A0A061HTJ0_CRIGR Loading...

Small nuclear ribonucleoprotein Sm D2

Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs.

AlphaFold DB (H0XWS9), UniProt , Accession A0A061HTJ0, Species CRIGR (Cricetulus griseus, Chinese hamster), Gene SNRPD2, Length 117 aa.

						>A0A061HTJ0_CRIGR|A0A061HTJ0|SNRPD2
SLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	S	57.1	Low	81.1	Confident	108 Å²	108	87.4 Å²	87.4	76%	0.755	48%	0.484	S	S	*	.				0	153.1	0	60.5	0	0	0	0	108.6	L3 N4	S1-L3 PolarHBondContact O-N 3.17Å; S1-N4 PolarHBondContact O-N 3.26Å
2	L	63.8	Low	81.9	Confident	48 Å²	48	89.2 Å²	89.2	25%	0.251	50%	0.502	S	S	.	.	T	Hydrogen-bonded Turn	trans	-58.3	-15.6	177	-71.2	165.2	0	0	0	113.3	E14 K17	L2-E14 HydrophobicContact CD2-CG 4.32Å; L2-K17 HydrophobicContact CD1-CD 4.27Å
3	L	67.9	Low	82.7	Confident	106 Å²	106	94.4 Å²	94.4	56%	0.555	52%	0.52	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.3	-26.9	175.5	-68.1	164.4	0	0	0	113.7	S1	S1-L3 PolarHBondContact O-N 3.17Å
4	N	78.6	Confident	83.2	Confident	139 Å²	139	91.6 Å²	91.6	74%	0.743	50%	0.502	S	S	*	.	S	Bend	trans	-90.8	-10.6	-176.2	-66.9	-2.6	0	0	0	113.4	S1	S1-N4 PolarHBondContact O-N 3.26Å
5	K	84.8	Confident	83.7	Confident	67 Å²	67	89.9 Å²	89.9	29%	0.291	49%	0.491	S	S	.	.	S	Bend	trans	-85	131.4	176.6	-168.3	175.6	173.6	-166.2	0	109.4	E9 M10 E14 R18	K5-E9 WeakPolarHBondContact CE-O 3.44Å; K5-E9 PolarHBondContact NZ-O 3.42Å; K5-M10 HydrophobicContact CB-CG 4.43Å; K5-M10 HydrophobicContact CD-CG 3.8Å; K5-M10 HydrophobicContact CG-CG 4.07Å; K5-E14 IonicContact NZ-OE1 2.81Å; K5-E14 PolarHBondContact NZ-OE1 2.96Å; K5-E14 IonicContact NZ-OE2 2.76Å; K5-E14 PolarHBondContact NZ-OE2 3.38Å; K5-R18 PolarHBondContact O-NH1 3.03Å
6	P	88.9	Confident	84	Confident	60 Å²	60	91.4 Å²	91.4	39%	0.39	49%	0.494	S	S	.	.			trans	-63.7	144.5	178.1	25.9	-33.4	0	0	0	111	S8 E9	P6-S8 PolarHBondContact O-N 3.01Å; P6-E9 HydrophobicContact CG-CB 4.18Å; P6-E9 HydrophobicContact CG-CG 3.9Å; P6-E9 WeakPolarHBondContact CG-OE2 3.24Å; P6-E9 PolarHBondContact O-N 2.81Å; P6-E9 VanDerWaalsContact O-N 3.13Å
7	K	86.6	Confident	84.4	Confident	118 Å²	118	92.8 Å²	92.8	51%	0.513	49%	0.494	S	S	.	.	G	3₁₀ helix	trans	-60.8	-27	-176.3	-69.4	-170.9	176.7	-170.7	0	113.8	E9 M10 L15 R18 E22	K7-E9 VanDerWaalsContact C-N 3.28Å; K7-E9 PolarHBondContact O-N 3.18Å; K7-M10 VanDerWaalsContact CA-CE 3.49Å; K7-M10 HydrophobicContact CB-CE 4.08Å; K7-M10 HydrophobicContact CG-CE 3.72Å; K7-L15 HydrophobicContact CB-CD2 4.23Å; K7-L15 HydrophobicContact CG-CD2 4.38Å; K7-R18 VanDerWaalsContact CE-CZ 3.49Å; K7-E22 IonicContact NZ-OE1 2.95Å; K7-E22 IonicContact NZ-OE2 2.74Å
8	S	90.9	Very high	84.7	Confident	108 Å²	108	89.4 Å²	89.4	76%	0.755	47%	0.473	S	S	*	.	G	3₁₀ helix	trans	-68.5	-21.6	178.2	48.4	0	0	0	0	114.5	P6	P6-S8 PolarHBondContact O-N 3.01Å
9	E	90.1	Very high	84.9	Confident	127 Å²	127	86.9 Å²	86.9	59%	0.593	46%	0.459	S	S	*	.	G	3₁₀ helix	trans	-105.5	1.7	-174.9	-65.5	174.1	-164.4	0	0	112.9	K5 P6 K7	K5-E9 WeakPolarHBondContact CE-O 3.44Å; K5-E9 PolarHBondContact NZ-O 3.42Å; P6-E9 HydrophobicContact CG-CB 4.18Å; P6-E9 HydrophobicContact CG-CG 3.9Å; P6-E9 WeakPolarHBondContact CG-OE2 3.24Å; P6-E9 PolarHBondContact O-N 2.81Å; P6-E9 VanDerWaalsContact O-N 3.13Å; K7-E9 VanDerWaalsContact C-N 3.28Å; K7-E9 PolarHBondContact O-N 3.18Å
10	M	90.1	Very high	85.2	Confident	16 Å²	16	87.5 Å²	87.5	8%	0.079	46%	0.459	C	S	.	.	S	Bend	trans	-87.7	144.9	-179.7	-79	-171.5	-72.6	0	0	111.7	K5 K7 E14 L15	K5-M10 HydrophobicContact CB-CG 4.43Å; K5-M10 HydrophobicContact CD-CG 3.8Å; K5-M10 HydrophobicContact CG-CG 4.07Å; K7-M10 VanDerWaalsContact CA-CE 3.49Å; K7-M10 HydrophobicContact CB-CE 4.08Å; K7-M10 HydrophobicContact CG-CE 3.72Å; M10-E14 VanDerWaalsContact CA-OE2 3.24Å; M10-E14 WeakPolarHBondContact CA-OE2 3.46Å; M10-E14 HydrophobicContact CB-CB 3.96Å; M10-E14 HydrophobicContact CG-CB 4.12Å; M10-E14 HydrophobicContact SD-CB 4.23Å; M10-L15 HydrophobicContact CB-CD2 4.04Å; M10-L15 HydrophobicContact CB-CG 3.85Å; M10-L15 HydrophobicContact CE-CD2 3.7Å
11	T	93.2	Very high	85.4	Confident	64 Å²	64	87 Å²	87	39%	0.393	45%	0.454	S	S	.	.			trans	-68.8	161.3	170.1	70.9	0	0	0	0	110.3	E13 E14 L15	T11-E13 PolarHBondContact O-N 3.37Å; T11-E14 PolarHBondContact N-OE2 3.48Å; T11-E14 PolarHBondContact O-N 3.21Å; T11-E14 VanDerWaalsContact OG1-CG 3.32Å; T11-E14 WeakPolarHBondContact OG1-CG 3.47Å; T11-E14 PolarHBondContact OG1-N 3.45Å; T11-L15 WeakPolarHBondContact O-CG 3.32Å; T11-L15 PolarHBondContact O-N 3.02Å
12	P	90.9	Very high	87	Confident	109 Å²	109	85.1 Å²	85.1	71%	0.708	43%	0.433	S	S	*	.	H	α-helix	trans	-55.5	-37.6	175.4	-26.8	35.8	0	0	0	113.3	L15 Q16	P12-L15 PolarHBondContact O-N 3.14Å; P12-Q16 PolarHBondContact O-N 2.92Å
