A0A060XN60_ONCMY Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB (A0A4W5MYX7), UniProt , Accession A0A060XN60, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 68 aa.

						>A0A060XN60_ONCMY|A0A060XN60
MSGSSNLVAMKKVVQQLRFEASINRVKVSQAAADLQQFCMQNALQDPLLTGVSSSTNPFRPQKVCSFL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	52.9	Low	76.7	Confident	229 Å²	229	100 Å²	100	100%	1.128	59%	0.588	S	S	*	*				0	9.5	0	-66.5	176.2	77	0	0	114.5
2	S	59.3	Low	78.1	Confident	86 Å²	86	103.6 Å²	103.6	60%	0.601	59%	0.591	S	S	*	*			trans	-92	-10.6	-174.6	-147.4	0	0	0	0	115.3	S5 N6	S2-S5 PolarHBondContact O-OG 3.11Å; S2-S5 VanDerWaalsContact O-OG 3.11Å; S2-N6 PolarHBondContact O-ND2 3.37Å
3	G	61.3	Low	79.4	Confident	53 Å²	53	102.2 Å²	102.2	55%	0.546	59%	0.585	S	S	.	*	H	α-helix	trans	-74.6	-32.1	-178.2	0	0	0	0	0	114.1	L7	G3-L7 PolarHBondContact O-N 3.39Å
4	S	65.1	Low	80.6	Confident	88 Å²	88	99.7 Å²	99.7	62%	0.615	57%	0.573	S	S	*	*	H	α-helix	trans	-74.1	-37.8	-173.7	-35.6	0	0	0	0	112.9	L7 V8	S4-L7 PolarHBondContact O-N 2.94Å; S4-V8 WeakPolarHBondContact O-CG2 3.43Å; S4-V8 PolarHBondContact O-N 3.23Å
5	S	71.4	Confident	81.5	Confident	69 Å²	69	101.9 Å²	101.9	48%	0.483	58%	0.575	S	S	.	*	H	α-helix	trans	-65.5	-41.8	177.5	43.9	0	0	0	0	111.9	S2 L7 V8 A9	S2-S5 PolarHBondContact O-OG 3.11Å; S2-S5 VanDerWaalsContact O-OG 3.11Å; S5-L7 VanDerWaalsContact C-N 3.31Å; S5-L7 PolarHBondContact O-N 3.23Å; S5-V8 PolarHBondContact O-N 3.06Å; S5-A9 PolarHBondContact O-N 3.35Å
6	N	83.9	Confident	82.4	Confident	91 Å²	91	101.7 Å²	101.7	49%	0.487	57%	0.568	S	S	.	*	H	α-helix	trans	-64.1	-36.1	176	-73.3	-27.8	0	0	0	112.4	S2 A9 M10	S2-N6 PolarHBondContact O-ND2 3.37Å; N6-A9 PolarHBondContact O-N 3.32Å; N6-M10 HydrophobicContact CB-CE 4.35Å; N6-M10 WeakPolarHBondContact O-CB 3.5Å; N6-M10 WeakPolarHBondContact O-CG 3.48Å; N6-M10 PolarHBondContact O-N 3.44Å
7	L	86.7	Confident	83.2	Confident	91 Å²	91	101.5 Å²	101.5	48%	0.476	57%	0.565	S	S	.	*	H	α-helix	trans	-68.3	-38.4	178.9	-143	158.6	0	0	0	111.6	G3 S4 S5 K11	G3-L7 PolarHBondContact O-N 3.39Å; S4-L7 PolarHBondContact O-N 2.94Å; S5-L7 VanDerWaalsContact C-N 3.31Å; S5-L7 PolarHBondContact O-N 3.23Å; L7-K11 HydrophobicContact CD2-CD 4.16Å; L7-K11 HydrophobicContact CD2-CG 4.38Å; L7-K11 WeakPolarHBondContact O-CG 3.48Å; L7-K11 PolarHBondContact O-N 3.06Å
8	V	89.3	Confident	83.9	Confident	86 Å²	86	106.1 Å²	106.1	52%	0.521	57%	0.572	S	S	.	*	H	α-helix	trans	-67	-42.2	174	175.4	0	0	0	0	111.4	S4 S5 K11 K12	S4-V8 WeakPolarHBondContact O-CG2 3.43Å; S4-V8 PolarHBondContact O-N 3.23Å; S5-V8 PolarHBondContact O-N 3.06Å; V8-K11 PolarHBondContact O-N 3.2Å; V8-K12 PolarHBondContact O-N 3.39Å; V8-K12 VanDerWaalsContact O-N 3.13Å
9	A	90.6	Very high	84.5	Confident	52 Å²	52	107.6 Å²	107.6	43%	0.43	57%	0.573	S	S	.	*	H	α-helix	trans	-61.2	-46.4	176.1	0	0	0	0	0	111.7	S5 N6 K11 K12 V13	S5-A9 PolarHBondContact O-N 3.35Å; N6-A9 PolarHBondContact O-N 3.32Å; A9-K11 VanDerWaalsContact C-N 3.35Å; A9-K11 PolarHBondContact O-N 2.91Å; A9-K12 WeakPolarHBondContact O-CB 3.36Å; A9-K12 PolarHBondContact O-N 2.96Å; A9-V13 WeakPolarHBondContact O-CG2 3.47Å; A9-V13 PolarHBondContact O-N 3.43Å
10	M	91.3	Very high	85	Confident	121 Å²	121	106.4 Å²	106.4	60%	0.596	56%	0.564	S	S	*	*	H	α-helix	trans	-61.8	-40	177.1	-77.5	-170.3	-91.9	0	0	112.7	N6 K12 V13 V14	N6-M10 HydrophobicContact CB-CE 4.35Å; N6-M10 WeakPolarHBondContact O-CB 3.5Å; N6-M10 WeakPolarHBondContact O-CG 3.48Å; N6-M10 PolarHBondContact O-N 3.44Å; M10-K12 VanDerWaalsContact C-N 3.33Å; M10-K12 PolarHBondContact O-N 3.46Å; M10-V13 PolarHBondContact O-N 3.18Å; M10-V14 WeakPolarHBondContact O-CG2 3.46Å; M10-V14 PolarHBondContact O-N 3.36Å
