsContact C-N 3.32Å; L88-V90 PolarHBondContact O-N 3.42Å; L88-V91 PolarHBondContact O-N 3.16Å; L88-F92 HydrophobicContact CD2-CD2 4.26Å; L88-F92 HydrophobicContact CD2-CE2 3.71Å; L88-F92 HydrophobicContact CG-CE2 4.3Å; L88-F92 WeakPolarHBondContact O-CD2 3.44Å; L88-F92 PolarHBondContact O-N 3.17Å
89	P	88.4	Confident	89.5	Confident	77 Å²	77	92.5 Å²	92.5	50%	0.5	48%	0.484	S	S	.	.	H	α-helix	trans	-59.8	-40.8	-179.2	-24.2	34.6	0	0	0	113.1	I85 F92 E93	I85-P89 WeakPolarHBondContact O-CD 3.36Å; I85-P89 WeakPolarHBondContact O-CG 3.42Å; P89-F92 PolarHBondContact O-N 3.29Å; P89-E93 WeakPolarHBondContact O-CB 3.43Å; P89-E93 PolarHBondContact O-N 3.25Å
90	V	89.2	Confident	88.9	Confident	84 Å²	84	96.5 Å²	96.5	51%	0.509	49%	0.493	S	S	.	.	H	α-helix	trans	-64.8	-44.9	179.9	176.7	0	0	0	0	110.7	L86 V87 L88 E93 T94	L86-V90 WeakPolarHBondContact O-CG2 3.29Å; V87-V90 PolarHBondContact O-N 2.85Å; L88-V90 VanDerWaalsContact C-N 3.32Å; L88-V90 PolarHBondContact O-N 3.42Å; V90-E93 PolarHBondContact O-N 3.4Å; V90-T94 WeakPolarHBondContact O-CG2 3.11Å; V90-T94 PolarHBondContact O-N 3.13Å; V90-T94 PolarHBondContact O-OG1 2.83Å
91	V	88.6	Confident	88.2	Confident	57 Å²	57	99.2 Å²	99.2	35%	0.345	50%	0.501	S	S	.	.	H	α-helix	trans	-62.7	-46	177.1	173.7	0	0	0	0	110.1	V87 L88 E93 T94 E95	V87-V91 HydrophobicContact CG1-CG2 3.67Å; V87-V91 WeakPolarHBondContact O-CG2 3.33Å; V87-V91 PolarHBondContact O-N 2.8Å; L88-V91 PolarHBondContact O-N 3.16Å; V91-E93 VanDerWaalsContact C-N 3.31Å; V91-E93 PolarHBondContact O-N 3.31Å; V91-T94 WeakPolarHBondContact CA-OG1 3.45Å; V91-T94 PolarHBondContact O-N 3.04Å; V91-T94 VanDerWaalsContact O-N 3.13Å; V91-T94 PolarHBondContact O-OG1 3.44Å; V91-E95 HydrophobicContact CG1-CG 4.17Å; V91-E95 WeakPolarHBondContact O-CG 3.31Å; V91-E95 PolarHBondContact O-N 2.86Å
92	F	85.1	Confident	87.4	Confident	117 Å²	117	101.2 Å²	101.2	51%	0.513	51%	0.506	S	S	.	.	H	α-helix	trans	-59	-41.6	176.8	-88.3	-67.7	0	0	0	112.8	L88 P89 R96	L88-F92 HydrophobicContact CD2-CD2 4.26Å; L88-F92 HydrophobicContact CD2-CE2 3.71Å; L88-F92 HydrophobicContact CG-CE2 4.3Å; L88-F92 WeakPolarHBondContact O-CD2 3.44Å; L88-F92 PolarHBondContact O-N 3.17Å; P89-F92 PolarHBondContact O-N 3.29Å; F92-R96 VanDerWaalsContact O-CB 3.27Å; F92-R96 WeakPolarHBondContact O-CB 3.32Å; F92-R96 WeakPolarHBondContact O-CG 3.23Å; F92-R96 PolarHBondContact O-N 2.99Å