13	E	92	Very high	88.3	Confident	157 Å²	157	84.7 Å²	84.7	73%	0.734	43%	0.43	S	S	*	.	H	α-helix	trans	-68.3	-42.4	178	-63.8	174.8	177.7	0	0	111.9	T11 L15 Q16 K17	T11-E13 PolarHBondContact O-N 3.37Å; E13-L15 VanDerWaalsContact C-N 3.32Å; E13-L15 PolarHBondContact O-N 2.96Å; E13-Q16 PolarHBondContact O-N 2.62Å; E13-K17 WeakPolarHBondContact O-CB 3.32Å; E13-K17 PolarHBondContact O-N 2.77Å
14	E	90.6	Very high	89.4	Confident	56 Å²	56	83.8 Å²	83.8	26%	0.262	43%	0.425	S	S	.	.	H	α-helix	trans	-62.9	-40	174.7	-73.4	177.2	153.2	0	0	111.5	L2 K5 M10 T11 R18	L2-E14 HydrophobicContact CD2-CG 4.32Å; K5-E14 IonicContact NZ-OE1 2.81Å; K5-E14 PolarHBondContact NZ-OE1 2.96Å; K5-E14 IonicContact NZ-OE2 2.76Å; K5-E14 PolarHBondContact NZ-OE2 3.38Å; M10-E14 VanDerWaalsContact CA-OE2 3.24Å; M10-E14 WeakPolarHBondContact CA-OE2 3.46Å; M10-E14 HydrophobicContact CB-CB 3.96Å; M10-E14 HydrophobicContact CG-CB 4.12Å; M10-E14 HydrophobicContact SD-CB 4.23Å; T11-E14 PolarHBondContact N-OE2 3.48Å; T11-E14 PolarHBondContact O-N 3.21Å; T11-E14 VanDerWaalsContact OG1-CG 3.32Å; T11-E14 WeakPolarHBondContact OG1-CG 3.47Å; T11-E14 PolarHBondContact OG1-N 3.45Å; E14-R18 VanDerWaalsContact O-CB 3.32Å; E14-R18 WeakPolarHBondContact O-CB 3.44Å; E14-R18 PolarHBondContact O-N 2.98Å
15	L	89.8	Confident	90	Very high	65 Å²	65	83 Å²	83	34%	0.34	43%	0.425	S	S	.	.	H	α-helix	trans	-63.2	-44.9	176.7	-75.7	168.8	0	0	0	111.8	K7 M10 T11 P12 E13 R18 E19	K7-L15 HydrophobicContact CB-CD2 4.23Å; K7-L15 HydrophobicContact CG-CD2 4.38Å; M10-L15 HydrophobicContact CB-CD2 4.04Å; M10-L15 HydrophobicContact CB-CG 3.85Å; M10-L15 HydrophobicContact CE-CD2 3.7Å; T11-L15 WeakPolarHBondContact O-CG 3.32Å; T11-L15 PolarHBondContact O-N 3.02Å; P12-L15 PolarHBondContact O-N 3.14Å; E13-L15 VanDerWaalsContact C-N 3.32Å; E13-L15 PolarHBondContact O-N 2.96Å; L15-R18 PolarHBondContact O-N 3.26Å; L15-E19 WeakPolarHBondContact O-CB 3.03Å; L15-E19 PolarHBondContact O-N 2.72Å
16	Q	89.6	Confident	90.3	Very high	115 Å²	115	80.8 Å²	80.8	54%	0.537	42%	0.422	S	S	.	.	H	α-helix	trans	-63.8	-47.1	178	-177.2	177.6	-11	0	0	111.2	P12 E13 R18 E19 E20	P12-Q16 PolarHBondContact O-N 2.92Å; E13-Q16 PolarHBondContact O-N 2.62Å; Q16-R18 VanDerWaalsContact C-N 3.3Å; Q16-R18 PolarHBondContact O-N 2.99Å; Q16-E19 PolarHBondContact O-N 3.41Å; Q16-E19 VanDerWaalsContact O-N 3.14Å; Q16-E20 PolarHBondContact NE2-OE1 3.17Å; Q16-E20 WeakPolarHBondContact O-CG 2.84Å; Q16-E20 PolarHBondContact O-N 3.13Å
17	K	90.1	Very high	90.5	Very high	114 Å²	114	83.7 Å²	83.7	50%	0.496	44%	0.441	S	S	.	.	H	α-helix	trans	-60.2	-42	178.4	-173.9	175.2	179.2	178.1	0	111.9	L2 E13 E20 E21	L2-K17 HydrophobicContact CD1-CD 4.27Å; E13-K17 WeakPolarHBondContact O-CB 3.32Å; E13-K17 PolarHBondContact O-N 2.77Å; K17-E20 PolarHBondContact O-N 2.87Å; K17-E21 WeakPolarHBondContact O-CG 3.41Å; K17-E21 PolarHBondContact O-N 2.96Å
18	R	89.3	Confident	90.9	Very high	33 Å²	33	80 Å²	80	13%	0.125	43%	0.426	C	S	.	.	H	α-helix	trans	-63.7	-41.4	175.4	-178.5	-178.4	166.1	162.4	1.7	112	K5 K7 E14 L15 Q16 E21 E22	K5-R18 PolarHBondContact O-NH1 3.03Å; K7-R18 VanDerWaalsContact CE-CZ 3.49Å; E14-R18 VanDerWaalsContact O-CB 3.32Å; E14-R18 WeakPolarHBondContact O-CB 3.44Å; E14-R18 PolarHBondContact O-N 2.98Å; L15-R18 PolarHBondContact O-N 3.26Å; Q16-R18 VanDerWaalsContact C-N 3.3Å; Q16-R18 PolarHBondContact O-N 2.99Å; R18-E21 PolarHBondContact O-N 3.43Å; R18-E22 HydrophobicContact CG-CG 4.47Å; R18-E22 IonicContact CZ-OE1 2.67Å; R18-E22 IonicContact NE-OE1 3.3Å; R18-E22 PolarHBondContact NE-OE1 3.29Å; R18-E22 IonicContact NH2-OE1 2.87Å; R18-E22 WeakPolarHBondContact O-CB 3.47Å; R18-E22 WeakPolarHBondContact O-CG 3.4Å; R18-E22 PolarHBondContact O-N 2.86Å
19	E	89.8	Confident	91.1	Very high	42 Å²	42	75.8 Å²	75.8	20%	0.196	40%	0.397	C	S	.	.	H	α-helix	trans	-63.1	-42.3	176.5	-179	170.4	-154.7	0	0	111.4	L15 Q16 E22 F23 R60	L15-E19 WeakPolarHBondContact O-CB 3.03Å; L15-E19 PolarHBondContact O-N 2.72Å; Q16-E19 PolarHBondContact O-N 3.41Å; Q16-E19 VanDerWaalsContact O-N 3.14Å; E19-E22 PolarHBondContact O-N 2.92Å; E19-F23 HydrophobicContact CG-CD2 3.95Å; E19-F23 HydrophobicContact CG-CE1 4.43Å; E19-F23 HydrophobicContact CG-CE2 3.38Å; E19-F23 HydrophobicContact CG-CZ 3.65Å; E19-F23 WeakPolarHBondContact O-CD2 3.44Å; E19-F23 WeakPolarHBondContact O-CG 3.46Å; E19-F23 PolarHBondContact O-N 2.78Å; E19-F23 WeakPolarHBondContact OE1-CZ 3.33Å; E19-R60 WeakPolarHBondContact OE1-CB 3.32Å; E19-R60 IonicContact OE1-CZ 2.62Å; E19-R60 IonicContact OE1-NE 3.26Å; E19-R60 PolarHBondContact OE1-NE 2.79Å; E19-R60 IonicContact OE1-NH2 3.39Å; E19-R60 PolarHBondContact OE1-NH2 2.84Å; E19-R60 IonicContact OE2-CZ 3.86Å; E19-R60 IonicContact OE2-NE 2.72Å; E19-R60 IonicContact OE2-NH2 3.54Å; E19-R60 PolarHBondContact OE2-NH2 3.08Å
