A0A060YIR5_ONCMY Loading...

Nuclear protein 1

AlphaFold DB (A0A673WBK2), UniProt , Accession A0A060YIR5, Species ONCMY (Oncorhynchus mykiss, Rainbow trout), Gene n/a, Length 75 aa.

						>A0A060YIR5_ONCMY|A0A060YIR5
MSSFVDVKNVEPTYFEEQHYDEYEYYNLSEKYTCGASRKGRSKKEASDNTNRPNPGGHERKLVEKLQNTEKKAKA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.1	Very low	53.3	Low	236 Å²	236	129.9 Å²	129.9	100%	1.163	69%	0.693	S	S	*	*				0	113.5	0	-83.7	67.4	145.5	0	0	108.3
2	S	44	Very low	54.7	Low	119 Å²	119	123.7 Å²	123.7	83%	0.832	67%	0.665	S	S	*	*			trans	-82.6	107.5	158.1	146.9	0	0	0	0	104.3	F4	S2-F4 PolarHBondContact O-N 3.26Å; S2-F4 VanDerWaalsContact O-N 3.14Å
3	S	46.2	Very low	56.5	Low	99 Å²	99	120.1 Å²	120.1	69%	0.692	65%	0.65	S	S	*	*			trans	-68.6	104.6	172.5	46.8	0	0	0	0	107.1	V5	S3-V5 PolarHBondContact O-N 2.98Å
4	F	49.9	Very low	58.2	Low	138 Å²	138	123.5 Å²	123.5	61%	0.605	65%	0.65	S	S	*	*			trans	-67.2	111.2	167.5	-179.3	-102.7	0	0	0	106.9	S2 D6 E30	S2-F4 PolarHBondContact O-N 3.26Å; S2-F4 VanDerWaalsContact O-N 3.14Å; F4-D6 VanDerWaalsContact CE1-OD1 3.32Å; F4-D6 WeakPolarHBondContact CE1-OD1 3.47Å; F4-E30 WeakPolarHBondContact CD2-OE1 3.46Å; F4-E30 WeakPolarHBondContact CE2-OE1 3.37Å
5	V	55.9	Low	59.8	Low	76 Å²	76	122.9 Å²	122.9	46%	0.461	64%	0.641	S	S	.	*			trans	-107.1	106.1	178.3	-177.7	0	0	0	0	106	S3 V7 V10	S3-V5 PolarHBondContact O-N 2.98Å; V5-V7 WeakPolarHBondContact O-CG2 3.44Å; V5-V7 PolarHBondContact O-N 2.62Å; V5-V10 HydrophobicContact CG1-CG2 3.58Å
6	D	52.4	Low	61.1	Low	104 Å²	104	117.4 Å²	117.4	56%	0.556	61%	0.611	S	S	*	*			trans	-59.3	103	174.9	-93.9	-48.5	0	0	0	109.3	F4 K8	F4-D6 VanDerWaalsContact CE1-OD1 3.32Å; F4-D6 WeakPolarHBondContact CE1-OD1 3.47Å; D6-K8 PolarHBondContact O-N 2.96Å
7	V	55.9	Low	62.3	Low	62 Å²	62	117.9 Å²	117.9	38%	0.376	61%	0.609	S	S	.	*	G	3₁₀ helix	trans	-62.7	-6.6	-173.4	172.7	0	0	0	0	114	V5 N9 E30	V5-V7 WeakPolarHBondContact O-CG2 3.44Å; V5-V7 PolarHBondContact O-N 2.62Å; V7-N9 PolarHBondContact O-N 3.13Å; V7-E30 HydrophobicContact CB-CB 4.44Å; V7-E30 HydrophobicContact CG2-CB 3.58Å; V7-E30 HydrophobicContact CG2-CG 3.94Å
8	K	56.9	Low	63.7	Low	192 Å²	192	117.7 Å²	117.7	84%	0.835	61%	0.605	S	S	*	*	G	3₁₀ helix	trans	-66.8	-19.1	-179.3	-66.2	-174.6	-179	177.6	0	114	D6	D6-K8 PolarHBondContact O-N 2.96Å
9	N	55.1	Low	64.8	Low	149 Å²	149	117.3 Å²	117.3	80%	0.797	60%	0.6	S	S	*	*	G	3₁₀ helix	trans	-131	21.7	-174.5	-71.3	12.7	0	0	0	113.9	V7 E11	V7-N9 PolarHBondContact O-N 3.13Å; N9-E11 PolarHBondContact O-N 3.26Å
10	V	64.4	Low	65.8	Low	83 Å²	83	115.4 Å²	115.4	50%	0.503	59%	0.586	S	S	.	*			trans	-88.7	102.6	176.9	-175	0	0	0	0	108.3	V5	V5-V10 HydrophobicContact CG1-CG2 3.58Å
11	E	68.3	Low	66.6	Low	171 Å²	171	113.8 Å²	113.8	80%	0.799	58%	0.579	S	S	*	*	P	Polyproline II helix	trans	-69.9	133.1	167.9	-65.7	-166.9	169	0	0	109	N9 T13	N9-E11 PolarHBondContact O-N 3.26Å; E11-T13 PolarHBondContact O-N 3.44Å
12	P	70.5	Confident	68.5	Low	55 Å²	55	111 Å²	111	36%	0.357	56%	0.563	S	S	.	*	P	Polyproline II helix	trans	-52.7	136.2	173.8	-27	35.8	0	0	0	111.1	E16 E17 Y25	P12-E16 HydrophobicContact CB-CB 4.4Å; P12-E17 HydrophobicContact CB-CG 3.86Å; P12-Y25 HydrophobicContact CB-CE1 3.86Å; P12-Y25 HydrophobicContact CG-CE1 3.75Å
13	T	78.3	Confident	70	Confident	77 Å²	77	114.2 Å²	114.2	47%	0.472	56%	0.558	S	S	.	*	P	Polyproline II helix	trans	-70.5	155.3	171.3	60.9	0	0	0	0	110.1	E11 F15 E16 E17	E11-T13 PolarHBondContact O-N 3.44Å; T13-F15 PolarHBondContact O-N 3.24Å; T13-E16 PolarHBondContact N-OE2 3.49Å; T13-E16 PolarHBondContact O-N 3.01Å; T13-E16 VanDerWaalsContact OG1-CD 3.26Å; T13-E16 WeakPolarHBondContact OG1-CG 3.5Å; T13-E16 PolarHBondContact OG1-OE2 2.98Å; T13-E17 PolarHBondContact O-N 3.11Å
14	Y	80.1	Confident	71.6	Confident	168 Å²	168	113.2 Å²	113.2	66%	0.659	54%	0.542	S	S	*	.	H	α-helix	trans	-51.5	-29.1	176.1	176.4	-95.5	0	0	0	113.7	Q18	Y14-Q18 WeakPolarHBondContact O-CG 3.42Å; Y14-Q18 PolarHBondContact O-N 2.97Å; Y14-Q18 PolarHBondContact OH-NE2 3.18Å