93	E	88.8	Confident	86.8	Confident	134 Å²	134	104.8 Å²	104.8	63%	0.626	52%	0.517	S	S	*	.	H	α-helix	trans	-63.5	-44.4	175.9	-169	172.5	-178.7	0	0	111.1	P89 V90 V91 R96 L97	P89-E93 WeakPolarHBondContact O-CB 3.43Å; P89-E93 PolarHBondContact O-N 3.25Å; V90-E93 PolarHBondContact O-N 3.4Å; V91-E93 VanDerWaalsContact C-N 3.31Å; V91-E93 PolarHBondContact O-N 3.31Å; E93-R96 PolarHBondContact O-N 3.08Å; E93-L97 HydrophobicContact CG-CD1 4.49Å; E93-L97 VanDerWaalsContact O-CG 3.3Å; E93-L97 WeakPolarHBondContact O-CG 3.49Å; E93-L97 PolarHBondContact O-N 3.47Å
94	T	88.9	Confident	86.2	Confident	65 Å²	65	103.3 Å²	103.3	40%	0.399	52%	0.515	S	S	.	.	H	α-helix	trans	-66.7	-38.5	177.8	60.3	0	0	0	0	113.4	V90 V91 L97 Q98	V90-T94 WeakPolarHBondContact O-CG2 3.11Å; V90-T94 PolarHBondContact O-N 3.13Å; V90-T94 PolarHBondContact O-OG1 2.83Å; V91-T94 WeakPolarHBondContact CA-OG1 3.45Å; V91-T94 PolarHBondContact O-N 3.04Å; V91-T94 VanDerWaalsContact O-N 3.13Å; V91-T94 PolarHBondContact O-OG1 3.44Å; T94-L97 PolarHBondContact O-N 3.28Å; T94-Q98 WeakPolarHBondContact O-CG 3.38Å; T94-Q98 PolarHBondContact O-N 3.08Å
95	E	83.5	Confident	85.4	Confident	97 Å²	97	103.7 Å²	103.7	45%	0.453	52%	0.515	S	S	.	.	H	α-helix	trans	-69.1	-40.1	176.3	-74.2	-170.9	171.4	0	0	111.3	V91 L97 Q98 L99	V91-E95 HydrophobicContact CG1-CG 4.17Å; V91-E95 WeakPolarHBondContact O-CG 3.31Å; V91-E95 PolarHBondContact O-N 2.86Å; E95-L97 VanDerWaalsContact C-N 3.34Å; E95-L97 PolarHBondContact O-N 2.78Å; E95-Q98 PolarHBondContact O-N 3.05Å; E95-L99 WeakPolarHBondContact O-CB 3.31Å; E95-L99 VanDerWaalsContact O-CG 3.28Å; E95-L99 WeakPolarHBondContact O-CG 3.22Å; E95-L99 PolarHBondContact O-N 3.09Å
96	R	83.1	Confident	84.5	Confident	173 Å²	173	103.2 Å²	103.2	65%	0.653	51%	0.51	S	S	*	.	H	α-helix	trans	-59.8	-45.2	174.9	-76	-72.5	-170	169.7	2.6	111.5	F92 E93 Q98 L99 E100	F92-R96 VanDerWaalsContact O-CB 3.27Å; F92-R96 WeakPolarHBondContact O-CB 3.32Å; F92-R96 WeakPolarHBondContact O-CG 3.23Å; F92-R96 PolarHBondContact O-N 2.99Å; E93-R96 PolarHBondContact O-N 3.08Å; R96-Q98 VanDerWaalsContact C-N 3.33Å; R96-Q98 PolarHBondContact O-N 3.41Å; R96-L99 PolarHBondContact O-N 2.77Å; R96-E100 PolarHBondContact O-N 3.45Å