20	E	89.1	Confident	91.3	Very high	98 Å²	98	72.5 Å²	72.5	46%	0.458	39%	0.386	S	S	.	.	H	α-helix	trans	-62.2	-42.2	174.2	-71.9	174.3	-167.8	0	0	112.2	Q16 K17 F23 N24	Q16-E20 PolarHBondContact NE2-OE1 3.17Å; Q16-E20 WeakPolarHBondContact O-CG 2.84Å; Q16-E20 PolarHBondContact O-N 3.13Å; K17-E20 PolarHBondContact O-N 2.87Å; E20-F23 PolarHBondContact O-N 2.8Å; E20-N24 PolarHBondContact O-N 2.88Å; E20-N24 VanDerWaalsContact O-N 3.08Å; E20-N24 PolarHBondContact O-ND2 3.15Å
21	E	89.8	Confident	91.5	Very high	77 Å²	77	72 Å²	72	36%	0.36	38%	0.383	S	S	.	.	H	α-helix	trans	-62.6	-44.5	174.1	-74.1	174.5	-169.7	0	0	111.5	K17 R18 F23 N24 T25	K17-E21 WeakPolarHBondContact O-CG 3.41Å; K17-E21 PolarHBondContact O-N 2.96Å; R18-E21 PolarHBondContact O-N 3.43Å; E21-F23 VanDerWaalsContact C-N 3.33Å; E21-F23 PolarHBondContact O-N 2.89Å; E21-N24 PolarHBondContact O-N 3.35Å; E21-T25 PolarHBondContact O-N 3.5Å; E21-T25 PolarHBondContact O-OG1 2.95Å
22	E	90.2	Very high	91.6	Very high	69 Å²	69	69.8 Å²	69.8	32%	0.322	37%	0.37	S	S	.	.	H	α-helix	trans	-61.5	-37.9	176	-75.8	176.5	-171.3	0	0	111.3	K7 R18 E19 G26	K7-E22 IonicContact NZ-OE1 2.95Å; K7-E22 IonicContact NZ-OE2 2.74Å; R18-E22 HydrophobicContact CG-CG 4.47Å; R18-E22 IonicContact CZ-OE1 2.67Å; R18-E22 IonicContact NE-OE1 3.3Å; R18-E22 PolarHBondContact NE-OE1 3.29Å; R18-E22 IonicContact NH2-OE1 2.87Å; R18-E22 WeakPolarHBondContact O-CB 3.47Å; R18-E22 WeakPolarHBondContact O-CG 3.4Å; R18-E22 PolarHBondContact O-N 2.86Å; E19-E22 PolarHBondContact O-N 2.92Å; E22-G26 WeakPolarHBondContact O-CA 3.47Å; E22-G26 PolarHBondContact O-N 2.8Å
23	F	92.2	Very high	91.7	Very high	39 Å²	39	68.9 Å²	68.9	17%	0.171	36%	0.356	C	S	.	.	H	α-helix	trans	-72.1	-27.5	175.7	-71	-33.1	0	0	0	114.2	E19 E20 E21 L28 S29 T32 F58 R60	E19-F23 HydrophobicContact CG-CD2 3.95Å; E19-F23 HydrophobicContact CG-CE1 4.43Å; E19-F23 HydrophobicContact CG-CE2 3.38Å; E19-F23 HydrophobicContact CG-CZ 3.65Å; E19-F23 WeakPolarHBondContact O-CD2 3.44Å; E19-F23 WeakPolarHBondContact O-CG 3.46Å; E19-F23 PolarHBondContact O-N 2.78Å; E19-F23 WeakPolarHBondContact OE1-CZ 3.33Å; E20-F23 PolarHBondContact O-N 2.8Å; E21-F23 VanDerWaalsContact C-N 3.33Å; E21-F23 PolarHBondContact O-N 2.89Å; F23-L28 HydrophobicContact CD1-CB 4.05Å; F23-L28 HydrophobicContact CD1-CD1 3.78Å; F23-L28 HydrophobicContact CE1-CD1 3.57Å; F23-S29 WeakPolarHBondContact O-CA 3.37Å; F23-S29 PolarHBondContact O-N 3.36Å; F23-T32 PolarHBondContact O-OG1 3.05Å; F23-F58 AromaticContact CD1-CE2 3.75Å; F23-F58 HydrophobicContact CD1-CE2 3.75Å; F23-F58 HydrophobicContact CD1-CZ 4.25Å; F23-F58 AromaticContact CE1-CE2 3.87Å; F23-F58 HydrophobicContact CE1-CE2 3.87Å; F23-F58 HydrophobicContact CG-CE2 4.27Å; F23-F58 HydrophobicContact CG-CZ 4.35Å; F23-F58 HydrophobicContact CZ-CE2 4.45Å; F23-R60 HydrophobicContact CE1-CB 4.37Å; F23-R60 HydrophobicContact CZ-CB 4.14Å
24	N	90.9	Very high	91.8	Very high	86 Å²	86	61.4 Å²	61.4	46%	0.46	32%	0.321	S	S	.	.	H	α-helix	trans	-90	-32.8	-178.8	-74.1	-60.7	0	0	0	113	E20 E21 S29	E20-N24 PolarHBondContact O-N 2.88Å; E20-N24 VanDerWaalsContact O-N 3.08Å; E20-N24 PolarHBondContact O-ND2 3.15Å; E21-N24 PolarHBondContact O-N 3.35Å; N24-S29 VanDerWaalsContact O-CB 3.26Å; N24-S29 WeakPolarHBondContact O-CB 3.37Å
25	T	91.3	Very high	92	Very high	122 Å²	122	61 Å²	61	75%	0.748	32%	0.322	S	S	*	.	H	α-helix	trans	-110.7	-20.5	-174	62.8	0	0	0	0	113.8	E21	E21-T25 PolarHBondContact O-N 3.5Å; E21-T25 PolarHBondContact O-OG1 2.95Å
26	G	91.5	Very high	92.2	Very high	21 Å²	21	65 Å²	65	22%	0.216	34%	0.337	C	S	.	.	S	Bend	trans	-85.4	-171.1	-177.7	0	0	0	0	0	114.6	E22 L28 S29	E22-G26 WeakPolarHBondContact O-CA 3.47Å; E22-G26 PolarHBondContact O-N 2.8Å; G26-L28 PolarHBondContact O-N 2.97Å; G26-S29 WeakPolarHBondContact O-CB 3.34Å; G26-S29 PolarHBondContact O-N 2.79Å; G26-S29 PolarHBondContact O-OG 3.38Å
27	P	93.4	Very high	92.4	Very high	122 Å²	122	63.6 Å²	63.6	79%	0.792	33%	0.333	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.8	-27.6	-178.4	24.6	-34.2	0	0	0	113.5	S29	P27-S29 PolarHBondContact O-N 3.08Å
28	L	94.8	Very high	92.6	Very high	39 Å²	39	61.4 Å²	61.4	20%	0.204	33%	0.327	C	S	.	.	T	Hydrogen-bonded Turn	trans	-74.3	-8	176.4	-62.8	-179.2	0	0	0	113.3	F23 G26 V30 L31 T32 F58	F23-L28 HydrophobicContact CD1-CB 4.05Å; F23-L28 HydrophobicContact CD1-CD1 3.78Å; F23-L28 HydrophobicContact CE1-CD1 3.57Å; G26-L28 PolarHBondContact O-N 2.97Å; L28-V30 PolarHBondContact O-N 2.88Å; L28-V30 VanDerWaalsContact O-N 3.1Å; L28-L31 HydrophobicContact CD2-CD1 4Å; L28-L31 WeakPolarHBondContact O-CA 3.39Å; L28-L31 WeakPolarHBondContact O-CB 3.33Å; L28-L31 PolarHBondContact O-N 3.43Å; L28-T32 PolarHBondContact O-N 2.89Å; L28-T32 VanDerWaalsContact O-N 3.16Å; L28-T32 PolarHBondContact O-OG1 3.49Å; L28-F58 HydrophobicContact CB-CE2 4.16Å; L28-F58 HydrophobicContact CD1-CE2 4.48Å