15	F	82.3	Confident	72.8	Confident	115 Å²	115	110.1 Å²	110.1	50%	0.504	53%	0.527	S	S	.	.	H	α-helix	trans	-68.2	-49.3	175	179	-96.5	0	0	0	111.8	T13 E17 Q18 H19 Y20	T13-F15 PolarHBondContact O-N 3.24Å; F15-E17 VanDerWaalsContact C-N 3.34Å; F15-E17 PolarHBondContact O-N 3.32Å; F15-Q18 PolarHBondContact O-N 3.27Å; F15-H19 AromaticContact CD2-CE1 3.97Å; F15-H19 AromaticContact CD2-ND1 3.87Å; F15-H19 AromaticContact CE2-CD2 3.97Å; F15-H19 AromaticContact CE2-CG 3.98Å; F15-H19 AromaticContact CE2-ND1 3.97Å; F15-H19 AromaticContact CE2-NE2 3.99Å; F15-H19 HydrophobicContact CZ-CB 4.41Å; F15-H19 WeakPolarHBondContact O-CB 3.46Å; F15-H19 PolarHBondContact O-N 2.85Å; F15-H19 VanDerWaalsContact O-N 3.1Å; F15-H19 PolarHBondContact O-ND1 2.73Å; F15-Y20 HydrophobicContact CE1-CE1 4.32Å
16	E	80.6	Confident	73.3	Confident	35 Å²	35	112.9 Å²	112.9	16%	0.164	53%	0.53	C	S	.	.	H	α-helix	trans	-64.1	-40	-179.7	-64.3	163.1	145.2	0	0	110.5	P12 T13 Q18 H19 Y20 Y25	P12-E16 HydrophobicContact CB-CB 4.4Å; T13-E16 PolarHBondContact N-OE2 3.49Å; T13-E16 PolarHBondContact O-N 3.01Å; T13-E16 VanDerWaalsContact OG1-CD 3.26Å; T13-E16 WeakPolarHBondContact OG1-CG 3.5Å; T13-E16 PolarHBondContact OG1-OE2 2.98Å; E16-Q18 PolarHBondContact O-N 2.78Å; E16-H19 PolarHBondContact O-N 3.2Å; E16-Y20 HydrophobicContact CB-CD2 3.91Å; E16-Y20 HydrophobicContact CB-CE2 4.23Å; E16-Y20 HydrophobicContact CB-CG 4.42Å; E16-Y20 HydrophobicContact CG-CD2 3.92Å; E16-Y20 HydrophobicContact CG-CE2 3.71Å; E16-Y20 VanDerWaalsContact O-CB 3.28Å; E16-Y20 WeakPolarHBondContact O-CB 3.29Å; E16-Y20 PolarHBondContact O-N 3.31Å; E16-Y25 HydrophobicContact CB-CE1 4.41Å; E16-Y25 PolarHBondContact O-OH 3.12Å
17	E	81.2	Confident	74.1	Confident	125 Å²	125	112.8 Å²	112.8	58%	0.584	53%	0.53	S	S	*	.	H	α-helix	trans	-58.7	-33.6	176.1	-70.7	-169.3	156.7	0	0	113.9	P12 T13 F15 Y25	P12-E17 HydrophobicContact CB-CG 3.86Å; T13-E17 PolarHBondContact O-N 3.11Å; F15-E17 VanDerWaalsContact C-N 3.34Å; F15-E17 PolarHBondContact O-N 3.32Å; E17-Y25 VanDerWaalsContact CA-OH 3.22Å; E17-Y25 WeakPolarHBondContact CA-OH 3.31Å; E17-Y25 PolarHBondContact N-OH 3.02Å
18	Q	87.3	Confident	74.8	Confident	114 Å²	114	113.1 Å²	113.1	53%	0.533	53%	0.529	S	S	.	.	H	α-helix	trans	-91.6	-26.3	-176.4	-71.9	-164.6	0.2	0	0	114.4	Y14 F15 E16	Y14-Q18 WeakPolarHBondContact O-CG 3.42Å; Y14-Q18 PolarHBondContact O-N 2.97Å; Y14-Q18 PolarHBondContact OH-NE2 3.18Å; F15-Q18 PolarHBondContact O-N 3.27Å; E16-Q18 PolarHBondContact O-N 2.78Å
19	H	84.6	Confident	75.1	Confident	110 Å²	110	105.5 Å²	105.5	51%	0.509	50%	0.5	S	S	.	.	H	α-helix	trans	-113.4	-19.1	-167.9	-61.3	68	0	0	0	112.6	F15 E16	F15-H19 AromaticContact CD2-CE1 3.97Å; F15-H19 AromaticContact CD2-ND1 3.87Å; F15-H19 AromaticContact CE2-CD2 3.97Å; F15-H19 AromaticContact CE2-CG 3.98Å; F15-H19 AromaticContact CE2-ND1 3.97Å; F15-H19 AromaticContact CE2-NE2 3.99Å; F15-H19 HydrophobicContact CZ-CB 4.41Å; F15-H19 WeakPolarHBondContact O-CB 3.46Å; F15-H19 PolarHBondContact O-N 2.85Å; F15-H19 VanDerWaalsContact O-N 3.1Å; F15-H19 PolarHBondContact O-ND1 2.73Å; E16-H19 PolarHBondContact O-N 3.2Å
20	Y	84.6	Confident	75.2	Confident	80 Å²	80	100.5 Å²	100.5	31%	0.314	47%	0.472	S	S	.	.			trans	-100.4	135.9	-176.2	-67.9	-1.2	0	0	0	113	F15 E16 E24 L28	F15-Y20 HydrophobicContact CE1-CE1 4.32Å; E16-Y20 HydrophobicContact CB-CD2 3.91Å; E16-Y20 HydrophobicContact CB-CE2 4.23Å; E16-Y20 HydrophobicContact CB-CG 4.42Å; E16-Y20 HydrophobicContact CG-CD2 3.92Å; E16-Y20 HydrophobicContact CG-CE2 3.71Å; E16-Y20 VanDerWaalsContact O-CB 3.28Å; E16-Y20 WeakPolarHBondContact O-CB 3.29Å; E16-Y20 PolarHBondContact O-N 3.31Å; Y20-E24 WeakPolarHBondContact CA-OE2 3.34Å; Y20-E24 HydrophobicContact CD1-CB 4.31Å; Y20-E24 HydrophobicContact CD2-CB 4.17Å; Y20-E24 HydrophobicContact CG-CB 3.85Å; Y20-L28 HydrophobicContact CD2-CD1 3.95Å; Y20-L28 HydrophobicContact CE2-CD1 3.93Å; Y20-L28 HydrophobicContact CE2-CD2 4.21Å; Y20-L28 HydrophobicContact CE2-CG 4.37Å