11	K	92.1	Very high	85.4	Confident	134 Å²	134	104.5 Å²	104.5	58%	0.583	56%	0.564	S	S	*	*	H	α-helix	trans	-60.3	-41.6	174.9	-76.9	178.9	176.3	-178.4	0	112.2	L7 V8 A9 V14 Q15	L7-K11 HydrophobicContact CD2-CD 4.16Å; L7-K11 HydrophobicContact CD2-CG 4.38Å; L7-K11 WeakPolarHBondContact O-CG 3.48Å; L7-K11 PolarHBondContact O-N 3.06Å; V8-K11 PolarHBondContact O-N 3.2Å; A9-K11 VanDerWaalsContact C-N 3.35Å; A9-K11 PolarHBondContact O-N 2.91Å; K11-V14 PolarHBondContact O-N 3.43Å; K11-Q15 WeakPolarHBondContact O-CG 3.34Å; K11-Q15 PolarHBondContact O-N 3.41Å
12	K	93.3	Very high	87.4	Confident	143 Å²	143	97.3 Å²	97.3	62%	0.622	54%	0.536	S	S	*	.	H	α-helix	trans	-62.6	-43.9	175.2	-73.5	-175.2	176.7	-175.1	0	111.9	V8 A9 M10 V14 Q15 Q16	V8-K12 PolarHBondContact O-N 3.39Å; V8-K12 VanDerWaalsContact O-N 3.13Å; A9-K12 WeakPolarHBondContact O-CB 3.36Å; A9-K12 PolarHBondContact O-N 2.96Å; M10-K12 VanDerWaalsContact C-N 3.33Å; M10-K12 PolarHBondContact O-N 3.46Å; K12-V14 VanDerWaalsContact C-N 3.35Å; K12-V14 PolarHBondContact O-N 2.87Å; K12-Q15 PolarHBondContact O-N 3.25Å; K12-Q16 PolarHBondContact O-N 3.04Å
13	V	94.9	Very high	89.1	Confident	85 Å²	85	97.3 Å²	97.3	52%	0.515	53%	0.528	S	S	.	.	H	α-helix	trans	-60.6	-44.5	176.9	173.5	0	0	0	0	111	A9 M10 Q15 Q16 L17	A9-V13 WeakPolarHBondContact O-CG2 3.47Å; A9-V13 PolarHBondContact O-N 3.43Å; M10-V13 PolarHBondContact O-N 3.18Å; V13-Q15 VanDerWaalsContact C-N 3.32Å; V13-Q15 PolarHBondContact O-N 3.13Å; V13-Q16 WeakPolarHBondContact O-CB 3.43Å; V13-Q16 PolarHBondContact O-N 3.03Å; V13-L17 HydrophobicContact CG1-CD1 3.92Å; V13-L17 HydrophobicContact CG1-CG 4.3Å; V13-L17 WeakPolarHBondContact O-CG 3.39Å; V13-L17 PolarHBondContact O-N 3.42Å
14	V	95.6	Very high	90.7	Very high	68 Å²	68	102.3 Å²	102.3	41%	0.412	54%	0.543	S	S	.	.	H	α-helix	trans	-63	-39.9	177.6	172.2	0	0	0	0	111.7	M10 K11 K12 L17 R18	M10-V14 WeakPolarHBondContact O-CG2 3.46Å; M10-V14 PolarHBondContact O-N 3.36Å; K11-V14 PolarHBondContact O-N 3.43Å; K12-V14 VanDerWaalsContact C-N 3.35Å; K12-V14 PolarHBondContact O-N 2.87Å; V14-L17 PolarHBondContact O-N 3.38Å; V14-R18 VanDerWaalsContact O-CG 3.28Å; V14-R18 WeakPolarHBondContact O-CG 3.25Å; V14-R18 PolarHBondContact O-N 3.24Å
15	Q	94.8	Very high	92.1	Very high	132 Å²	132	106.8 Å²	106.8	62%	0.617	55%	0.546	S	S	*	.	H	α-helix	trans	-62.4	-43.1	174.9	-75.1	179.9	-45.2	0	0	111.7	K11 K12 V13 R18 F19	K11-Q15 WeakPolarHBondContact O-CG 3.34Å; K11-Q15 PolarHBondContact O-N 3.41Å; K12-Q15 PolarHBondContact O-N 3.25Å; V13-Q15 VanDerWaalsContact C-N 3.32Å; V13-Q15 PolarHBondContact O-N 3.13Å; Q15-R18 PolarHBondContact O-N 2.96Å; Q15-F19 PolarHBondContact O-N 3.06Å; Q15-F19 VanDerWaalsContact O-N 3.14Å
16	Q	95.2	Very high	93.2	Very high	99 Å²	99	108.8 Å²	108.8	46%	0.463	56%	0.555	S	S	.	*	H	α-helix	trans	-62	-47.9	176.7	-177.3	63.7	17.8	0	0	111.9	K12 V13 R18 F19 E20	K12-Q16 PolarHBondContact O-N 3.04Å; V13-Q16 WeakPolarHBondContact O-CB 3.43Å; V13-Q16 PolarHBondContact O-N 3.03Å; Q16-R18 VanDerWaalsContact C-N 3.29Å; Q16-R18 PolarHBondContact O-N 2.94Å; Q16-F19 WeakPolarHBondContact O-CB 3.42Å; Q16-F19 PolarHBondContact O-N 3.33Å; Q16-F19 VanDerWaalsContact O-N 3.08Å; Q16-E20 WeakPolarHBondContact CG-OE1 3.39Å; Q16-E20 PolarHBondContact NE2-OE1 3.22Å; Q16-E20 PolarHBondContact O-N 3.14Å