29	S	94.6	Very high	92.8	Very high	21 Å²	21	59.8 Å²	59.8	15%	0.147	32%	0.321	C	S	.	.	H	α-helix	trans	-56	-27.6	173.9	64.8	0	0	0	0	113.1	F23 N24 G26 P27 L31 T32 Q33	F23-S29 WeakPolarHBondContact O-CA 3.37Å; F23-S29 PolarHBondContact O-N 3.36Å; N24-S29 VanDerWaalsContact O-CB 3.26Å; N24-S29 WeakPolarHBondContact O-CB 3.37Å; G26-S29 WeakPolarHBondContact O-CB 3.34Å; G26-S29 PolarHBondContact O-N 2.79Å; G26-S29 PolarHBondContact O-OG 3.38Å; P27-S29 PolarHBondContact O-N 3.08Å; S29-L31 VanDerWaalsContact C-N 3.3Å; S29-L31 PolarHBondContact O-N 3.05Å; S29-T32 WeakPolarHBondContact O-CB 3.46Å; S29-T32 PolarHBondContact O-N 3.37Å; S29-Q33 WeakPolarHBondContact O-CB 3.36Å; S29-Q33 VanDerWaalsContact O-CG 3.26Å; S29-Q33 WeakPolarHBondContact O-CG 3.34Å; S29-Q33 PolarHBondContact O-N 2.8Å
30	V	94.1	Very high	93	Very high	58 Å²	58	60.9 Å²	60.9	35%	0.352	33%	0.326	S	S	.	.	H	α-helix	trans	-59.9	-40.1	172.9	178.2	0	0	0	0	111.5	L28 S34 R110	L28-V30 PolarHBondContact O-N 2.88Å; L28-V30 VanDerWaalsContact O-N 3.1Å; V30-S34 WeakPolarHBondContact O-CB 3.35Å; V30-S34 PolarHBondContact O-N 2.73Å; V30-S34 PolarHBondContact O-OG 2.94Å; V30-R110 HydrophobicContact CG1-CB 3.78Å
31	L	95.1	Very high	93.4	Very high	6 Å²	6	56.2 Å²	56.2	3%	0.031	30%	0.304	C	S	.	.	H	α-helix	trans	-72.7	-42.7	175.7	-64.1	177.1	0	0	0	111	L28 S29 Q33 S34 V35 V55 F58 M64 V108	L28-L31 HydrophobicContact CD2-CD1 4Å; L28-L31 WeakPolarHBondContact O-CA 3.39Å; L28-L31 WeakPolarHBondContact O-CB 3.33Å; L28-L31 PolarHBondContact O-N 3.43Å; S29-L31 VanDerWaalsContact C-N 3.3Å; S29-L31 PolarHBondContact O-N 3.05Å; L31-Q33 VanDerWaalsContact C-N 3.31Å; L31-Q33 PolarHBondContact O-N 3.21Å; L31-S34 WeakPolarHBondContact O-CA 3.43Å; L31-S34 WeakPolarHBondContact O-CB 3.44Å; L31-S34 PolarHBondContact O-N 3.46Å; L31-V35 WeakPolarHBondContact O-CG2 3.29Å; L31-V35 PolarHBondContact O-N 2.75Å; L31-V55 HydrophobicContact CD2-CG2 4.35Å; L31-F58 HydrophobicContact CB-CD1 3.85Å; L31-F58 HydrophobicContact CB-CD2 4.13Å; L31-F58 HydrophobicContact CB-CE1 3.88Å; L31-F58 HydrophobicContact CB-CE2 4.16Å; L31-F58 HydrophobicContact CB-CG 4Å; L31-F58 HydrophobicContact CB-CZ 4.04Å; L31-F58 HydrophobicContact CD1-CB 4.26Å; L31-F58 HydrophobicContact CD1-CD2 3.8Å; L31-F58 HydrophobicContact CD1-CE2 4.36Å; L31-F58 HydrophobicContact CD1-CG 3.98Å; L31-M64 HydrophobicContact CD1-CE 3.45Å; L31-M64 VanDerWaalsContact CD1-CE 3.45Å; L31-M64 HydrophobicContact CD1-SD 4.44Å; L31-M64 HydrophobicContact CD2-CE 3.85Å; L31-M64 HydrophobicContact CD2-SD 4.1Å; L31-M64 HydrophobicContact CG-CE 4.32Å; L31-V108 HydrophobicContact CD2-CG1 3.86Å
32	T	95.1	Very high	93.7	Very high	17 Å²	17	55.3 Å²	55.3	10%	0.104	30%	0.301	C	S	.	.	H	α-helix	trans	-53.4	-49.4	174.3	-55.6	0	0	0	0	111.2	F23 L28 S29 S34 V35 K36 F58	F23-T32 PolarHBondContact O-OG1 3.05Å; L28-T32 PolarHBondContact O-N 2.89Å; L28-T32 VanDerWaalsContact O-N 3.16Å; L28-T32 PolarHBondContact O-OG1 3.49Å; S29-T32 WeakPolarHBondContact O-CB 3.46Å; S29-T32 PolarHBondContact O-N 3.37Å; T32-S34 VanDerWaalsContact C-N 3.3Å; T32-S34 PolarHBondContact O-N 2.86Å; T32-V35 PolarHBondContact O-N 2.67Å; T32-K36 HydrophobicContact CG2-CD 4.18Å; T32-K36 WeakPolarHBondContact O-CB 3.46Å; T32-K36 WeakPolarHBondContact O-CG 3.48Å; T32-K36 PolarHBondContact O-N 3.45Å; T32-F58 WeakPolarHBondContact OG1-CZ 3.45Å
33	Q	93.4	Very high	94.1	Very high	90 Å²	90	52 Å²	52	42%	0.421	29%	0.286	S	S	.	.	H	α-helix	trans	-67.7	-31.9	177.4	-65.6	173.7	11.5	0	0	112.1	S29 L31 N37 R110	S29-Q33 WeakPolarHBondContact O-CB 3.36Å; S29-Q33 VanDerWaalsContact O-CG 3.26Å; S29-Q33 WeakPolarHBondContact O-CG 3.34Å; S29-Q33 PolarHBondContact O-N 2.8Å; L31-Q33 VanDerWaalsContact C-N 3.31Å; L31-Q33 PolarHBondContact O-N 3.21Å; Q33-N37 VanDerWaalsContact O-CB 3.25Å; Q33-N37 WeakPolarHBondContact O-CB 3.25Å; Q33-N37 PolarHBondContact O-N 2.95Å; Q33-N37 PolarHBondContact O-ND2 3.1Å; Q33-R110 VanDerWaalsContact CB-NH1 3.25Å
34	S	93.9	Very high	94.4	Very high	0 Å²	0	52.6 Å²	52.6	0%	0	29%	0.291	C	S	.	.	H	α-helix	trans	-69.7	-38.8	178.3	-61.4	0	0	0	0	112.4	V30 L31 T32 N38 T39	V30-S34 WeakPolarHBondContact O-CB 3.35Å; V30-S34 PolarHBondContact O-N 2.73Å; V30-S34 PolarHBondContact O-OG 2.94Å; L31-S34 WeakPolarHBondContact O-CA 3.43Å; L31-S34 WeakPolarHBondContact O-CB 3.44Å; L31-S34 PolarHBondContact O-N 3.46Å; T32-S34 VanDerWaalsContact C-N 3.3Å; T32-S34 PolarHBondContact O-N 2.86Å; S34-N38 CarbonylContact O-C 3.6Å; S34-N38 VanDerWaalsContact O-CA 3.29Å; S34-N38 WeakPolarHBondContact O-CA 3.18Å; S34-N38 PolarHBondContact O-N 3.38Å; S34-T39 WeakPolarHBondContact CA-OG1 3.39Å; S34-T39 PolarHBondContact O-N 3.11Å