97	L	78.1	Confident	83.8	Confident	96 Å²	96	103.2 Å²	103.2	50%	0.503	51%	0.507	S	S	.	.	H	α-helix	trans	-62.6	-40	175.7	-70.9	171	0	0	0	111.9	E93 T94 E95 Q101	E93-L97 HydrophobicContact CG-CD1 4.49Å; E93-L97 VanDerWaalsContact O-CG 3.3Å; E93-L97 WeakPolarHBondContact O-CG 3.49Å; E93-L97 PolarHBondContact O-N 3.47Å; T94-L97 PolarHBondContact O-N 3.28Å; E95-L97 VanDerWaalsContact C-N 3.34Å; E95-L97 PolarHBondContact O-N 2.78Å; L97-Q101 WeakPolarHBondContact O-CG 3.31Å; L97-Q101 PolarHBondContact O-N 2.92Å; L97-Q101 VanDerWaalsContact O-N 3.17Å
98	Q	81.3	Confident	82.8	Confident	121 Å²	121	109.5 Å²	109.5	57%	0.565	53%	0.525	S	S	*	.	H	α-helix	trans	-66.4	-40.8	175.8	-75.2	-177	11.6	0	0	112.4	T94 E95 R96 Q101 Q102	T94-Q98 WeakPolarHBondContact O-CG 3.38Å; T94-Q98 PolarHBondContact O-N 3.08Å; E95-Q98 PolarHBondContact O-N 3.05Å; R96-Q98 VanDerWaalsContact C-N 3.33Å; R96-Q98 PolarHBondContact O-N 3.41Å; Q98-Q101 PolarHBondContact O-N 3.48Å; Q98-Q102 WeakPolarHBondContact O-CB 3.38Å; Q98-Q102 VanDerWaalsContact O-CG 3.32Å; Q98-Q102 WeakPolarHBondContact O-CG 3.34Å; Q98-Q102 PolarHBondContact O-N 3.43Å
99	L	84.1	Confident	81.8	Confident	88 Å²	88	112 Å²	112	46%	0.461	54%	0.535	S	S	.	.	H	α-helix	trans	-64.4	-42.9	178	-73.2	171.9	0	0	0	111.9	E95 R96 Q102 Q103	E95-L99 WeakPolarHBondContact O-CB 3.31Å; E95-L99 VanDerWaalsContact O-CG 3.28Å; E95-L99 WeakPolarHBondContact O-CG 3.22Å; E95-L99 PolarHBondContact O-N 3.09Å; R96-L99 PolarHBondContact O-N 2.77Å; L99-Q102 PolarHBondContact O-N 3.27Å; L99-Q103 WeakPolarHBondContact O-CG 3.41Å; L99-Q103 PolarHBondContact O-N 3.26Å
100	E	84.4	Confident	80.8	Confident	121 Å²	121	114.8 Å²	114.8	57%	0.565	54%	0.544	S	S	*	.	H	α-helix	trans	-63.5	-42.6	176.7	-75.7	-176.6	178	0	0	112	R96 Q103 L104	R96-E100 PolarHBondContact O-N 3.45Å; E100-Q103 PolarHBondContact O-N 2.93Å; E100-L104 PolarHBondContact O-N 3.46Å
101	Q	80.4	Confident	79.6	Confident	130 Å²	130	118 Å²	118	61%	0.607	56%	0.558	S	S	*	*	H	α-helix	trans	-65.2	-40.1	175.7	-71.5	-155	18.4	0	0	112.4	L97 Q98 L104 Q105	L97-Q101 WeakPolarHBondContact O-CG 3.31Å; L97-Q101 PolarHBondContact O-N 2.92Å; L97-Q101 VanDerWaalsContact O-N 3.17Å; Q98-Q101 PolarHBondContact O-N 3.48Å; Q101-L104 PolarHBondContact O-N 2.82Å; Q101-Q105 WeakPolarHBondContact O-CB 3.48Å; Q101-Q105 VanDerWaalsContact O-CG 3.31Å; Q101-Q105 WeakPolarHBondContact O-CG 3.37Å; Q101-Q105 PolarHBondContact O-N 2.99Å