21	D	83.5	Confident	74.9	Confident	82 Å²	82	105.4 Å²	105.4	44%	0.439	49%	0.486	S	S	.	.			trans	-84	170.7	168	74.5	15	0	0	0	112.1	Y23 E24 Y25	D21-Y23 PolarHBondContact O-N 3.06Å; D21-Y23 VanDerWaalsContact O-N 3.08Å; D21-Y23 WeakPolarHBondContact OD1-CA 3.36Å; D21-Y23 WeakPolarHBondContact OD1-CB 3.44Å; D21-Y23 PolarHBondContact OD1-N 3.5Å; D21-E24 PolarHBondContact N-OE2 3.35Å; D21-E24 PolarHBondContact O-N 2.94Å; D21-E24 VanDerWaalsContact O-N 3.12Å; D21-E24 WeakPolarHBondContact OD1-CG 3.24Å; D21-E24 PolarHBondContact OD1-N 2.78Å; D21-Y25 WeakPolarHBondContact O-CD2 3.38Å; D21-Y25 PolarHBondContact O-N 3.13Å
22	E	76.8	Confident	74.1	Confident	178 Å²	178	103.8 Å²	103.8	83%	0.832	47%	0.474	S	S	*	.	H	α-helix	trans	-55	-27.5	179	-79.3	-175.9	174.5	0	0	113.6
23	Y	75.7	Confident	73.4	Confident	185 Å²	185	105.4 Å²	105.4	73%	0.725	48%	0.483	S	S	*	.	H	α-helix	trans	-80	-37.2	179.5	-76.1	-82.8	0	0	0	112	D21 Y25 Y26	D21-Y23 PolarHBondContact O-N 3.06Å; D21-Y23 VanDerWaalsContact O-N 3.08Å; D21-Y23 WeakPolarHBondContact OD1-CA 3.36Å; D21-Y23 WeakPolarHBondContact OD1-CB 3.44Å; D21-Y23 PolarHBondContact OD1-N 3.5Å; Y23-Y25 VanDerWaalsContact C-N 3.27Å; Y23-Y25 PolarHBondContact O-N 3Å; Y23-Y26 VanDerWaalsContact O-CB 3.26Å; Y23-Y26 WeakPolarHBondContact O-CB 3.36Å; Y23-Y26 PolarHBondContact O-N 3.31Å; Y23-Y26 VanDerWaalsContact O-N 3.09Å
24	E	78.9	Confident	72.1	Confident	78 Å²	78	105 Å²	105	36%	0.364	48%	0.482	S	S	.	.	H	α-helix	trans	-63.9	-34.2	177.5	-74.6	163.7	147.6	0	0	111.4	Y20 D21 Y26 N27	Y20-E24 WeakPolarHBondContact CA-OE2 3.34Å; Y20-E24 HydrophobicContact CD1-CB 4.31Å; Y20-E24 HydrophobicContact CD2-CB 4.17Å; Y20-E24 HydrophobicContact CG-CB 3.85Å; D21-E24 PolarHBondContact N-OE2 3.35Å; D21-E24 PolarHBondContact O-N 2.94Å; D21-E24 VanDerWaalsContact O-N 3.12Å; D21-E24 WeakPolarHBondContact OD1-CG 3.24Å; D21-E24 PolarHBondContact OD1-N 2.78Å; E24-Y26 VanDerWaalsContact C-N 3.27Å; E24-Y26 PolarHBondContact O-N 2.93Å; E24-N27 WeakPolarHBondContact O-CB 3.35Å; E24-N27 PolarHBondContact O-N 3.08Å
25	Y	75	Confident	70.7	Confident	73 Å²	73	99.8 Å²	99.8	29%	0.286	48%	0.48	S	S	.	.	H	α-helix	trans	-60.8	-31.7	171.5	-79	-72.1	0	0	0	114.1	P12 E16 E17 D21 Y23 N27 L28	P12-Y25 HydrophobicContact CB-CE1 3.86Å; P12-Y25 HydrophobicContact CG-CE1 3.75Å; E16-Y25 HydrophobicContact CB-CE1 4.41Å; E16-Y25 PolarHBondContact O-OH 3.12Å; E17-Y25 VanDerWaalsContact CA-OH 3.22Å; E17-Y25 WeakPolarHBondContact CA-OH 3.31Å; E17-Y25 PolarHBondContact N-OH 3.02Å; D21-Y25 WeakPolarHBondContact O-CD2 3.38Å; D21-Y25 PolarHBondContact O-N 3.13Å; Y23-Y25 VanDerWaalsContact C-N 3.27Å; Y23-Y25 PolarHBondContact O-N 3Å; Y25-N27 PolarHBondContact O-N 3.48Å; Y25-L28 HydrophobicContact CD1-CD1 4.04Å; Y25-L28 HydrophobicContact CE1-CD1 4.43Å; Y25-L28 PolarHBondContact O-N 2.59Å
26	Y	68.1	Low	69.4	Low	135 Å²	135	98.1 Å²	98.1	53%	0.529	49%	0.487	S	S	.	.	H	α-helix	trans	-64.2	-33.8	179.6	-163.6	-102.5	0	0	0	112	Y23 E24 L28 S29 Y32	Y23-Y26 VanDerWaalsContact O-CB 3.26Å; Y23-Y26 WeakPolarHBondContact O-CB 3.36Å; Y23-Y26 PolarHBondContact O-N 3.31Å; Y23-Y26 VanDerWaalsContact O-N 3.09Å; E24-Y26 VanDerWaalsContact C-N 3.27Å; E24-Y26 PolarHBondContact O-N 2.93Å; Y26-L28 VanDerWaalsContact C-N 3.29Å; Y26-L28 PolarHBondContact O-N 3.47Å; Y26-S29 PolarHBondContact O-N 2.95Å; Y26-S29 PolarHBondContact O-OG 3.41Å; Y26-Y32 HydrophobicContact CD1-CD2 4.14Å; Y26-Y32 AromaticContact CD1-CE2 3.96Å; Y26-Y32 HydrophobicContact CD1-CE2 3.96Å; Y26-Y32 AromaticContact CE1-CD2 3.83Å; Y26-Y32 HydrophobicContact CE1-CD2 3.83Å; Y26-Y32 HydrophobicContact CE1-CE1 4.17Å; Y26-Y32 AromaticContact CE1-CE2 3.24Å; Y26-Y32 HydrophobicContact CE1-CE2 3.24Å; Y26-Y32 AromaticContact CE1-CZ 3.45Å; Y26-Y32 VanDerWaalsContact CE1-CZ 3.45Å; Y26-Y32 HydrophobicContact CE2-CE2 4.3Å; Y26-Y32 AromaticContact CZ-CE2 3.46Å; Y26-Y32 VanDerWaalsContact CZ-CE2 3.46Å; Y26-Y32 AromaticContact CZ-CZ 3.67Å; Y26-Y32 PolarHBondContact OH-OH 2.98Å