17	L	96.1	Very high	93.7	Very high	99 Å²	99	112.2 Å²	112.2	52%	0.518	57%	0.566	S	S	.	*	H	α-helix	trans	-62.1	-36.6	179.5	-69.8	172.3	0	0	0	112.2	V13 V14 F19 E20 A21	V13-L17 HydrophobicContact CG1-CD1 3.92Å; V13-L17 HydrophobicContact CG1-CG 4.3Å; V13-L17 WeakPolarHBondContact O-CG 3.39Å; V13-L17 PolarHBondContact O-N 3.42Å; V14-L17 PolarHBondContact O-N 3.38Å; L17-F19 VanDerWaalsContact C-N 3.33Å; L17-E20 PolarHBondContact O-N 3.48Å; L17-A21 VanDerWaalsContact O-CB 3.25Å; L17-A21 WeakPolarHBondContact O-CB 3.28Å; L17-A21 PolarHBondContact O-N 2.8Å
18	R	96.2	Very high	94.2	Very high	183 Å²	183	113.8 Å²	113.8	69%	0.691	58%	0.579	S	S	*	*	H	α-helix	trans	-63.4	-40.9	174.2	-74.4	173.3	-179.6	-170.1	-0.1	111.7	V14 Q15 Q16 S22	V14-R18 VanDerWaalsContact O-CG 3.28Å; V14-R18 WeakPolarHBondContact O-CG 3.25Å; V14-R18 PolarHBondContact O-N 3.24Å; Q15-R18 PolarHBondContact O-N 2.96Å; Q16-R18 VanDerWaalsContact C-N 3.29Å; Q16-R18 PolarHBondContact O-N 2.94Å; R18-S22 PolarHBondContact O-N 3.13Å
19	F	95.4	Very high	94.4	Very high	135 Å²	135	113.9 Å²	113.9	59%	0.592	58%	0.583	S	S	*	*	H	α-helix	trans	-63.8	-48.6	175.5	-179.1	-101.8	0	0	0	111.2	Q15 Q16 L17 A21 S22 I23	Q15-F19 PolarHBondContact O-N 3.06Å; Q15-F19 VanDerWaalsContact O-N 3.14Å; Q16-F19 WeakPolarHBondContact O-CB 3.42Å; Q16-F19 PolarHBondContact O-N 3.33Å; Q16-F19 VanDerWaalsContact O-N 3.08Å; L17-F19 VanDerWaalsContact C-N 3.33Å; F19-A21 VanDerWaalsContact C-N 3.31Å; F19-A21 PolarHBondContact O-N 3.49Å; F19-S22 PolarHBondContact O-N 3.26Å; F19-S22 PolarHBondContact O-OG 3.08Å; F19-I23 PolarHBondContact O-N 3.36Å
20	E	94.5	Very high	94.6	Very high	83 Å²	83	116.2 Å²	116.2	39%	0.388	59%	0.585	S	S	.	*	H	α-helix	trans	-65.4	-32	178.9	-70.1	174.3	-168.1	0	0	113.5	Q16 L17 S22 I23 R25	Q16-E20 WeakPolarHBondContact CG-OE1 3.39Å; Q16-E20 PolarHBondContact NE2-OE1 3.22Å; Q16-E20 PolarHBondContact O-N 3.14Å; L17-E20 PolarHBondContact O-N 3.48Å; E20-S22 VanDerWaalsContact C-N 3.3Å; E20-I23 HydrophobicContact CB-CD1 4.47Å; E20-I23 HydrophobicContact CG-CD1 4.48Å; E20-I23 PolarHBondContact O-N 3.43Å; E20-R25 PolarHBondContact O-NH2 3.37Å; E20-R25 VanDerWaalsContact O-NH2 3.13Å
21	A	93.9	Very high	94.9	Very high	68 Å²	68	112 Å²	112	56%	0.562	57%	0.57	S	S	*	*	H	α-helix	trans	-65.3	-36.1	172.7	0	0	0	0	0	111.6	L17 F19 I23	L17-A21 VanDerWaalsContact O-CB 3.25Å; L17-A21 WeakPolarHBondContact O-CB 3.28Å; L17-A21 PolarHBondContact O-N 2.8Å; F19-A21 VanDerWaalsContact C-N 3.31Å; F19-A21 PolarHBondContact O-N 3.49Å; A21-I23 VanDerWaalsContact C-N 3.25Å; A21-I23 PolarHBondContact O-N 3.45Å
22	S	94.5	Very high	95	Very high	77 Å²	77	108.1 Å²	108.1	54%	0.538	56%	0.563	S	S	.	*	T	Hydrogen-bonded Turn	trans	-77.4	-3.3	-179.6	74.2	0	0	0	0	114.9	R18 F19 E20 N24	R18-S22 PolarHBondContact O-N 3.13Å; F19-S22 PolarHBondContact O-N 3.26Å; F19-S22 PolarHBondContact O-OG 3.08Å; E20-S22 VanDerWaalsContact C-N 3.3Å; S22-N24 PolarHBondContact O-N 3.33Å
23	I	95.1	Very high	95.1	Very high	86 Å²	86	103.5 Å²	103.5	44%	0.441	55%	0.551	S	S	.	*	S	Bend	trans	-69.2	127.4	177.1	-62.2	175.4	0	0	0	110	F19 E20 A21 R25	F19-I23 PolarHBondContact O-N 3.36Å; E20-I23 HydrophobicContact CB-CD1 4.47Å; E20-I23 HydrophobicContact CG-CD1 4.48Å; E20-I23 PolarHBondContact O-N 3.43Å; A21-I23 VanDerWaalsContact C-N 3.25Å; A21-I23 PolarHBondContact O-N 3.45Å; I23-R25 PolarHBondContact O-N 3.05Å; I23-R25 PolarHBondContact O-NH1 3.18Å