35	V	94.9	Very high	94.7	Very high	48 Å²	48	48.7 Å²	48.7	29%	0.291	27%	0.27	S	S	.	.	H	α-helix	trans	-66.5	-51.5	173.4	175.3	0	0	0	0	110.2	L31 T32 N37 N38 V55 K56 F58	L31-V35 WeakPolarHBondContact O-CG2 3.29Å; L31-V35 PolarHBondContact O-N 2.75Å; T32-V35 PolarHBondContact O-N 2.67Å; V35-N37 PolarHBondContact O-N 3.1Å; V35-N38 PolarHBondContact O-N 2.96Å; V35-N38 VanDerWaalsContact O-N 3.1Å; V35-V55 HydrophobicContact CG2-CB 3.92Å; V35-V55 HydrophobicContact CG2-CG1 3.73Å; V35-K56 WeakPolarHBondContact CG1-O 3.2Å; V35-F58 HydrophobicContact CG2-CD1 4.06Å; V35-F58 HydrophobicContact CG2-CE1 4.39Å
36	K	93.7	Very high	94.9	Very high	149 Å²	149	52.4 Å²	52.4	65%	0.648	27%	0.271	S	S	*	.	H	α-helix	trans	-58	-45	-178.7	-74.8	177.7	179.4	175.7	0	112.6	T32 N38	T32-K36 HydrophobicContact CG2-CD 4.18Å; T32-K36 WeakPolarHBondContact O-CB 3.46Å; T32-K36 WeakPolarHBondContact O-CG 3.48Å; T32-K36 PolarHBondContact O-N 3.45Å; K36-N38 VanDerWaalsContact C-N 3.3Å
37	N	93.4	Very high	94.9	Very high	85 Å²	85	56 Å²	56	46%	0.455	29%	0.285	S	S	.	.	T	Hydrogen-bonded Turn	trans	-89	2	-178.9	-61.4	-41.8	0	0	0	113	Q33 V35 T39 R110	Q33-N37 VanDerWaalsContact O-CB 3.25Å; Q33-N37 WeakPolarHBondContact O-CB 3.25Å; Q33-N37 PolarHBondContact O-N 2.95Å; Q33-N37 PolarHBondContact O-ND2 3.1Å; V35-N37 PolarHBondContact O-N 3.1Å; N37-T39 HydrophobicContact CB-CG2 3.71Å; N37-T39 PolarHBondContact O-N 2.99Å; N37-T39 VanDerWaalsContact O-N 3.1Å; N37-R110 PolarHBondContact ND2-NH2 3.03Å; N37-R110 VanDerWaalsContact ND2-NH2 3.11Å
38	N	93.2	Very high	94.8	Very high	67 Å²	67	56.2 Å²	56.2	36%	0.358	28%	0.279	S	S	.	.	T	Hydrogen-bonded Turn	trans	48.5	36.6	-174.3	-170.6	43.5	0	0	0	112.5	S34 V35 K36 R54 K56	S34-N38 CarbonylContact O-C 3.6Å; S34-N38 VanDerWaalsContact O-CA 3.29Å; S34-N38 WeakPolarHBondContact O-CA 3.18Å; S34-N38 PolarHBondContact O-N 3.38Å; V35-N38 PolarHBondContact O-N 2.96Å; V35-N38 VanDerWaalsContact O-N 3.1Å; K36-N38 VanDerWaalsContact C-N 3.3Å; N38-R54 PolarHBondContact O-NH1 3.03Å; N38-K56 PolarHBondContact OD1-NZ 2.82Å
39	T	94	Very high	94.8	Very high	0 Å²	0	56.6 Å²	56.6	0%	0	28%	0.279	C	S	.	.			trans	-79.8	154.9	-177	56.5	0	0	0	0	111.9	S34 N37 R110 L113	S34-T39 WeakPolarHBondContact CA-OG1 3.39Å; S34-T39 PolarHBondContact O-N 3.11Å; N37-T39 HydrophobicContact CB-CG2 3.71Å; N37-T39 PolarHBondContact O-N 2.99Å; N37-T39 VanDerWaalsContact O-N 3.1Å; T39-R110 PolarHBondContact OG1-NE 2.83Å; T39-L113 HydrophobicContact CG2-CD1 4.2Å; T39-L113 HydrophobicContact CG2-CD2 3.84Å; T39-L113 HydrophobicContact CG2-CG 3.73Å
40	Q	95.2	Very high	94.9	Very high	64 Å²	64	60.5 Å²	60.5	30%	0.299	29%	0.294	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.5	147	172	-78.5	-179.2	-36.8	0	0	111	G53 R54 N111	Q40-G53 CarbonylContact C-O 3.5Å; Q40-G53 WeakPolarHBondContact CA-O 3.46Å; Q40-R54 HydrophobicContact CG-CG 3.98Å; Q40-N111 HydrophobicContact CB-CB 4.08Å; Q40-N111 VanDerWaalsContact O-CB 3.25Å; Q40-N111 WeakPolarHBondContact O-CB 3.42Å; Q40-N111 PolarHBondContact O-N 2.74Å
41	V	96.6	Very high	95.1	Very high	0 Å²	0	57.9 Å²	57.9	0%	0	28%	0.278	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.7	143	172.7	-59.8	0	0	0	0	109.4	I43 L52 G53 V55 V108 L109	V41-I43 HydrophobicContact CG2-CD1 3.92Å; V41-I43 HydrophobicContact CG2-CG1 4.01Å; V41-L52 WeakPolarHBondContact O-CA 3.41Å; V41-G53 PolarHBondContact N-O 3.05Å; V41-G53 PolarHBondContact O-N 2.9Å; V41-G53 VanDerWaalsContact O-N 3.08Å; V41-V55 HydrophobicContact CB-CG2 4.48Å; V41-V55 HydrophobicContact CG1-CG2 4.13Å; V41-V55 HydrophobicContact CG2-CG2 3.54Å; V41-V108 HydrophobicContact CB-CG1 4.18Å; V41-L109 CarbonylContact C-O 3.56Å; V41-L109 WeakPolarHBondContact CA-O 3.19Å
42	L	97.1	Very high	95.2	Very high	58 Å²	58	59.7 Å²	59.7	30%	0.304	29%	0.287	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.8	120.3	167.6	-178.7	69.3	0	0	0	108.2	K50 L51 L52 M72 L109	L42-K50 HydrophobicContact CD1-CB 4.25Å; L42-L51 CarbonylContact C-O 3.54Å; L42-L51 WeakPolarHBondContact CA-O 3.49Å; L42-L52 HydrophobicContact CB-CD1 4.27Å; L42-L52 HydrophobicContact CD1-CB 4.4Å; L42-L52 HydrophobicContact CD1-CD1 4.35Å; L42-M72 HydrophobicContact CD1-CE 4.18Å; L42-L109 HydrophobicContact CB-CB 4.45Å; L42-L109 PolarHBondContact N-O 2.95Å; L42-L109 PolarHBondContact O-N 3.49Å
43	I	97.8	Very high	95.3	Very high	0 Å²	0	59 Å²	59	0%	0	28%	0.283	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.4	127	179.6	-58.5	161	0	0	0	108.1	V41 K50 L51 M64 L66 L100 V105 V107 V108	V41-I43 HydrophobicContact CG2-CD1 3.92Å; V41-I43 HydrophobicContact CG2-CG1 4.01Å; I43-K50 CarbonylContact O-C 3.57Å; I43-K50 WeakPolarHBondContact O-CA 3.2Å; I43-L51 HydrophobicContact CB-CB 4.25Å; I43-L51 PolarHBondContact N-O 3.19Å; I43-L51 PolarHBondContact O-N 2.84Å; I43-M64 HydrophobicContact CD1-SD 3.98Å; I43-L66 HydrophobicContact CD1-CD1 3.88Å; I43-L66 HydrophobicContact CD1-CD2 4.01Å; I43-L100 HydrophobicContact CD1-CD2 4.14Å; I43-L100 HydrophobicContact CG2-CD2 4.12Å; I43-V105 HydrophobicContact CG2-CG1 4.01Å; I43-V105 HydrophobicContact CG2-CG2 4.1Å; I43-V107 WeakPolarHBondContact CA-O 3.42Å; I43-V108 HydrophobicContact CG1-CG1 4.12Å; I43-V108 HydrophobicContact CG1-CG2 4.24Å