102	Q	80.4	Confident	78.4	Confident	97 Å²	97	120.3 Å²	120.3	45%	0.453	57%	0.567	S	S	.	*	H	α-helix	trans	-63.7	-41.1	175.2	-76.3	179.4	6.3	0	0	111.8	Q98 L99 Q105 Q106	Q98-Q102 WeakPolarHBondContact O-CB 3.38Å; Q98-Q102 VanDerWaalsContact O-CG 3.32Å; Q98-Q102 WeakPolarHBondContact O-CG 3.34Å; Q98-Q102 PolarHBondContact O-N 3.43Å; L99-Q102 PolarHBondContact O-N 3.27Å; Q102-Q105 PolarHBondContact O-N 3.02Å; Q102-Q106 WeakPolarHBondContact O-CB 3.36Å; Q102-Q106 WeakPolarHBondContact O-CG 3.49Å; Q102-Q106 PolarHBondContact O-N 2.88Å
103	Q	82	Confident	77.2	Confident	130 Å²	130	116 Å²	116	61%	0.607	56%	0.556	S	S	*	*	H	α-helix	trans	-65.3	-40.9	175.9	-74.9	-173	6.8	0	0	112.1	L99 E100 Q105 Q106 Q107	L99-Q103 WeakPolarHBondContact O-CG 3.41Å; L99-Q103 PolarHBondContact O-N 3.26Å; E100-Q103 PolarHBondContact O-N 2.93Å; Q103-Q105 VanDerWaalsContact C-N 3.34Å; Q103-Q106 PolarHBondContact O-N 2.93Å; Q103-Q107 VanDerWaalsContact O-CB 3.25Å; Q103-Q107 WeakPolarHBondContact O-CB 2.94Å; Q103-Q107 PolarHBondContact O-N 2.74Å
104	L	82.1	Confident	75.8	Confident	99 Å²	99	115.7 Å²	115.7	52%	0.518	57%	0.566	S	S	.	*	H	α-helix	trans	-63.7	-40.1	173.9	-81.1	166.5	0	0	0	111.9	E100 Q101 Q107 R108	E100-L104 PolarHBondContact O-N 3.46Å; Q101-L104 PolarHBondContact O-N 2.82Å; L104-Q107 PolarHBondContact O-N 2.85Å; L104-R108 WeakPolarHBondContact O-CB 3.31Å; L104-R108 WeakPolarHBondContact O-CG 3.2Å; L104-R108 PolarHBondContact O-N 3.03Å
105	Q	78.3	Confident	74.1	Confident	118 Å²	118	117.5 Å²	117.5	55%	0.551	57%	0.573	S	S	*	*	H	α-helix	trans	-65.5	-42.9	175.2	-74.9	177.2	-10.2	0	0	111.8	Q101 Q102 Q103 R108 Q109	Q101-Q105 WeakPolarHBondContact O-CB 3.48Å; Q101-Q105 VanDerWaalsContact O-CG 3.31Å; Q101-Q105 WeakPolarHBondContact O-CG 3.37Å; Q101-Q105 PolarHBondContact O-N 2.99Å; Q102-Q105 PolarHBondContact O-N 3.02Å; Q103-Q105 VanDerWaalsContact C-N 3.34Å; Q105-R108 PolarHBondContact O-N 2.77Å; Q105-Q109 WeakPolarHBondContact O-CB 3.29Å; Q105-Q109 WeakPolarHBondContact O-CG 3.47Å; Q105-Q109 PolarHBondContact O-N 3.09Å
106	Q	76.2	Confident	72.7	Confident	112 Å²	112	115.2 Å²	115.2	52%	0.523	57%	0.57	S	S	.	*	H	α-helix	trans	-65.4	-43	174.6	-75.9	-179.1	-7	0	0	111.7	Q102 Q103 R108 Q109 I110	Q102-Q106 WeakPolarHBondContact O-CB 3.36Å; Q102-Q106 WeakPolarHBondContact O-CG 3.49Å; Q102-Q106 PolarHBondContact O-N 2.88Å; Q103-Q106 PolarHBondContact O-N 2.93Å; Q106-R108 VanDerWaalsContact C-N 3.32Å; Q106-R108 PolarHBondContact O-N 2.89Å; Q106-Q109 CarbonylContact O-C 3.48Å; Q106-Q109 PolarHBondContact O-N 3Å; Q106-Q109 VanDerWaalsContact O-N 3.14Å; Q106-I110 WeakPolarHBondContact O-CB 3.22Å; Q106-I110 PolarHBondContact O-N 3.02Å