27	N	69.3	Low	68.2	Low	101 Å²	101	99.5 Å²	99.5	54%	0.54	50%	0.501	S	S	.	.	H	α-helix	trans	-73.9	-19.3	-179.8	-60.8	-40.6	0	0	0	113.1	E24 Y25 S29 T33	E24-N27 WeakPolarHBondContact O-CB 3.35Å; E24-N27 PolarHBondContact O-N 3.08Å; Y25-N27 PolarHBondContact O-N 3.48Å; N27-S29 VanDerWaalsContact C-N 3.29Å; N27-T33 WeakPolarHBondContact O-CG2 3.26Å
28	L	68.9	Low	67.1	Low	70 Å²	70	105.3 Å²	105.3	37%	0.366	52%	0.517	S	S	.	.	T	Hydrogen-bonded Turn	trans	-78.1	-15.4	175.8	-62.8	177.6	0	0	0	112.7	Y20 Y25 Y26	Y20-L28 HydrophobicContact CD2-CD1 3.95Å; Y20-L28 HydrophobicContact CE2-CD1 3.93Å; Y20-L28 HydrophobicContact CE2-CD2 4.21Å; Y20-L28 HydrophobicContact CE2-CG 4.37Å; Y25-L28 HydrophobicContact CD1-CD1 4.04Å; Y25-L28 HydrophobicContact CE1-CD1 4.43Å; Y25-L28 PolarHBondContact O-N 2.59Å; Y26-L28 VanDerWaalsContact C-N 3.29Å; Y26-L28 PolarHBondContact O-N 3.47Å
29	S	64.3	Low	65.9	Low	31 Å²	31	107.9 Å²	107.9	22%	0.217	53%	0.527	C	S	.	.	S	Bend	trans	-73.1	133.3	-179.5	73.1	0	0	0	0	112.2	Y26 N27 K31 Y32	Y26-S29 PolarHBondContact O-N 2.95Å; Y26-S29 PolarHBondContact O-OG 3.41Å; N27-S29 VanDerWaalsContact C-N 3.29Å; S29-K31 PolarHBondContact O-N 3.07Å; S29-Y32 PolarHBondContact O-N 3Å; S29-Y32 WeakPolarHBondContact OG-CD2 3.46Å
30	E	57.8	Low	64.8	Low	44 Å²	44	105.9 Å²	105.9	21%	0.206	54%	0.536	C	S	.	.	H	α-helix	trans	-53.9	-27.7	-173.9	-130.4	-175.6	156.3	0	0	113.8	F4 V7 Y32 T33 C34	F4-E30 WeakPolarHBondContact CD2-OE1 3.46Å; F4-E30 WeakPolarHBondContact CE2-OE1 3.37Å; V7-E30 HydrophobicContact CB-CB 4.44Å; V7-E30 HydrophobicContact CG2-CB 3.58Å; V7-E30 HydrophobicContact CG2-CG 3.94Å; E30-Y32 PolarHBondContact O-N 2.96Å; E30-Y32 VanDerWaalsContact O-N 3.16Å; E30-T33 WeakPolarHBondContact CA-OG1 3.28Å; E30-T33 PolarHBondContact O-N 3.49Å; E30-C34 HydrophobicContact CG-CB 4.35Å; E30-C34 WeakPolarHBondContact O-CB 3.43Å; E30-C34 PolarHBondContact O-N 3.09Å
31	K	56.2	Low	64.1	Low	186 Å²	186	108.1 Å²	108.1	81%	0.809	54%	0.544	S	S	*	.	H	α-helix	trans	-58.5	-27.1	179.7	-79.3	-175.4	178.1	178	0	113.1	S29	S29-K31 PolarHBondContact O-N 3.07Å
32	Y	53.4	Low	63.8	Low	137 Å²	137	106.9 Å²	106.9	54%	0.537	54%	0.542	S	S	.	.	H	α-helix	trans	-108.1	-18.4	-178.7	-60.4	-76.5	0	0	0	113.3	Y26 S29 E30	Y26-Y32 HydrophobicContact CD1-CD2 4.14Å; Y26-Y32 AromaticContact CD1-CE2 3.96Å; Y26-Y32 HydrophobicContact CD1-CE2 3.96Å; Y26-Y32 AromaticContact CE1-CD2 3.83Å; Y26-Y32 HydrophobicContact CE1-CD2 3.83Å; Y26-Y32 HydrophobicContact CE1-CE1 4.17Å; Y26-Y32 AromaticContact CE1-CE2 3.24Å; Y26-Y32 HydrophobicContact CE1-CE2 3.24Å; Y26-Y32 AromaticContact CE1-CZ 3.45Å; Y26-Y32 VanDerWaalsContact CE1-CZ 3.45Å; Y26-Y32 HydrophobicContact CE2-CE2 4.3Å; Y26-Y32 AromaticContact CZ-CE2 3.46Å; Y26-Y32 VanDerWaalsContact CZ-CE2 3.46Å; Y26-Y32 AromaticContact CZ-CZ 3.67Å; Y26-Y32 PolarHBondContact OH-OH 2.98Å; S29-Y32 PolarHBondContact O-N 3Å; S29-Y32 WeakPolarHBondContact OG-CD2 3.46Å; E30-Y32 PolarHBondContact O-N 2.96Å; E30-Y32 VanDerWaalsContact O-N 3.16Å
33	T	53.9	Low	63.6	Low	90 Å²	90	107.2 Å²	107.2	55%	0.552	54%	0.541	S	S	*	.	H	α-helix	trans	-92	-24.2	178.4	65.8	0	0	0	0	112.8	N27 E30 G35	N27-T33 WeakPolarHBondContact O-CG2 3.26Å; E30-T33 WeakPolarHBondContact CA-OG1 3.28Å; E30-T33 PolarHBondContact O-N 3.49Å; T33-G35 PolarHBondContact O-N 3.39Å
34	C	52.2	Low	63.6	Low	67 Å²	67	105.5 Å²	105.5	45%	0.453	54%	0.537	S	S	.	.			trans	-94.4	71.2	-175.6	-166.4	0	0	0	0	112.5	E30 A36	E30-C34 HydrophobicContact CG-CB 4.35Å; E30-C34 WeakPolarHBondContact O-CB 3.43Å; E30-C34 PolarHBondContact O-N 3.09Å; C34-A36 PolarHBondContact O-N 3.2Å