44	N	97.6	Very high	95.5	Very high	51 Å²	51	58 Å²	58	27%	0.273	28%	0.275	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.1	121.9	171.7	-163.8	9.7	0	0	0	109.8	I106 V107	N44-I106 PolarHBondContact O-N 2.75Å; N44-V107 HydrophobicContact CB-CB 4.47Å; N44-V107 PolarHBondContact N-O 2.78Å
45	C	97.3	Very high	95.6	Very high	5 Å²	5	58 Å²	58	3%	0.034	28%	0.275	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	157	-175.4	-63.7	0	0	0	0	112.7	N47 N48 K49 S104	C45-N47 VanDerWaalsContact CB-OD1 3.27Å; C45-N47 WeakPolarHBondContact CB-OD1 3.39Å; C45-N47 PolarHBondContact O-N 2.9Å; C45-N48 PolarHBondContact O-N 3.24Å; C45-K49 WeakPolarHBondContact CB-O 3.32Å; C45-K49 PolarHBondContact N-O 3.06Å; C45-S104 CarbonylContact C-O 3.47Å; C45-S104 WeakPolarHBondContact CA-O 3.35Å
46	R	96.4	Very high	95.8	Very high	200 Å²	200	59.6 Å²	59.6	76%	0.755	28%	0.278	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.3	-26.5	-178.1	-159.1	175.8	-154.1	169	5.7	115	N48 S104 I106	R46-N48 PolarHBondContact O-N 2.84Å; R46-S104 PolarHBondContact N-O 2.81Å; R46-I106 HydrophobicContact CB-CD1 4.32Å; R46-I106 HydrophobicContact CB-CG1 4.42Å; R46-I106 HydrophobicContact CG-CD1 4.49Å
47	N	92.3	Very high	96	Very high	96 Å²	96	54.8 Å²	54.8	51%	0.513	27%	0.267	S	S	.	.	T	Hydrogen-bonded Turn	trans	-81.4	16.9	175.7	63.3	-3.1	0	0	0	113.3	C45 K49	C45-N47 VanDerWaalsContact CB-OD1 3.27Å; C45-N47 WeakPolarHBondContact CB-OD1 3.39Å; C45-N47 PolarHBondContact O-N 2.9Å; N47-K49 PolarHBondContact O-N 3.34Å; N47-K49 VanDerWaalsContact OD1-CB 3.3Å; N47-K49 WeakPolarHBondContact OD1-CB 3.48Å; N47-K49 WeakPolarHBondContact OD1-CG 3.13Å; N47-K49 PolarHBondContact OD1-N 3.2Å
48	N	90.4	Very high	96.1	Very high	126 Å²	126	52.9 Å²	52.9	67%	0.674	25%	0.254	S	S	*	.	S	Bend	trans	59.8	24.9	-178	-157.6	34.7	0	0	0	113.7	C45 R46	C45-N48 PolarHBondContact O-N 3.24Å; R46-N48 PolarHBondContact O-N 2.84Å
49	K	94.8	Very high	96.3	Very high	48 Å²	48	52.2 Å²	52.2	21%	0.209	25%	0.25	C	S	.	.			trans	-98.9	150.3	169.4	-56.4	-166.5	-179.4	-177.6	0	110.3	C45 N47 E71 W73	C45-K49 WeakPolarHBondContact CB-O 3.32Å; C45-K49 PolarHBondContact N-O 3.06Å; N47-K49 PolarHBondContact O-N 3.34Å; N47-K49 VanDerWaalsContact OD1-CB 3.3Å; N47-K49 WeakPolarHBondContact OD1-CB 3.48Å; N47-K49 WeakPolarHBondContact OD1-CG 3.13Å; N47-K49 PolarHBondContact OD1-N 3.2Å; K49-E71 HydrophobicContact CB-CG 4.31Å; K49-E71 HydrophobicContact CD-CG 3.89Å; K49-E71 WeakPolarHBondContact CD-OE1 3.35Å; K49-E71 IonicContact NZ-OE1 3.25Å; K49-E71 PolarHBondContact NZ-OE1 3.03Å; K49-E71 IonicContact NZ-OE2 2.7Å; K49-E71 PolarHBondContact NZ-OE2 3.49Å; K49-W73 HydrophobicContact CD-CB 4.5Å; K49-W73 HydrophobicContact CG-CB 3.98Å
50	K	97.3	Very high	96.3	Very high	103 Å²	103	59.6 Å²	59.6	45%	0.448	28%	0.278	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.2	134.7	175	-60.9	177.8	-174.6	176.3	0	109.1	L42 I43 E71 M72	L42-K50 HydrophobicContact CD1-CB 4.25Å; I43-K50 CarbonylContact O-C 3.57Å; I43-K50 WeakPolarHBondContact O-CA 3.2Å; K50-E71 CarbonylContact O-C 3.57Å; K50-E71 WeakPolarHBondContact O-CA 3.47Å; K50-M72 HydrophobicContact CB-CE 4.27Å; K50-M72 PolarHBondContact N-O 3.1Å; K50-M72 PolarHBondContact O-N 3.18Å
51	L	97.9	Very high	96.3	Very high	3 Å²	3	62.4 Å²	62.4	2%	0.016	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.7	123.5	176	-54.3	174.3	0	0	0	108.5	L42 I43 L66 V69 E71 M98 L100	L42-L51 CarbonylContact C-O 3.54Å; L42-L51 WeakPolarHBondContact CA-O 3.49Å; I43-L51 HydrophobicContact CB-CB 4.25Å; I43-L51 PolarHBondContact N-O 3.19Å; I43-L51 PolarHBondContact O-N 2.84Å; L51-L66 HydrophobicContact CD1-CD1 4.21Å; L51-V69 HydrophobicContact CB-CG1 4.08Å; L51-V69 HydrophobicContact CD2-CG1 3.96Å; L51-E71 HydrophobicContact CD2-CB 3.59Å; L51-E71 HydrophobicContact CD2-CG 3.57Å; L51-M98 HydrophobicContact CD1-SD 4.01Å; L51-M98 HydrophobicContact CD2-SD 4.42Å; L51-L100 HydrophobicContact CD1-CD1 3.99Å; L51-L100 HydrophobicContact CD1-CD2 3.76Å; L51-L100 HydrophobicContact CD1-CG 4.43Å
52	L	97.5	Very high	96.3	Very high	44 Å²	44	64.1 Å²	64.1	23%	0.23	30%	0.303	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.6	117.2	167.7	-175.4	72.2	0	0	0	107.7	V41 L42 V69 K70 M72	V41-L52 WeakPolarHBondContact O-CA 3.41Å; L42-L52 HydrophobicContact CB-CD1 4.27Å; L42-L52 HydrophobicContact CD1-CB 4.4Å; L42-L52 HydrophobicContact CD1-CD1 4.35Å; L52-V69 CarbonylContact O-C 3.53Å; L52-V69 WeakPolarHBondContact O-CA 3.45Å; L52-K70 HydrophobicContact CB-CB 4.46Å; L52-K70 PolarHBondContact N-O 3.34Å; L52-K70 PolarHBondContact O-N 2.88Å; L52-M72 HydrophobicContact CB-CE 3.84Å