107	Q	77.3	Confident	71.2	Confident	125 Å²	125	111 Å²	111	58%	0.584	58%	0.581	S	S	*	*	H	α-helix	trans	-64.2	-40	176.8	-165.3	-178.8	33.6	0	0	110.4	Q103 L104 I110 L111	Q103-Q107 VanDerWaalsContact O-CB 3.25Å; Q103-Q107 WeakPolarHBondContact O-CB 2.94Å; Q103-Q107 PolarHBondContact O-N 2.74Å; L104-Q107 PolarHBondContact O-N 2.85Å; Q107-I110 PolarHBondContact O-N 2.64Å; Q107-L111 WeakPolarHBondContact O-CB 3.41Å; Q107-L111 PolarHBondContact O-N 2.92Å
108	R	71.4	Confident	69.9	Low	180 Å²	180	113.3 Å²	113.3	68%	0.679	59%	0.591	S	S	*	*	H	α-helix	trans	-63.7	-43	170.6	-74.5	-164.8	-176.7	179.6	3.8	111.6	L104 Q105 Q106 I110 L112	L104-R108 WeakPolarHBondContact O-CB 3.31Å; L104-R108 WeakPolarHBondContact O-CG 3.2Å; L104-R108 PolarHBondContact O-N 3.03Å; Q105-R108 PolarHBondContact O-N 2.77Å; Q106-R108 VanDerWaalsContact C-N 3.32Å; Q106-R108 PolarHBondContact O-N 2.89Å; R108-I110 VanDerWaalsContact C-N 3.35Å; R108-I110 PolarHBondContact O-N 2.95Å; R108-L112 HydrophobicContact CB-CD1 4.43Å; R108-L112 WeakPolarHBondContact O-CA 3.05Å; R108-L112 WeakPolarHBondContact O-CB 3.5Å; R108-L112 WeakPolarHBondContact O-CG 3.47Å; R108-L112 PolarHBondContact O-N 2.79Å
109	Q	66.9	Low	68.2	Low	131 Å²	131	112.3 Å²	112.3	61%	0.612	60%	0.597	S	S	*	*	H	α-helix	trans	-70	-25.1	176.7	-78.9	179.6	-7.2	0	0	114.2	Q105 Q106 G113	Q105-Q109 WeakPolarHBondContact O-CB 3.29Å; Q105-Q109 WeakPolarHBondContact O-CG 3.47Å; Q105-Q109 PolarHBondContact O-N 3.09Å; Q106-Q109 CarbonylContact O-C 3.48Å; Q106-Q109 PolarHBondContact O-N 3Å; Q106-Q109 VanDerWaalsContact O-N 3.14Å; Q109-G113 CarbonylContact O-C 2.9Å; Q109-G113 WeakPolarHBondContact O-CA 3.32Å; Q109-G113 PolarHBondContact O-N 2.91Å
110	I	66.9	Low	66.7	Low	136 Å²	136	111.8 Å²	111.8	70%	0.697	61%	0.613	S	S	*	*	H	α-helix	trans	-82.7	-40.6	175	-86.5	150.3	0	0	0	110.6	Q106 Q107 R108 G113	Q106-I110 WeakPolarHBondContact O-CB 3.22Å; Q106-I110 PolarHBondContact O-N 3.02Å; Q107-I110 PolarHBondContact O-N 2.64Å; R108-I110 VanDerWaalsContact C-N 3.35Å; R108-I110 PolarHBondContact O-N 2.95Å; I110-G113 PolarHBondContact O-N 3.16Å
111	L	64.8	Low	65.1	Low	152 Å²	152	108.9 Å²	108.9	80%	0.796	62%	0.615	S	S	*	*	H	α-helix	trans	-75.9	-27.7	178.3	-157.6	72.8	0	0	0	112.3	Q107	Q107-L111 WeakPolarHBondContact O-CB 3.41Å; Q107-L111 PolarHBondContact O-N 2.92Å