24	N	94.6	Very high	95.1	Very high	159 Å²	159	103.4 Å²	103.4	85%	0.85	55%	0.547	S	S	*	.	P	Polyproline II helix	trans	-67.7	120.6	173.6	-69.9	-62.5	0	0	0	110.3	S22	S22-N24 PolarHBondContact O-N 3.33Å
25	R	94	Very high	95.1	Very high	182 Å²	182	105.7 Å²	105.7	69%	0.687	56%	0.557	S	S	*	*	P	Polyproline II helix	trans	-99.6	141.9	177.9	-64.7	176	-177.3	72.4	5.2	109.9	E20 I23	E20-R25 PolarHBondContact O-NH2 3.37Å; E20-R25 VanDerWaalsContact O-NH2 3.13Å; I23-R25 PolarHBondContact O-N 3.05Å; I23-R25 PolarHBondContact O-NH1 3.18Å
26	V	94.4	Very high	95	Very high	110 Å²	110	105.4 Å²	105.4	67%	0.667	56%	0.555	S	S	*	*	P	Polyproline II helix	trans	-88.1	157.4	169.7	-64.7	0	0	0	0	110.3	V28 A31	V26-V28 PolarHBondContact O-N 3.41Å; V26-A31 HydrophobicContact CG2-CB 4.09Å
27	K	96.2	Very high	95	Very high	163 Å²	163	106.2 Å²	106.2	71%	0.709	56%	0.559	S	S	*	*	P	Polyproline II helix	trans	-64.5	136.9	173.7	-67.8	-177.3	-178.1	174.3	0	109.3	S29 Q30 A31	K27-S29 PolarHBondContact O-N 3.43Å; K27-Q30 HydrophobicContact CB-CB 4.36Å; K27-Q30 WeakPolarHBondContact O-CB 3.31Å; K27-Q30 PolarHBondContact O-N 2.66Å; K27-A31 PolarHBondContact O-N 3.4Å
28	V	95.4	Very high	94.9	Very high	125 Å²	125	107.6 Å²	107.6	76%	0.758	56%	0.561	S	S	*	*	H	α-helix	trans	-57.2	-36.9	177.7	-179.5	0	0	0	0	111.1	V26 Q30 A31 A32	V26-V28 PolarHBondContact O-N 3.41Å; V28-Q30 VanDerWaalsContact C-N 3.33Å; V28-Q30 PolarHBondContact O-N 2.9Å; V28-A31 PolarHBondContact O-N 3.29Å; V28-A32 VanDerWaalsContact O-CB 3.31Å; V28-A32 WeakPolarHBondContact O-CB 3.45Å; V28-A32 PolarHBondContact O-N 3.06Å
29	S	95.4	Very high	94.7	Very high	87 Å²	87	102.6 Å²	102.6	61%	0.608	55%	0.554	S	S	*	*	H	α-helix	trans	-62	-38.3	175.8	59.7	0	0	0	0	113.2	K27 A33	K27-S29 PolarHBondContact O-N 3.43Å; S29-A33 PolarHBondContact O-N 3.3Å; S29-A33 VanDerWaalsContact O-N 3.13Å
30	Q	94.8	Very high	94.5	Very high	102 Å²	102	102.3 Å²	102.3	48%	0.477	56%	0.556	S	S	.	*	H	α-helix	trans	-69.3	-49.5	176.8	-175.6	63.2	47.7	0	0	110.4	K27 V28 A32 A33 D34	K27-Q30 HydrophobicContact CB-CB 4.36Å; K27-Q30 WeakPolarHBondContact O-CB 3.31Å; K27-Q30 PolarHBondContact O-N 2.66Å; V28-Q30 VanDerWaalsContact C-N 3.33Å; V28-Q30 PolarHBondContact O-N 2.9Å; Q30-A32 VanDerWaalsContact C-N 3.26Å; Q30-A32 PolarHBondContact O-N 2.98Å; Q30-A33 PolarHBondContact O-N 2.92Å; Q30-A33 VanDerWaalsContact O-N 3.12Å; Q30-D34 PolarHBondContact NE2-OD1 3.48Å; Q30-D34 VanDerWaalsContact O-CG 3.22Å; Q30-D34 PolarHBondContact O-N 3.45Å
31	A	95.6	Very high	94.2	Very high	32 Å²	32	104.3 Å²	104.3	26%	0.264	57%	0.565	S	S	.	*	H	α-helix	trans	-59	-38.8	178.8	0	0	0	0	0	112.1	V26 K27 V28 D34 L35	V26-A31 HydrophobicContact CG2-CB 4.09Å; K27-A31 PolarHBondContact O-N 3.4Å; V28-A31 PolarHBondContact O-N 3.29Å; A31-D34 PolarHBondContact O-N 3Å; A31-L35 WeakPolarHBondContact O-CB 3.25Å; A31-L35 VanDerWaalsContact O-CG 3.25Å; A31-L35 WeakPolarHBondContact O-CG 3.39Å; A31-L35 PolarHBondContact O-N 2.91Å
32	A	95.6	Very high	94	Very high	53 Å²	53	103.9 Å²	103.9	44%	0.438	55%	0.553	S	S	.	*	H	α-helix	trans	-65.4	-42.5	176	0	0	0	0	0	112.4	V28 Q30 L35 Q36	V28-A32 VanDerWaalsContact O-CB 3.31Å; V28-A32 WeakPolarHBondContact O-CB 3.45Å; V28-A32 PolarHBondContact O-N 3.06Å; Q30-A32 VanDerWaalsContact C-N 3.26Å; Q30-A32 PolarHBondContact O-N 2.98Å; A32-L35 PolarHBondContact O-N 2.87Å; A32-Q36 WeakPolarHBondContact O-CB 3.36Å; A32-Q36 PolarHBondContact O-N 3.32Å