53	G	96.9	Very high	96.3	Very high	1 Å²	1	62.3 Å²	62.3	1%	0.01	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-162	-173	-175.5	0	0	0	0	0	112.6	Q40 V41	Q40-G53 CarbonylContact C-O 3.5Å; Q40-G53 WeakPolarHBondContact CA-O 3.46Å; V41-G53 PolarHBondContact N-O 3.05Å; V41-G53 PolarHBondContact O-N 2.9Å; V41-G53 VanDerWaalsContact O-N 3.08Å
54	R	97.1	Very high	96.4	Very high	69 Å²	69	62.4 Å²	62.4	26%	0.26	29%	0.294	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.2	129.5	173.9	-60.3	-176.9	-167.3	-89.3	-1.2	109.4	N38 Q40 L66 E67	N38-R54 PolarHBondContact O-NH1 3.03Å; Q40-R54 HydrophobicContact CG-CG 3.98Å; R54-L66 WeakPolarHBondContact O-CA 3.25Å; R54-E67 PolarHBondContact N-O 3.32Å; R54-E67 PolarHBondContact O-N 3.32Å
55	V	97.3	Very high	96.4	Very high	1 Å²	1	63 Å²	63	1%	0.006	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78	130.9	176.7	-169.2	0	0	0	0	108.9	L31 V35 V41 A57 F58 M64 L66	L31-V55 HydrophobicContact CD2-CG2 4.35Å; V35-V55 HydrophobicContact CG2-CB 3.92Å; V35-V55 HydrophobicContact CG2-CG1 3.73Å; V41-V55 HydrophobicContact CB-CG2 4.48Å; V41-V55 HydrophobicContact CG1-CG2 4.13Å; V41-V55 HydrophobicContact CG2-CG2 3.54Å; V55-A57 WeakPolarHBondContact CG1-O 3.33Å; V55-F58 HydrophobicContact CG1-CB 4.33Å; V55-M64 HydrophobicContact CG1-CB 4.42Å; V55-M64 HydrophobicContact CG2-SD 4.27Å; V55-L66 HydrophobicContact CB-CD2 4.23Å; V55-L66 HydrophobicContact CG1-CD2 4.45Å; V55-L66 HydrophobicContact CG2-CD2 3.73Å
56	K	97.6	Very high	96.4	Very high	82 Å²	82	62.7 Å²	62.7	36%	0.357	30%	0.297	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.1	-35.5	173.3	-67	-51.9	-167.8	-176.9	0	112.8	V35 N38 V65 E67	V35-K56 WeakPolarHBondContact CG1-O 3.2Å; N38-K56 PolarHBondContact OD1-NZ 2.82Å; K56-V65 HydrophobicContact CB-CG1 4.35Å; K56-V65 PolarHBondContact N-O 2.68Å; K56-E67 WeakPolarHBondContact CE-OE2 3.34Å; K56-E67 HydrophobicContact CG-CB 4.21Å; K56-E67 HydrophobicContact CG-CG 3.63Å; K56-E67 IonicContact NZ-OE2 3.44Å
57	A	97.5	Very high	96.5	Very high	48 Å²	48	55.3 Å²	55.3	40%	0.397	27%	0.271	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.7	154.6	174	0	0	0	0	0	109.5	V55 M64 V65	V55-A57 WeakPolarHBondContact CG1-O 3.33Å; A57-M64 WeakPolarHBondContact O-CA 3.12Å; A57-V65 HydrophobicContact CB-CB 4.22Å; A57-V65 HydrophobicContact CB-CG2 4.25Å; A57-V65 PolarHBondContact O-N 3.1Å
58	F	97.4	Very high	96.8	Very high	45 Å²	45	54.3 Å²	54.3	20%	0.197	27%	0.266	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.9	167.7	171.5	72.2	-79.7	0	0	0	110	F23 L28 L31 T32 V35 V55 N63 M64	F23-F58 AromaticContact CD1-CE2 3.75Å; F23-F58 HydrophobicContact CD1-CE2 3.75Å; F23-F58 HydrophobicContact CD1-CZ 4.25Å; F23-F58 AromaticContact CE1-CE2 3.87Å; F23-F58 HydrophobicContact CE1-CE2 3.87Å; F23-F58 HydrophobicContact CG-CE2 4.27Å; F23-F58 HydrophobicContact CG-CZ 4.35Å; F23-F58 HydrophobicContact CZ-CE2 4.45Å; L28-F58 HydrophobicContact CB-CE2 4.16Å; L28-F58 HydrophobicContact CD1-CE2 4.48Å; L31-F58 HydrophobicContact CB-CD1 3.85Å; L31-F58 HydrophobicContact CB-CD2 4.13Å; L31-F58 HydrophobicContact CB-CE1 3.88Å; L31-F58 HydrophobicContact CB-CE2 4.16Å; L31-F58 HydrophobicContact CB-CG 4Å; L31-F58 HydrophobicContact CB-CZ 4.04Å; L31-F58 HydrophobicContact CD1-CB 4.26Å; L31-F58 HydrophobicContact CD1-CD2 3.8Å; L31-F58 HydrophobicContact CD1-CE2 4.36Å; L31-F58 HydrophobicContact CD1-CG 3.98Å; T32-F58 WeakPolarHBondContact OG1-CZ 3.45Å; V35-F58 HydrophobicContact CG2-CD1 4.06Å; V35-F58 HydrophobicContact CG2-CE1 4.39Å; V55-F58 HydrophobicContact CG1-CB 4.33Å; F58-N63 CarbonylContact C-O 3.57Å; F58-N63 WeakPolarHBondContact CA-O 3.13Å; F58-N63 WeakPolarHBondContact CB-O 3.26Å; F58-M64 HydrophobicContact CB-CG 4.07Å
59	D	95.5	Very high	97.1	Very high	52 Å²	52	48.3 Å²	48.3	28%	0.278	23%	0.234	S	C	.	.			trans	-130.5	-178	175.9	72.3	12.2	0	0	0	112.7	H61 C62 N63	D59-H61 PolarHBondContact O-N 2.68Å; D59-H61 WeakPolarHBondContact OD1-CA 3.47Å; D59-H61 WeakPolarHBondContact OD1-CB 3.39Å; D59-H61 PolarHBondContact OD1-N 3.27Å; D59-C62 PolarHBondContact O-N 3.16Å; D59-C62 PolarHBondContact OD1-N 3Å; D59-N63 PolarHBondContact N-O 3.44Å; D59-N63 VanDerWaalsContact N-O 3.15Å; D59-N63 WeakPolarHBondContact OD1-CB 3.47Å; D59-N63 PolarHBondContact OD1-N 3.4Å; D59-N63 WeakPolarHBondContact OD2-CB 3.36Å; D59-N63 PolarHBondContact OD2-ND2 2.91Å
60	R	94.3	Very high	97.3	Very high	156 Å²	156	49.9 Å²	49.9	59%	0.589	24%	0.241	S	C	*	.	T	Hydrogen-bonded Turn	trans	-61.2	-20.5	178	69.5	179.3	73.8	161.5	5.2	115	E19 F23 C62	E19-R60 WeakPolarHBondContact OE1-CB 3.32Å; E19-R60 IonicContact OE1-CZ 2.62Å; E19-R60 IonicContact OE1-NE 3.26Å; E19-R60 PolarHBondContact OE1-NE 2.79Å; E19-R60 IonicContact OE1-NH2 3.39Å; E19-R60 PolarHBondContact OE1-NH2 2.84Å; E19-R60 IonicContact OE2-CZ 3.86Å; E19-R60 IonicContact OE2-NE 2.72Å; E19-R60 IonicContact OE2-NH2 3.54Å; E19-R60 PolarHBondContact OE2-NH2 3.08Å; F23-R60 HydrophobicContact CE1-CB 4.37Å; F23-R60 HydrophobicContact CZ-CB 4.14Å; R60-C62 VanDerWaalsContact C-N 3.3Å