112	L	62	Low	63.4	Low	104 Å²	104	110.8 Å²	110.8	55%	0.545	63%	0.626	S	S	.	*	S	Bend	trans	-95.7	-3.7	171.6	-64.3	171.5	0	0	0	111.9	R108 A116	R108-L112 HydrophobicContact CB-CD1 4.43Å; R108-L112 WeakPolarHBondContact O-CA 3.05Å; R108-L112 WeakPolarHBondContact O-CB 3.5Å; R108-L112 WeakPolarHBondContact O-CG 3.47Å; R108-L112 PolarHBondContact O-N 2.79Å; L112-A116 HydrophobicContact CB-CB 3.89Å; L112-A116 HydrophobicContact CD2-CB 4.15Å; L112-A116 WeakPolarHBondContact O-CA 3.36Å; L112-A116 WeakPolarHBondContact O-CB 3.47Å; L112-A116 PolarHBondContact O-N 3.19Å
113	G	61.5	Low	61.9	Low	27 Å²	27	112.6 Å²	112.6	28%	0.278	65%	0.647	S	S	.	*	G	3₁₀ helix	trans	56.6	166.1	-169.4	0	0	0	0	0	112.9	Q109 I110 N115	Q109-G113 CarbonylContact O-C 2.9Å; Q109-G113 WeakPolarHBondContact O-CA 3.32Å; Q109-G113 PolarHBondContact O-N 2.91Å; I110-G113 PolarHBondContact O-N 3.16Å; G113-N115 PolarHBondContact O-N 2.92Å
114	P	58.8	Low	60.7	Low	128 Å²	128	109.3 Å²	109.3	83%	0.831	65%	0.648	S	S	*	*	G	3₁₀ helix	trans	-58.7	7.4	168	-24.1	33.9	0	0	0	115
115	N	51.8	Low	59.2	Low	103 Å²	103	113.7 Å²	113.7	55%	0.551	67%	0.668	S	S	*	*	G	3₁₀ helix	trans	-132.5	-13.9	-169.7	-90.6	-70.5	0	0	0	116.7	G113 G117 M118 S119	G113-N115 PolarHBondContact O-N 2.92Å; N115-G117 PolarHBondContact O-N 3.33Å; N115-M118 CarbonylContact O-C 3.58Å; N115-M118 PolarHBondContact O-N 3.09Å; N115-S119 PolarHBondContact O-N 3.21Å; N115-S119 VanDerWaalsContact O-N 3.09Å
116	A	55.7	Low	58.2	Low	48 Å²	48	116.7 Å²	116.7	40%	0.397	68%	0.684	S	S	.	*	T	Hydrogen-bonded Turn	trans	-77.2	-3.2	-177.9	0	0	0	0	0	114.5	L112	L112-A116 HydrophobicContact CB-CB 3.89Å; L112-A116 HydrophobicContact CD2-CB 4.15Å; L112-A116 WeakPolarHBondContact O-CA 3.36Å; L112-A116 WeakPolarHBondContact O-CB 3.47Å; L112-A116 PolarHBondContact O-N 3.19Å
117	G	50.7	Low	57.4	Low	84 Å²	84	117.1 Å²	117.1	87%	0.866	70%	0.696	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.5	-15.9	161.5	0	0	0	0	0	113.9	N115	N115-G117 PolarHBondContact O-N 3.33Å
118	M	50	Low	56.6	Low	146 Å²	146	117.2 Å²	117.2	72%	0.719	71%	0.708	S	S	*	*	T	Hydrogen-bonded Turn	trans	-113.3	-2	-176.8	-158	138.6	68.2	0	0	113.2	N115	N115-M118 CarbonylContact O-C 3.58Å; N115-M118 PolarHBondContact O-N 3.09Å