35	G	51.1	Low	63	Low	59 Å²	59	106.3 Å²	106.3	61%	0.608	54%	0.541	S	S	*	.			trans	-71.3	58.4	160.5	0	0	0	0	0	111.9	T33 S37	T33-G35 PolarHBondContact O-N 3.39Å; G35-S37 PolarHBondContact O-N 3.49Å
36	A	54.8	Low	62.8	Low	80 Å²	80	104.6 Å²	104.6	66%	0.661	54%	0.542	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.5	3.6	-176.9	0	0	0	0	0	115.1	C34 R38	C34-A36 PolarHBondContact O-N 3.2Å; A36-R38 PolarHBondContact O-N 3.35Å
37	S	55.4	Low	63	Low	65 Å²	65	101.5 Å²	101.5	46%	0.455	54%	0.54	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.2	95.4	162.9	-87.3	0	0	0	0	108.6	G35 K39 G40	G35-S37 PolarHBondContact O-N 3.49Å; S37-K39 CarbonylContact O-C 3.6Å; S37-K39 PolarHBondContact O-N 3.06Å; S37-G40 PolarHBondContact O-N 3.07Å
38	R	57.9	Low	63.2	Low	246 Å²	246	100.8 Å²	100.8	93%	0.928	54%	0.536	S	S	*	.	T	Hydrogen-bonded Turn	trans	-31.9	109.2	173.1	-65.6	-180	-123.6	-166.9	-1.3	109.9	A36	A36-R38 PolarHBondContact O-N 3.35Å
39	K	62.1	Low	63.4	Low	168 Å²	168	101.2 Å²	101.2	73%	0.73	54%	0.539	S	S	*	.	T	Hydrogen-bonded Turn	trans	98.7	22.4	-176.6	-148	144.4	-172.1	168.5	0	117.4	S37 R41	S37-K39 CarbonylContact O-C 3.6Å; S37-K39 PolarHBondContact O-N 3.06Å; K39-R41 WeakPolarHBondContact O-CG 3.19Å; K39-R41 PolarHBondContact O-N 2.96Å
40	G	60.9	Low	63.6	Low	69 Å²	69	103 Å²	103	71%	0.711	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	60	23.3	160.9	0	0	0	0	0	115.2	S37	S37-G40 PolarHBondContact O-N 3.07Å
41	R	71.1	Confident	64.1	Low	126 Å²	126	106.8 Å²	106.8	48%	0.475	57%	0.57	S	S	.	*			trans	-103.8	139.4	176.2	-65.3	176.3	-147.7	160.9	-0.1	109.2	K39 E45	K39-R41 WeakPolarHBondContact O-CG 3.19Å; K39-R41 PolarHBondContact O-N 2.96Å; R41-E45 WeakPolarHBondContact CA-OE2 3.21Å; R41-E45 HydrophobicContact CB-CB 4.23Å
42	S	75.3	Confident	64.8	Low	56 Å²	56	104.8 Å²	104.8	39%	0.392	56%	0.557	S	S	.	*			trans	-63.4	157.3	166	66.5	0	0	0	0	110.9	K44 E45 A46	S42-K44 PolarHBondContact O-N 3.05Å; S42-E45 WeakPolarHBondContact CB-OE2 3.49Å; S42-E45 PolarHBondContact N-OE2 2.9Å; S42-E45 PolarHBondContact O-N 3.22Å; S42-E45 WeakPolarHBondContact OG-CB 3.49Å; S42-E45 WeakPolarHBondContact OG-CG 3.16Å; S42-E45 PolarHBondContact OG-N 2.86Å; S42-E45 VanDerWaalsContact OG-N 3.1Å; S42-E45 PolarHBondContact OG-OE2 2.8Å; S42-A46 PolarHBondContact O-N 3.1Å
43	K	73.3	Confident	65.5	Low	185 Å²	185	104.8 Å²	104.8	80%	0.804	57%	0.574	S	S	*	*	H	α-helix	trans	-56	-35	174.8	-69.7	-178.5	180	175.2	0	112	A46 S47	K43-A46 PolarHBondContact O-N 2.75Å; K43-S47 PolarHBondContact O-N 2.97Å; K43-S47 VanDerWaalsContact O-N 3.08Å
44	K	76.6	Confident	66	Low	150 Å²	150	104.7 Å²	104.7	65%	0.652	57%	0.57	S	S	*	*	H	α-helix	trans	-67.9	-48.6	176.8	-176	177.9	179.3	-177.2	0	111.9	S42 A46 S47 D48	S42-K44 PolarHBondContact O-N 3.05Å; K44-A46 PolarHBondContact O-N 3.29Å; K44-S47 PolarHBondContact O-N 3.14Å; K44-S47 VanDerWaalsContact O-N 3.14Å; K44-S47 PolarHBondContact O-OG 2.78Å; K44-D48 WeakPolarHBondContact O-CB 3.16Å; K44-D48 PolarHBondContact O-N 2.98Å
45	E	64.8	Low	67	Low	94 Å²	94	107.4 Å²	107.4	44%	0.439	59%	0.587	S	S	.	*	H	α-helix	trans	-61.4	-36.4	175.4	-72.2	165.6	140.4	0	0	111.8	R41 S42 N49	R41-E45 WeakPolarHBondContact CA-OE2 3.21Å; R41-E45 HydrophobicContact CB-CB 4.23Å; S42-E45 WeakPolarHBondContact CB-OE2 3.49Å; S42-E45 PolarHBondContact N-OE2 2.9Å; S42-E45 PolarHBondContact O-N 3.22Å; S42-E45 WeakPolarHBondContact OG-CB 3.49Å; S42-E45 WeakPolarHBondContact OG-CG 3.16Å; S42-E45 PolarHBondContact OG-N 2.86Å; S42-E45 VanDerWaalsContact OG-N 3.1Å; S42-E45 PolarHBondContact OG-OE2 2.8Å; E45-N49 VanDerWaalsContact O-CB 3.28Å; E45-N49 WeakPolarHBondContact O-CB 3.49Å; E45-N49 PolarHBondContact O-N 2.95Å; E45-N49 PolarHBondContact O-ND2 2.9Å