33	A	95.7	Very high	93.5	Very high	45 Å²	45	101.5 Å²	101.5	37%	0.372	54%	0.539	S	S	.	.	H	α-helix	trans	-63.7	-43.2	176.1	0	0	0	0	0	111.6	S29 Q30 L35 Q36 Q37	S29-A33 PolarHBondContact O-N 3.3Å; S29-A33 VanDerWaalsContact O-N 3.13Å; Q30-A33 PolarHBondContact O-N 2.92Å; Q30-A33 VanDerWaalsContact O-N 3.12Å; A33-L35 PolarHBondContact O-N 3.12Å; A33-Q36 PolarHBondContact O-N 2.88Å; A33-Q37 WeakPolarHBondContact O-CB 3.43Å; A33-Q37 PolarHBondContact O-N 3.49Å
34	D	95.1	Very high	92.7	Very high	83 Å²	83	104.3 Å²	104.3	44%	0.444	55%	0.553	S	S	.	*	H	α-helix	trans	-62.6	-43.9	178.2	-63.7	-17.1	0	0	0	111.2	Q30 A31 Q37 F38	Q30-D34 PolarHBondContact NE2-OD1 3.48Å; Q30-D34 VanDerWaalsContact O-CG 3.22Å; Q30-D34 PolarHBondContact O-N 3.45Å; A31-D34 PolarHBondContact O-N 3Å; D34-Q37 PolarHBondContact O-N 2.79Å; D34-F38 WeakPolarHBondContact O-CB 3.21Å; D34-F38 PolarHBondContact O-N 3.45Å
35	L	95.2	Very high	92.1	Very high	116 Å²	116	104.1 Å²	104.1	61%	0.607	55%	0.547	S	S	*	.	H	α-helix	trans	-63	-45.5	175.3	-74	172.8	0	0	0	111.9	A31 A32 A33 Q37 F38 C39	A31-L35 WeakPolarHBondContact O-CB 3.25Å; A31-L35 VanDerWaalsContact O-CG 3.25Å; A31-L35 WeakPolarHBondContact O-CG 3.39Å; A31-L35 PolarHBondContact O-N 2.91Å; A32-L35 PolarHBondContact O-N 2.87Å; A33-L35 PolarHBondContact O-N 3.12Å; L35-Q37 VanDerWaalsContact C-N 3.34Å; L35-Q37 PolarHBondContact O-N 3.13Å; L35-F38 PolarHBondContact O-N 2.79Å; L35-C39 PolarHBondContact O-N 2.91Å; L35-C39 PolarHBondContact O-SG 3.43Å; L35-C39 VanDerWaalsContact O-SG 3.34Å
36	Q	92.4	Very high	91.7	Very high	126 Å²	126	98.1 Å²	98.1	59%	0.589	53%	0.529	S	S	*	.	H	α-helix	trans	-60.6	-45.8	177.6	-178.8	-178.9	-4.5	0	0	111	A32 A33 F38 C39 M40	A32-Q36 WeakPolarHBondContact O-CB 3.36Å; A32-Q36 PolarHBondContact O-N 3.32Å; A33-Q36 PolarHBondContact O-N 2.88Å; Q36-F38 VanDerWaalsContact C-N 3.33Å; Q36-F38 PolarHBondContact O-N 3.47Å; Q36-C39 PolarHBondContact O-N 3.5Å; Q36-M40 HydrophobicContact CG-CG 4.43Å; Q36-M40 HydrophobicContact CG-SD 4.05Å; Q36-M40 VanDerWaalsContact O-CG 3.31Å; Q36-M40 WeakPolarHBondContact O-CG 3.31Å; Q36-M40 PolarHBondContact O-N 3.47Å
37	Q	94.3	Very high	91	Very high	117 Å²	117	96.1 Å²	96.1	55%	0.547	52%	0.518	S	S	.	.	H	α-helix	trans	-62.2	-43.3	179.1	-172.3	179.9	-46.2	0	0	111.1	A33 D34 L35 C39 M40 Q41	A33-Q37 WeakPolarHBondContact O-CB 3.43Å; A33-Q37 PolarHBondContact O-N 3.49Å; D34-Q37 PolarHBondContact O-N 2.79Å; L35-Q37 VanDerWaalsContact C-N 3.34Å; L35-Q37 PolarHBondContact O-N 3.13Å; Q37-C39 PolarHBondContact O-N 3.24Å; Q37-M40 PolarHBondContact O-N 2.94Å; Q37-Q41 VanDerWaalsContact O-CG 3.3Å; Q37-Q41 WeakPolarHBondContact O-CG 3.41Å; Q37-Q41 PolarHBondContact O-N 3.33Å
38	F	94.3	Very high	90.4	Very high	127 Å²	127	96.1 Å²	96.1	56%	0.557	53%	0.525	S	S	*	.	H	α-helix	trans	-59.2	-47	174.4	-179.6	-95.1	0	0	0	111.6	D34 L35 Q36 M40 Q41 N42	D34-F38 WeakPolarHBondContact O-CB 3.21Å; D34-F38 PolarHBondContact O-N 3.45Å; L35-F38 PolarHBondContact O-N 2.79Å; Q36-F38 VanDerWaalsContact C-N 3.33Å; Q36-F38 PolarHBondContact O-N 3.47Å; F38-M40 PolarHBondContact O-N 3.21Å; F38-Q41 PolarHBondContact O-N 3.34Å; F38-N42 WeakPolarHBondContact CD2-ND2 3.3Å; F38-N42 VanDerWaalsContact CE2-ND2 3.3Å; F38-N42 WeakPolarHBondContact CE2-ND2 3.28Å; F38-N42 WeakPolarHBondContact CZ-ND2 3.48Å; F38-N42 PolarHBondContact O-N 2.84Å; F38-N42 VanDerWaalsContact O-N 3.11Å; F38-N42 PolarHBondContact O-ND2 3.09Å