119	S	47.5	Very low	56.2	Low	99 Å²	99	112.5 Å²	112.5	69%	0.692	71%	0.707	S	S	*	*	S	Bend	trans	-90.5	4.8	173	77.7	0	0	0	0	113.9	N115	N115-S119 PolarHBondContact O-N 3.21Å; N115-S119 VanDerWaalsContact O-N 3.09Å
120	G	51.2	Low	56	Low	77 Å²	77	112.3 Å²	112.3	79%	0.794	72%	0.718	S	S	*	*	S	Bend	trans	-97.1	-6.4	-176.1	0	0	0	0	0	116.1
121	G	50.1	Low	55.5	Low	60 Å²	60	112.2 Å²	112.2	62%	0.619	72%	0.723	S	S	*	*	S	Bend	trans	-173.8	116.3	-179.3	0	0	0	0	0	113.8
122	M	45.6	Very low	55.3	Low	171 Å²	171	114.6 Å²	114.6	84%	0.842	73%	0.727	S	S	*	*			trans	83.7	104.2	164.6	-118.8	64.7	167.1	0	0	118	G124	M122-G124 PolarHBondContact O-N 3.19Å
123	P	49.3	Very low	54.7	Low	135 Å²	135	122 Å²	122	88%	0.877	76%	0.762	S	S	*	*	S	Bend	trans	-74.3	114.9	158.7	30.7	-26.2	0	0	0	108.2
124	G	56.2	Low	54.4	Low	61 Å²	61	126.8 Å²	126.8	63%	0.629	79%	0.786	S	S	*	*			trans	120	91.7	167.5	0	0	0	0	0	113.1	M122	M122-G124 PolarHBondContact O-N 3.19Å
125	M	50.8	Low	54.2	Low	191 Å²	191	126.7 Å²	126.7	94%	0.941	78%	0.784	S	S	*	*			trans	-165.2	99.9	132.7	-102.4	176.6	-157.5	0	0	106.8
126	M	57.2	Low	54.3	Low	181 Å²	181	128 Å²	128	89%	0.892	80%	0.797	S	S	*	*	P	Polyproline II helix	trans	-58.2	139.8	163.7	-64.2	173.9	-176.7	0	0	108.1
127	P	60.5	Low	54.2	Low	121 Å²	121	132.7 Å²	132.7	79%	0.786	82%	0.82	S	S	*	*	P	Polyproline II helix	trans	-64.9	134	170	25.7	-30.4	0	0	0	109.1
128	P	59.2	Low	54.5	Low	126 Å²	126	135.8 Å²	135.8	82%	0.818	82%	0.817	S	S	*	*	P	Polyproline II helix	trans	-65.9	138.3	173.9	27.8	-31.8	0	0	0	109.4
129	A	63.6	Low	54.7	Low	81 Å²	81	135.1 Å²	135.1	67%	0.669	82%	0.824	S	S	*	*	P	Polyproline II helix	trans	-55.9	150.9	179.9	0	0	0	0	0	112.3	V131	A129-V131 PolarHBondContact O-N 3.45Å
130	P	62.3	Low	55.3	Low	128 Å²	128	137.6 Å²	137.6	83%	0.831	83%	0.833	S	S	*	*	P	Polyproline II helix	trans	-68.4	119.5	-178.5	27.1	-32.3	0	0	0	110.5	K132	P130-K132 PolarHBondContact O-N 3.34Å
131	V	57.1	Low	55.6	Low	134 Å²	134	142.3 Å²	142.3	81%	0.812	84%	0.836	S	S	*	*			trans	-79.4	115.3	171.5	-165.2	0	0	0	0	107.6	A129	A129-V131 PolarHBondContact O-N 3.45Å
132	K	60.3	Low	56	Low	201 Å²	201	149.2 Å²	149.2	87%	0.874	85%	0.854	S	S	*	*			trans	-68.9	127.9	170.2	-79.8	179.3	162.8	-171.5	0	110.1	P130	P130-K132 PolarHBondContact O-N 3.34Å
133	M	50.3	Low	57	Low	260 Å²	260	147.2 Å²	147.2	100%	1.281	86%	0.855	S	S	*	*			trans	-140.9	0	144.9	-72	-170.2	178.5	0	0	108.3

Retrieved 133 of 133 residues in 433.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).