46	A	71.9	Confident	68	Low	37 Å²	37	106.5 Å²	106.5	31%	0.306	58%	0.578	S	S	.	*	H	α-helix	trans	-63.3	-43.4	174.7	0	0	0	0	0	112	S42 K43 K44 T50	S42-A46 PolarHBondContact O-N 3.1Å; K43-A46 PolarHBondContact O-N 2.75Å; K44-A46 PolarHBondContact O-N 3.29Å; A46-T50 VanDerWaalsContact O-CB 3.24Å; A46-T50 WeakPolarHBondContact O-CB 3.32Å; A46-T50 PolarHBondContact O-N 2.99Å; A46-T50 VanDerWaalsContact O-N 3.12Å; A46-T50 PolarHBondContact O-OG1 3.22Å
47	S	72.9	Confident	69.1	Low	71 Å²	71	103.2 Å²	103.2	50%	0.497	55%	0.552	S	S	.	*	H	α-helix	trans	-64.4	-45.5	176.4	57.7	0	0	0	0	111.9	K43 K44 N49 T50	K43-S47 PolarHBondContact O-N 2.97Å; K43-S47 VanDerWaalsContact O-N 3.08Å; K44-S47 PolarHBondContact O-N 3.14Å; K44-S47 VanDerWaalsContact O-N 3.14Å; K44-S47 PolarHBondContact O-OG 2.78Å; S47-N49 VanDerWaalsContact C-N 3.28Å; S47-N49 PolarHBondContact O-N 3.21Å; S47-T50 PolarHBondContact O-N 3.3Å; S47-T50 VanDerWaalsContact O-N 3.13Å
48	D	73.7	Confident	70.2	Confident	85 Å²	85	106.7 Å²	106.7	46%	0.455	56%	0.561	S	S	.	*	H	α-helix	trans	-72.7	-24.8	-172.1	-61.8	-6.9	0	0	0	112.4	K44 R52	K44-D48 WeakPolarHBondContact O-CB 3.16Å; K44-D48 PolarHBondContact O-N 2.98Å; D48-R52 PolarHBondContact O-NE 2.97Å; D48-R52 PolarHBondContact O-NH2 3.16Å
49	N	71.2	Confident	71.4	Confident	80 Å²	80	101.6 Å²	101.6	43%	0.428	55%	0.547	S	S	.	.	H	α-helix	trans	-95.8	-5.3	175.1	-68.9	-83.4	0	0	0	113	E45 S47 R52	E45-N49 VanDerWaalsContact O-CB 3.28Å; E45-N49 WeakPolarHBondContact O-CB 3.49Å; E45-N49 PolarHBondContact O-N 2.95Å; E45-N49 PolarHBondContact O-ND2 2.9Å; S47-N49 VanDerWaalsContact C-N 3.28Å; S47-N49 PolarHBondContact O-N 3.21Å; N49-R52 PolarHBondContact OD1-NH1 3.02Å; N49-R52 PolarHBondContact OD1-NH2 2.83Å
50	T	69.9	Low	72.4	Confident	68 Å²	68	100.8 Å²	100.8	42%	0.417	54%	0.54	S	S	.	.	S	Bend	trans	-87.9	141.1	175.3	-65.5	0	0	0	0	110	A46 S47 R52	A46-T50 VanDerWaalsContact O-CB 3.24Å; A46-T50 WeakPolarHBondContact O-CB 3.32Å; A46-T50 PolarHBondContact O-N 2.99Å; A46-T50 VanDerWaalsContact O-N 3.12Å; A46-T50 PolarHBondContact O-OG1 3.22Å; S47-T50 PolarHBondContact O-N 3.3Å; S47-T50 VanDerWaalsContact O-N 3.13Å; T50-R52 PolarHBondContact O-N 2.79Å
51	N	67.3	Low	73.5	Confident	123 Å²	123	100.2 Å²	100.2	66%	0.658	52%	0.518	S	S	*	.	S	Bend	trans	62.9	26.6	173	-59.5	-39.9	0	0	0	116.3	K61	N51-K61 PolarHBondContact OD1-NZ 3.14Å
52	R	70.3	Confident	74.2	Confident	144 Å²	144	98.2 Å²	98.2	54%	0.543	52%	0.516	S	S	.	.			trans	-61.7	134.6	172.8	-73.5	173.6	177.3	174.2	0.4	111	D48 N49 T50 N54	D48-R52 PolarHBondContact O-NE 2.97Å; D48-R52 PolarHBondContact O-NH2 3.16Å; N49-R52 PolarHBondContact OD1-NH1 3.02Å; N49-R52 PolarHBondContact OD1-NH2 2.83Å; T50-R52 PolarHBondContact O-N 2.79Å; R52-N54 PolarHBondContact O-N 2.95Å
53	P	69.3	Low	74.8	Confident	137 Å²	137	99.2 Å²	99.2	89%	0.89	52%	0.519	S	S	*	.			trans	-72.1	84.5	175	30	-32.9	0	0	0	108.9
54	N	64.9	Low	75.6	Confident	88 Å²	88	95.2 Å²	95.2	47%	0.471	50%	0.503	S	S	.	.			trans	-98.6	130.9	168.8	-177	-6.7	0	0	0	106.9	R52 G56 G57	R52-N54 PolarHBondContact O-N 2.95Å; N54-G56 PolarHBondContact O-N 3.34Å; N54-G57 WeakPolarHBondContact O-CA 3.37Å; N54-G57 PolarHBondContact O-N 2.95Å
55	P	72.4	Confident	76.2	Confident	124 Å²	124	93.8 Å²	93.8	81%	0.805	50%	0.497	S	S	*	.	T	Hydrogen-bonded Turn	trans	-50.4	123.9	169.4	20.4	-32.5	0	0	0	110.2	G57	P55-G57 PolarHBondContact O-N 2.92Å
56	G	71.7	Confident	77.6	Confident	40 Å²	40	94.4 Å²	94.4	41%	0.412	50%	0.503	S	S	.	.	T	Hydrogen-bonded Turn	trans	72.8	-2.1	-173.8	0	0	0	0	0	115.8	N54 H58 R60	N54-G56 PolarHBondContact O-N 3.34Å; G56-H58 VanDerWaalsContact C-N 3.35Å; G56-H58 PolarHBondContact O-N 2.92Å; G56-R60 WeakPolarHBondContact O-CB 3.44Å; G56-R60 PolarHBondContact O-N 3.09Å
57	G	77.6	Confident	78.6	Confident	12 Å²	12	97.3 Å²	97.3	12%	0.124	51%	0.511	C	S	.	.	H	α-helix	trans	-67.8	-32.9	177.3	0	0	0	0	0	113.5	N54 P55 K61	N54-G57 WeakPolarHBondContact O-CA 3.37Å; N54-G57 PolarHBondContact O-N 2.95Å; P55-G57 PolarHBondContact O-N 2.92Å; G57-K61 VanDerWaalsContact O-CB 3.29Å; G57-K61 WeakPolarHBondContact O-CB 3.42Å; G57-K61 PolarHBondContact O-N 3.21Å