39	C	92.7	Very high	89.7	Confident	79 Å²	79	96.1 Å²	96.1	53%	0.534	52%	0.52	S	S	.	.	H	α-helix	trans	-60.8	-44.3	176.8	-71.3	0	0	0	0	112	L35 Q36 Q37 Q41 N42 A43	L35-C39 PolarHBondContact O-N 2.91Å; L35-C39 PolarHBondContact O-SG 3.43Å; L35-C39 VanDerWaalsContact O-SG 3.34Å; Q36-C39 PolarHBondContact O-N 3.5Å; Q37-C39 PolarHBondContact O-N 3.24Å; C39-Q41 PolarHBondContact O-N 3.32Å; C39-N42 PolarHBondContact O-N 3.46Å; C39-A43 WeakPolarHBondContact O-CA 3.46Å; C39-A43 WeakPolarHBondContact O-CB 3.42Å; C39-A43 PolarHBondContact O-N 3.01Å
40	M	90.2	Very high	88.9	Confident	128 Å²	128	95.6 Å²	95.6	63%	0.631	51%	0.514	S	S	*	.	H	α-helix	trans	-64.4	-38.8	179.9	-70.6	178.8	71	0	0	112.7	Q36 Q37 F38	Q36-M40 HydrophobicContact CG-CG 4.43Å; Q36-M40 HydrophobicContact CG-SD 4.05Å; Q36-M40 VanDerWaalsContact O-CG 3.31Å; Q36-M40 WeakPolarHBondContact O-CG 3.31Å; Q36-M40 PolarHBondContact O-N 3.47Å; Q37-M40 PolarHBondContact O-N 2.94Å; F38-M40 PolarHBondContact O-N 3.21Å
41	Q	89.9	Confident	87.7	Confident	126 Å²	126	93.2 Å²	93.2	59%	0.589	52%	0.516	S	S	*	.	H	α-helix	trans	-67.1	-38.3	177.4	-71.3	177.7	8	0	0	112.1	Q37 F38 C39	Q37-Q41 VanDerWaalsContact O-CG 3.3Å; Q37-Q41 WeakPolarHBondContact O-CG 3.41Å; Q37-Q41 PolarHBondContact O-N 3.33Å; F38-Q41 PolarHBondContact O-N 3.34Å; C39-Q41 PolarHBondContact O-N 3.32Å
42	N	87.9	Confident	86.8	Confident	58 Å²	58	94.8 Å²	94.8	31%	0.31	52%	0.522	S	S	.	.	H	α-helix	trans	-91.8	-13.4	-176.9	-67.4	-81.5	0	0	0	113.6	F38 C39 L44 Q45 D46	F38-N42 WeakPolarHBondContact CD2-ND2 3.3Å; F38-N42 VanDerWaalsContact CE2-ND2 3.3Å; F38-N42 WeakPolarHBondContact CE2-ND2 3.28Å; F38-N42 WeakPolarHBondContact CZ-ND2 3.48Å; F38-N42 PolarHBondContact O-N 2.84Å; F38-N42 VanDerWaalsContact O-N 3.11Å; F38-N42 PolarHBondContact O-ND2 3.09Å; C39-N42 PolarHBondContact O-N 3.46Å; N42-L44 PolarHBondContact O-N 2.87Å; N42-Q45 PolarHBondContact O-N 3.2Å; N42-D46 PolarHBondContact O-N 3.18Å
43	A	84.4	Confident	85.5	Confident	28 Å²	28	95.8 Å²	95.8	23%	0.231	53%	0.526	C	S	.	.	T	Hydrogen-bonded Turn	trans	-57	-34.6	-179	0	0	0	0	0	112.6	C39 Q45 D46 T50	C39-A43 WeakPolarHBondContact O-CA 3.46Å; C39-A43 WeakPolarHBondContact O-CB 3.42Å; C39-A43 PolarHBondContact O-N 3.01Å; A43-Q45 VanDerWaalsContact C-N 3.31Å; A43-D46 PolarHBondContact O-N 3.43Å; A43-T50 WeakPolarHBondContact O-CG2 3.46Å
44	L	79.4	Confident	84	Confident	144 Å²	144	96.4 Å²	96.4	75%	0.754	53%	0.528	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.1	-26	178.2	-66.2	175.7	0	0	0	113.3	N42 T50	N42-L44 PolarHBondContact O-N 2.87Å; L44-T50 HydrophobicContact CD2-CG2 4.22Å
45	Q	82.2	Confident	82.8	Confident	155 Å²	155	97 Å²	97	72%	0.724	54%	0.538	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.5	-17.7	178.3	-163.7	179.5	62.6	0	0	111.7	N42 A43 P47	N42-Q45 PolarHBondContact O-N 3.2Å; A43-Q45 VanDerWaalsContact C-N 3.31Å; Q45-P47 WeakPolarHBondContact O-CD 3.46Å
46	D	84.2	Confident	81.7	Confident	56 Å²	56	96.3 Å²	96.3	30%	0.299	54%	0.539	S	S	.	.			trans	-74.6	110.7	178.4	-170.8	-24.4	0	0	0	110.8	N42 A43 L48 L49 T50	N42-D46 PolarHBondContact O-N 3.18Å; A43-D46 PolarHBondContact O-N 3.43Å; D46-L48 PolarHBondContact O-N 3.11Å; D46-L48 VanDerWaalsContact OD1-CB 3.28Å; D46-L48 WeakPolarHBondContact OD1-CB 3.3Å; D46-L48 PolarHBondContact OD1-N 2.81Å; D46-L49 HydrophobicContact CB-CB 4.09Å; D46-L49 HydrophobicContact CB-CD1 4.02Å; D46-L49 PolarHBondContact O-N 3.39Å; D46-L49 WeakPolarHBondContact OD2-CD1 3.47Å; D46-T50 PolarHBondContact O-N 3.19Å; D46-T50 VanDerWaalsContact O-N 3.09Å; D46-T50 PolarHBondContact O-OG1 2.96Å