58	H	79.2	Confident	79.4	Confident	138 Å²	138	97.3 Å²	97.3	64%	0.639	51%	0.505	S	S	*	.	H	α-helix	trans	-64.6	-48.9	175.6	-173.7	72.5	0	0	0	111.4	G56 K61 L62	G56-H58 VanDerWaalsContact C-N 3.35Å; G56-H58 PolarHBondContact O-N 2.92Å; H58-K61 PolarHBondContact O-N 3.26Å; H58-L62 PolarHBondContact O-N 3.36Å
59	E	82.3	Confident	80.4	Confident	138 Å²	138	97.8 Å²	97.8	65%	0.645	51%	0.511	S	S	*	.	H	α-helix	trans	-61.1	-48.5	177.6	-65.2	164.7	-175	0	0	111.1	K61 L62 V63	E59-K61 VanDerWaalsContact C-N 3.29Å; E59-K61 PolarHBondContact O-N 3.34Å; E59-L62 WeakPolarHBondContact O-CB 3.36Å; E59-L62 PolarHBondContact O-N 3.45Å; E59-L62 VanDerWaalsContact O-N 3.13Å; E59-V63 WeakPolarHBondContact O-CG2 3.39Å; E59-V63 PolarHBondContact O-N 2.8Å
60	R	84.6	Confident	81.5	Confident	152 Å²	152	99 Å²	99	57%	0.574	51%	0.514	S	S	*	.	H	α-helix	trans	-58.8	-39.7	176.4	-174.5	170.7	56.8	92.8	-0.1	112.5	G56 V63 E64	G56-R60 WeakPolarHBondContact O-CB 3.44Å; G56-R60 PolarHBondContact O-N 3.09Å; R60-V63 PolarHBondContact O-N 3.32Å; R60-E64 WeakPolarHBondContact O-CB 3.26Å; R60-E64 PolarHBondContact O-N 3.22Å
61	K	83.9	Confident	82.5	Confident	57 Å²	57	102.3 Å²	102.3	25%	0.248	52%	0.523	C	S	.	.	H	α-helix	trans	-66.6	-39.4	176.6	-178.5	170.7	-176.4	168.5	0	112.3	N51 G57 H58 E59 K65	N51-K61 PolarHBondContact OD1-NZ 3.14Å; G57-K61 VanDerWaalsContact O-CB 3.29Å; G57-K61 WeakPolarHBondContact O-CB 3.42Å; G57-K61 PolarHBondContact O-N 3.21Å; H58-K61 PolarHBondContact O-N 3.26Å; E59-K61 VanDerWaalsContact C-N 3.29Å; E59-K61 PolarHBondContact O-N 3.34Å; K61-K65 WeakPolarHBondContact O-CB 3.13Å; K61-K65 WeakPolarHBondContact O-CG 3.48Å; K61-K65 PolarHBondContact O-N 3.33Å
62	L	85.4	Confident	83.4	Confident	84 Å²	84	104.6 Å²	104.6	44%	0.44	53%	0.527	S	S	.	.	H	α-helix	trans	-62.9	-48.6	174.9	-76.4	169.3	0	0	0	110.8	H58 E59 E64 K65 L66	H58-L62 PolarHBondContact O-N 3.36Å; E59-L62 WeakPolarHBondContact O-CB 3.36Å; E59-L62 PolarHBondContact O-N 3.45Å; E59-L62 VanDerWaalsContact O-N 3.13Å; L62-E64 PolarHBondContact O-N 3.21Å; L62-K65 PolarHBondContact O-N 3.43Å; L62-L66 PolarHBondContact O-N 3.21Å
63	V	88.8	Confident	84.2	Confident	76 Å²	76	101.8 Å²	101.8	46%	0.461	54%	0.535	S	S	.	.	H	α-helix	trans	-58.3	-47.4	177.2	173.5	0	0	0	0	111.2	E59 R60 K65 L66 Q67	E59-V63 WeakPolarHBondContact O-CG2 3.39Å; E59-V63 PolarHBondContact O-N 2.8Å; R60-V63 PolarHBondContact O-N 3.32Å; V63-K65 VanDerWaalsContact C-N 3.34Å; V63-K65 PolarHBondContact O-N 2.93Å; V63-L66 PolarHBondContact O-N 2.95Å; V63-Q67 HydrophobicContact CG1-CG 4.39Å; V63-Q67 WeakPolarHBondContact O-CG 3.16Å; V63-Q67 PolarHBondContact O-N 2.94Å
64	E	89.1	Confident	84.5	Confident	101 Å²	101	103.7 Å²	103.7	47%	0.472	53%	0.529	S	S	.	.	H	α-helix	trans	-62.4	-39.7	179.1	-174.6	177.5	-174.4	0	0	112.1	R60 L62 N68	R60-E64 WeakPolarHBondContact O-CB 3.26Å; R60-E64 PolarHBondContact O-N 3.22Å; L62-E64 PolarHBondContact O-N 3.21Å; E64-N68 VanDerWaalsContact O-CB 3.31Å; E64-N68 WeakPolarHBondContact O-CB 3.13Å; E64-N68 PolarHBondContact O-N 3.12Å; E64-N68 PolarHBondContact O-ND2 3.41Å; E64-N68 VanDerWaalsContact O-ND2 3.07Å
65	K	89.9	Confident	84.5	Confident	120 Å²	120	106 Å²	106	52%	0.522	56%	0.56	S	S	.	*	H	α-helix	trans	-64.1	-44	174.8	-80.9	-178.9	171	-173.1	0	112.3	K61 L62 V63 N68 T69	K61-K65 WeakPolarHBondContact O-CB 3.13Å; K61-K65 WeakPolarHBondContact O-CG 3.48Å; K61-K65 PolarHBondContact O-N 3.33Å; L62-K65 PolarHBondContact O-N 3.43Å; V63-K65 VanDerWaalsContact C-N 3.34Å; V63-K65 PolarHBondContact O-N 2.93Å; K65-N68 PolarHBondContact O-N 3.08Å; K65-T69 WeakPolarHBondContact O-CB 3.22Å; K65-T69 PolarHBondContact O-N 3.31Å; K65-T69 PolarHBondContact O-OG1 3.49Å