47	P	80.9	Confident	81.1	Confident	68 Å²	68	93 Å²	93	44%	0.442	53%	0.526	S	S	.	.	H	α-helix	trans	-60.8	-24.4	179.1	-27.2	41	0	0	0	114	Q45 G51 V52	Q45-P47 WeakPolarHBondContact O-CD 3.46Å; P47-G51 VanDerWaalsContact O-CA 3.3Å; P47-G51 WeakPolarHBondContact O-CA 3.3Å; P47-G51 PolarHBondContact O-N 3.07Å; P47-V52 HydrophobicContact CB-CG1 3.6Å; P47-V52 HydrophobicContact CG-CG1 4.35Å
48	L	82.2	Confident	80.3	Confident	163 Å²	163	93 Å²	93	85%	0.853	54%	0.536	S	S	*	.	H	α-helix	trans	-82	-28.7	-178.5	-57.2	177.5	0	0	0	111.8	D46	D46-L48 PolarHBondContact O-N 3.11Å; D46-L48 VanDerWaalsContact OD1-CB 3.28Å; D46-L48 WeakPolarHBondContact OD1-CB 3.3Å; D46-L48 PolarHBondContact OD1-N 2.81Å
49	L	80.9	Confident	79.6	Confident	126 Å²	126	95.7 Å²	95.7	66%	0.66	55%	0.547	S	S	*	.	H	α-helix	trans	-86.8	-45.5	178.6	-97.6	137.3	0	0	0	112.6	D46	D46-L49 HydrophobicContact CB-CB 4.09Å; D46-L49 HydrophobicContact CB-CD1 4.02Å; D46-L49 PolarHBondContact O-N 3.39Å; D46-L49 WeakPolarHBondContact OD2-CD1 3.47Å
50	T	78.1	Confident	78.5	Confident	76 Å²	76	96.6 Å²	96.6	47%	0.466	54%	0.54	S	S	.	.	H	α-helix	trans	-85	-20.4	-178.7	46	0	0	0	0	113.7	A43 L44 D46	A43-T50 WeakPolarHBondContact O-CG2 3.46Å; L44-T50 HydrophobicContact CD2-CG2 4.22Å; D46-T50 PolarHBondContact O-N 3.19Å; D46-T50 VanDerWaalsContact O-N 3.09Å; D46-T50 PolarHBondContact O-OG1 2.96Å
51	G	71.5	Confident	77.7	Confident	51 Å²	51	95.8 Å²	95.8	53%	0.526	54%	0.544	S	S	.	.			trans	73.6	132	-169.8	0	0	0	0	0	111.1	P47	P47-G51 VanDerWaalsContact O-CA 3.3Å; P47-G51 WeakPolarHBondContact O-CA 3.3Å; P47-G51 PolarHBondContact O-N 3.07Å
52	V	74.9	Confident	76.7	Confident	65 Å²	65	98.6 Å²	98.6	39%	0.394	56%	0.557	S	S	.	*			trans	-95.5	141.6	173.9	-77.1	0	0	0	0	110.8	P47 S54 N57	P47-V52 HydrophobicContact CB-CG1 3.6Å; P47-V52 HydrophobicContact CG-CG1 4.35Å; V52-S54 PolarHBondContact O-N 2.85Å; V52-N57 HydrophobicContact CG2-CB 3.88Å
53	S	69.9	Low	75.5	Confident	75 Å²	75	104.4 Å²	104.4	52%	0.524	58%	0.579	S	S	.	*			trans	-52.4	138.7	163.6	174.7	0	0	0	0	108.3	S55 T56 N57	S53-S55 PolarHBondContact O-N 3.19Å; S53-S55 PolarHBondContact OG-OG 3.22Å; S53-T56 PolarHBondContact O-N 3.16Å; S53-T56 PolarHBondContact O-OG1 2.92Å; S53-T56 VanDerWaalsContact O-OG1 3.05Å; S53-N57 PolarHBondContact O-N 3.25Å
54	S	64.3	Low	74.5	Confident	58 Å²	58	109.2 Å²	109.2	41%	0.406	61%	0.606	S	S	.	*	T	Hydrogen-bonded Turn	trans	-65.8	-13.6	-175	37.4	0	0	0	0	112.2	V52 R60	V52-S54 PolarHBondContact O-N 2.85Å; S54-R60 VanDerWaalsContact CA-NH2 3.32Å; S54-R60 VanDerWaalsContact O-CZ 3.24Å; S54-R60 PolarHBondContact O-NE 3.01Å; S54-R60 PolarHBondContact O-NH2 3.38Å; S54-R60 PolarHBondContact OG-NH1 3.03Å; S54-R60 PolarHBondContact OG-NH2 3.31Å
55	S	68.9	Low	73.8	Confident	95 Å²	95	107.3 Å²	107.3	66%	0.664	60%	0.603	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.4	-27.1	171.3	52.9	0	0	0	0	113.7	S53	S53-S55 PolarHBondContact O-N 3.19Å; S53-S55 PolarHBondContact OG-OG 3.22Å
56	T	72.9	Confident	72.8	Confident	101 Å²	101	104.5 Å²	104.5	62%	0.62	60%	0.601	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.7	-8.3	177.1	14.2	0	0	0	0	112.9	S53 P58	S53-T56 PolarHBondContact O-N 3.16Å; S53-T56 PolarHBondContact O-OG1 2.92Å; S53-T56 VanDerWaalsContact O-OG1 3.05Å; T56-P58 VanDerWaalsContact O-CD 3.27Å; T56-P58 WeakPolarHBondContact O-CD 3.11Å
57	N	78.3	Confident	71.4	Confident	58 Å²	58	111.2 Å²	111.2	31%	0.31	63%	0.628	S	S	.	*			trans	-82.4	112	176.5	-174.7	-5.2	0	0	0	111.1	V52 S53 F59 R60	V52-N57 HydrophobicContact CG2-CB 3.88Å; S53-N57 PolarHBondContact O-N 3.25Å; N57-F59 PolarHBondContact O-N 2.94Å; N57-F59 WeakPolarHBondContact OD1-CB 3.41Å; N57-F59 PolarHBondContact OD1-N 3.05Å; N57-R60 WeakPolarHBondContact O-CB 3.27Å; N57-R60 PolarHBondContact O-N 2.99Å; N57-R60 VanDerWaalsContact O-N 3.16Å
58	P	79	Confident	70	Confident	116 Å²	116	119 Å²	119	75%	0.753	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.1	-17.1	178.9	27.8	-34.4	0	0	0	113.6	T56 R60	T56-P58 VanDerWaalsContact O-CD 3.27Å; T56-P58 WeakPolarHBondContact O-CD 3.11Å; P58-R60 VanDerWaalsContact C-N 3.35Å
59	F	78.7	Confident	69.4	Low	184 Å²	184	116.9 Å²	116.9	81%	0.807	66%	0.655	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.3	9	176.7	-60.8	-78.9	0	0	0	113.5	N57	N57-F59 PolarHBondContact O-N 2.94Å; N57-F59 WeakPolarHBondContact OD1-CB 3.41Å; N57-F59 PolarHBondContact OD1-N 3.05Å
60	R	70.7	Confident	68.8	Low	98 Å²	98	116.4 Å²	116.4	37%	0.37	66%	0.655	S	S	.	*	P	Polyproline II helix	trans	-63.6	129.4	176.3	-172.2	-148.1	-87.6	-89.8	7	109.7	S54 N57 P58 Q62	S54-R60 VanDerWaalsContact CA-NH2 3.32Å; S54-R60 VanDerWaalsContact O-CZ 3.24Å; S54-R60 PolarHBondContact O-NE 3.01Å; S54-R60 PolarHBondContact O-NH2 3.38Å; S54-R60 PolarHBondContact OG-NH1 3.03Å; S54-R60 PolarHBondContact OG-NH2 3.31Å; N57-R60 WeakPolarHBondContact O-CB 3.27Å; N57-R60 PolarHBondContact O-N 2.99Å; N57-R60 VanDerWaalsContact O-N 3.16Å; P58-R60 VanDerWaalsContact C-N 3.35Å; R60-Q62 PolarHBondContact O-N 3.27Å
61	P	72.2	Confident	68.3	Low	111 Å²	111	118.6 Å²	118.6	72%	0.721	67%	0.665	S	S	*	*	P	Polyproline II helix	trans	-59.9	133.5	167.2	22.3	-29.8	0	0	0	110.1	K63	P61-K63 PolarHBondContact O-N 3.4Å
62	Q	68.8	Low	68.1	Low	184 Å²	184	122.6 Å²	122.6	86%	0.86	67%	0.674	S	S	*	*	P	Polyproline II helix	trans	-60.7	127.5	177.1	-70.5	-159.6	-4.2	0	0	109.3	R60 V64	R60-Q62 PolarHBondContact O-N 3.27Å; Q62-V64 PolarHBondContact O-N 2.68Å
63	K	63.6	Low	67.7	Low	180 Å²	180	126.2 Å²	126.2	78%	0.783	69%	0.691	S	S	*	*			trans	-66.3	106.7	167	-78	-170.3	174.4	-172.7	0	106.9	P61 C65	P61-K63 PolarHBondContact O-N 3.4Å; K63-C65 PolarHBondContact O-N 3.22Å
64	V	63.8	Low	67.6	Low	129 Å²	129	129.6 Å²	129.6	78%	0.782	70%	0.702	S	S	*	*			trans	-61.3	115.7	161.6	-71.7	0	0	0	0	106.9	Q62 S66	Q62-V64 PolarHBondContact O-N 2.68Å; V64-S66 PolarHBondContact O-N 3.18Å; V64-S66 VanDerWaalsContact O-N 3.11Å
65	C	63	Low	67.8	Low	104 Å²	104	134.7 Å²	134.7	70%	0.703	72%	0.723	S	S	*	*			trans	-76.5	95.7	172.8	-146.5	0	0	0	0	106.4	K63 F67	K63-C65 PolarHBondContact O-N 3.22Å; C65-F67 PolarHBondContact O-N 3.17Å
66	S	62.5	Low	67.7	Low	96 Å²	96	137.8 Å²	137.8	67%	0.671	73%	0.728	S	S	*	*			trans	-72.2	105	164.8	14.6	0	0	0	0	107.4	V64 L68	V64-S66 PolarHBondContact O-N 3.18Å; V64-S66 VanDerWaalsContact O-N 3.11Å; S66-L68 PolarHBondContact O-N 3.11Å
67	F	54.8	Low	67.3	Low	197 Å²	197	140.8 Å²	140.8	86%	0.864	74%	0.737	S	S	*	*			trans	-66.5	107.4	160.7	-66.4	-84.1	0	0	0	106.6	C65	C65-F67 PolarHBondContact O-N 3.17Å
68	L	52.1	Low	66.3	Low	233 Å²	233	148.4 Å²	148.4	100%	1.22	78%	0.776	S	S	*	*			trans	-105.6	0	166.2	-133.1	114.8	0	0	0	108.4	S66	S66-L68 PolarHBondContact O-N 3.11Å

Retrieved 68 of 68 residues in 384.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).