66	L	93.4	Very high	85.1	Confident	108 Å²	108	105.2 Å²	105.2	57%	0.565	55%	0.548	S	S	*	.	H	α-helix	trans	-59.3	-54.4	176.8	-84.5	151.9	0	0	0	110.5	L62 V63 N68 T69 E70	L62-L66 PolarHBondContact O-N 3.21Å; V63-L66 PolarHBondContact O-N 2.95Å; L66-N68 VanDerWaalsContact C-N 3.33Å; L66-N68 PolarHBondContact O-N 2.82Å; L66-T69 WeakPolarHBondContact O-CB 3.46Å; L66-T69 PolarHBondContact O-N 2.79Å; L66-T69 VanDerWaalsContact O-N 3.11Å; L66-E70 PolarHBondContact O-N 2.77Å
67	Q	92.4	Very high	85.8	Confident	98 Å²	98	108.6 Å²	108.6	46%	0.458	56%	0.555	S	S	.	*	H	α-helix	trans	-58.5	-41.5	179.4	-70.6	178.9	-11.5	0	0	113	V63 K71	V63-Q67 HydrophobicContact CG1-CG 4.39Å; V63-Q67 WeakPolarHBondContact O-CG 3.16Å; V63-Q67 PolarHBondContact O-N 2.94Å; Q67-K71 WeakPolarHBondContact O-CB 3.37Å; Q67-K71 VanDerWaalsContact O-CG 3.26Å; Q67-K71 WeakPolarHBondContact O-CG 3.39Å; Q67-K71 PolarHBondContact O-N 3.02Å
68	N	91.2	Very high	86.3	Confident	71 Å²	71	113.9 Å²	113.9	38%	0.38	58%	0.579	S	S	.	*	H	α-helix	trans	-68.3	-35.8	178.4	-75.3	-30.2	0	0	0	112.4	E64 K65 L66 K72	E64-N68 VanDerWaalsContact O-CB 3.31Å; E64-N68 WeakPolarHBondContact O-CB 3.13Å; E64-N68 PolarHBondContact O-N 3.12Å; E64-N68 PolarHBondContact O-ND2 3.41Å; E64-N68 VanDerWaalsContact O-ND2 3.07Å; K65-N68 PolarHBondContact O-N 3.08Å; L66-N68 VanDerWaalsContact C-N 3.33Å; L66-N68 PolarHBondContact O-N 2.82Å; N68-K72 WeakPolarHBondContact O-CG 3.28Å; N68-K72 PolarHBondContact O-N 3.24Å; N68-K72 VanDerWaalsContact O-N 3.09Å
69	T	93.3	Very high	86.7	Confident	94 Å²	94	112.5 Å²	112.5	58%	0.577	58%	0.576	S	S	*	*	H	α-helix	trans	-66.3	-45.8	176.1	-54.5	0	0	0	0	110.4	K65 L66 K71 K72 A73	K65-T69 WeakPolarHBondContact O-CB 3.22Å; K65-T69 PolarHBondContact O-N 3.31Å; K65-T69 PolarHBondContact O-OG1 3.49Å; L66-T69 WeakPolarHBondContact O-CB 3.46Å; L66-T69 PolarHBondContact O-N 2.79Å; L66-T69 VanDerWaalsContact O-N 3.11Å; T69-K71 PolarHBondContact O-N 2.92Å; T69-K72 PolarHBondContact O-N 3.47Å; T69-A73 PolarHBondContact O-N 3.24Å
70	E	94	Very high	87	Confident	107 Å²	107	110.9 Å²	110.9	50%	0.5	57%	0.571	S	S	.	*	H	α-helix	trans	-60.8	-45	175.6	-71.2	179.2	-173.8	0	0	112.6	L66 K72 A73 K74	L66-E70 PolarHBondContact O-N 2.77Å; E70-K72 VanDerWaalsContact C-N 3.29Å; E70-K72 PolarHBondContact O-N 3.42Å; E70-A73 PolarHBondContact O-N 3.1Å; E70-K74 WeakPolarHBondContact O-CG 3.49Å; E70-K74 PolarHBondContact O-N 2.82Å
71	K	92	Very high	87.1	Confident	137 Å²	137	108.2 Å²	108.2	60%	0.596	57%	0.571	S	S	*	*	H	α-helix	trans	-60.3	-39.4	177.2	-75.2	172.5	-175.8	176.7	0	112.1	Q67 T69 K74 A75	Q67-K71 WeakPolarHBondContact O-CB 3.37Å; Q67-K71 VanDerWaalsContact O-CG 3.26Å; Q67-K71 WeakPolarHBondContact O-CG 3.39Å; Q67-K71 PolarHBondContact O-N 3.02Å; T69-K71 PolarHBondContact O-N 2.92Å; K71-K74 PolarHBondContact O-N 2.87Å; K71-A75 PolarHBondContact O-N 2.99Å
72	K	86.3	Confident	87.4	Confident	170 Å²	170	111.9 Å²	111.9	74%	0.739	59%	0.594	S	S	*	*	H	α-helix	trans	-70.8	-32.7	176.2	-76.2	-177	178.5	-170.2	0	113.2	N68 T69 E70 K74	N68-K72 WeakPolarHBondContact O-CG 3.28Å; N68-K72 PolarHBondContact O-N 3.24Å; N68-K72 VanDerWaalsContact O-N 3.09Å; T69-K72 PolarHBondContact O-N 3.47Å; E70-K72 VanDerWaalsContact C-N 3.29Å; E70-K72 PolarHBondContact O-N 3.42Å; K72-K74 VanDerWaalsContact C-N 3.31Å
73	A	87.8	Confident	87.5	Confident	86 Å²	86	114 Å²	114	71%	0.711	61%	0.606	S	S	*	*	H	α-helix	trans	-74.2	-23.8	177.1	0	0	0	0	0	112.7	T69 E70	T69-A73 PolarHBondContact O-N 3.24Å; E70-A73 PolarHBondContact O-N 3.1Å
74	K	75.5	Confident	87.4	Confident	177 Å²	177	117.2 Å²	117.2	77%	0.77	62%	0.618	S	S	*	*			trans	-88	-13.8	177.7	-71.3	177.4	-178.9	178.2	0	114.3	E70 K71 K72	E70-K74 WeakPolarHBondContact O-CG 3.49Å; E70-K74 PolarHBondContact O-N 2.82Å; K71-K74 PolarHBondContact O-N 2.87Å; K72-K74 VanDerWaalsContact C-N 3.31Å
75	A	64.3	Low	87.3	Confident	137 Å²	137	118.6 Å²	118.6	100%	1.132	63%	0.632	S	S	*	*			trans	-98.4	0	-179.7	0	0	0	0	0	110.4	K71	K71-A75 PolarHBondContact O-N 2.99Å

Retrieved 75 of 75 residues in 107.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).