61	H	96.3	Very high	97.3	Very high	123 Å²	123	45.6 Å²	45.6	57%	0.569	22%	0.222	S	C	*	.	T	Hydrogen-bonded Turn	trans	-92.3	4.9	179.1	-61.1	-63.5	0	0	0	112	D59 N63 G102	D59-H61 PolarHBondContact O-N 2.68Å; D59-H61 WeakPolarHBondContact OD1-CA 3.47Å; D59-H61 WeakPolarHBondContact OD1-CB 3.39Å; D59-H61 PolarHBondContact OD1-N 3.27Å; H61-N63 PolarHBondContact O-N 2.88Å; H61-G102 WeakPolarHBondContact O-CA 3.42Å
62	C	96.1	Very high	97.3	Very high	36 Å²	36	48 Å²	48	24%	0.243	23%	0.234	C	C	.	.			trans	61.4	22.6	-170.1	-60.2	0	0	0	0	113.1	D59 R60 M64 G102	D59-C62 PolarHBondContact O-N 3.16Å; D59-C62 PolarHBondContact OD1-N 3Å; R60-C62 VanDerWaalsContact C-N 3.3Å; C62-M64 HydrophobicContact CB-CE 4.14Å; C62-M64 WeakPolarHBondContact O-CG 3.49Å; C62-G102 VanDerWaalsContact C-CA 3.49Å; C62-G102 WeakPolarHBondContact O-CA 3.26Å
63	N	97.8	Very high	97.2	Very high	20 Å²	20	48.3 Å²	48.3	11%	0.107	23%	0.232	C	C	.	.			trans	-66.4	142.7	163.7	-58.1	-46.1	0	0	0	108	F58 D59 H61 F99 L100 R101 G102	F58-N63 CarbonylContact C-O 3.57Å; F58-N63 WeakPolarHBondContact CA-O 3.13Å; F58-N63 WeakPolarHBondContact CB-O 3.26Å; D59-N63 PolarHBondContact N-O 3.44Å; D59-N63 VanDerWaalsContact N-O 3.15Å; D59-N63 WeakPolarHBondContact OD1-CB 3.47Å; D59-N63 PolarHBondContact OD1-N 3.4Å; D59-N63 WeakPolarHBondContact OD2-CB 3.36Å; D59-N63 PolarHBondContact OD2-ND2 2.91Å; H61-N63 PolarHBondContact O-N 2.88Å; N63-F99 HydrophobicContact CB-CE2 4.16Å; N63-F99 HydrophobicContact CB-CZ 3.98Å; N63-L100 CarbonylContact C-O 3.58Å; N63-L100 VanDerWaalsContact CA-O 3.32Å; N63-L100 WeakPolarHBondContact CA-O 3.43Å; N63-R101 WeakPolarHBondContact OD1-CA 3.36Å; N63-G102 PolarHBondContact OD1-N 3.04Å
64	M	98.1	Very high	97.1	Very high	1 Å²	1	52 Å²	52	1%	0.005	25%	0.254	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.2	139	-174.7	-57.8	-175.7	-164.5	0	0	111.7	L31 I43 V55 A57 F58 C62 L66 L100 V108	L31-M64 HydrophobicContact CD1-CE 3.45Å; L31-M64 VanDerWaalsContact CD1-CE 3.45Å; L31-M64 HydrophobicContact CD1-SD 4.44Å; L31-M64 HydrophobicContact CD2-CE 3.85Å; L31-M64 HydrophobicContact CD2-SD 4.1Å; L31-M64 HydrophobicContact CG-CE 4.32Å; I43-M64 HydrophobicContact CD1-SD 3.98Å; V55-M64 HydrophobicContact CG1-CB 4.42Å; V55-M64 HydrophobicContact CG2-SD 4.27Å; A57-M64 WeakPolarHBondContact O-CA 3.12Å; F58-M64 HydrophobicContact CB-CG 4.07Å; C62-M64 HydrophobicContact CB-CE 4.14Å; C62-M64 WeakPolarHBondContact O-CG 3.49Å; M64-L66 HydrophobicContact CB-CD2 3.96Å; M64-L66 HydrophobicContact CB-CG 4.21Å; M64-L66 HydrophobicContact SD-CD2 4.5Å; M64-L100 HydrophobicContact CB-CB 4.5Å; M64-L100 PolarHBondContact N-O 2.96Å; M64-L100 PolarHBondContact O-N 2.84Å; M64-V108 HydrophobicContact CE-CG2 4.04Å
65	V	98.4	Very high	96.8	Very high	63 Å²	63	52.3 Å²	52.3	38%	0.382	26%	0.259	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.7	119.3	162.4	-178.6	0	0	0	0	107.3	K56 A57 F99	K56-V65 HydrophobicContact CB-CG1 4.35Å; K56-V65 PolarHBondContact N-O 2.68Å; A57-V65 HydrophobicContact CB-CB 4.22Å; A57-V65 HydrophobicContact CB-CG2 4.25Å; A57-V65 PolarHBondContact O-N 3.1Å; V65-F99 HydrophobicContact CG2-CD2 4.29Å
66	L	98.2	Very high	96.3	Very high	0 Å²	0	56.6 Å²	56.6	0%	0	29%	0.285	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.4	146.2	-177.1	-55.9	176.6	0	0	0	110.7	I43 L51 R54 V55 M64 V69 K97 M98 L100	I43-L66 HydrophobicContact CD1-CD1 3.88Å; I43-L66 HydrophobicContact CD1-CD2 4.01Å; L51-L66 HydrophobicContact CD1-CD1 4.21Å; R54-L66 WeakPolarHBondContact O-CA 3.25Å; V55-L66 HydrophobicContact CB-CD2 4.23Å; V55-L66 HydrophobicContact CG1-CD2 4.45Å; V55-L66 HydrophobicContact CG2-CD2 3.73Å; M64-L66 HydrophobicContact CB-CD2 3.96Å; M64-L66 HydrophobicContact CB-CG 4.21Å; M64-L66 HydrophobicContact SD-CD2 4.5Å; L66-V69 HydrophobicContact CB-CG2 3.38Å; L66-V69 HydrophobicContact CD1-CG2 4.18Å; L66-V69 HydrophobicContact CG-CG2 4.43Å; L66-K97 WeakPolarHBondContact O-CA 3.37Å; L66-M98 HydrophobicContact CB-CB 4.41Å; L66-M98 HydrophobicContact CD1-SD 4.34Å; L66-M98 PolarHBondContact N-O 2.93Å; L66-M98 PolarHBondContact O-N 3.07Å; L66-L100 HydrophobicContact CD1-CB 4.19Å; L66-L100 HydrophobicContact CD1-CD2 4.16Å
67	E	98	Very high	95.8	Very high	44 Å²	44	55.6 Å²	55.6	21%	0.206	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.3	155.4	171	-68.4	-169.4	158.5	0	0	111.7	R54 K56 V69 S96 K97	R54-E67 PolarHBondContact N-O 3.32Å; R54-E67 PolarHBondContact O-N 3.32Å; K56-E67 WeakPolarHBondContact CE-OE2 3.34Å; K56-E67 HydrophobicContact CG-CB 4.21Å; K56-E67 HydrophobicContact CG-CG 3.63Å; K56-E67 IonicContact NZ-OE2 3.44Å; E67-V69 VanDerWaalsContact C-N 3.32Å; E67-V69 PolarHBondContact O-N 3.02Å; E67-S96 WeakPolarHBondContact CA-O 3.27Å; E67-K97 HydrophobicContact CG-CG 4.29Å; E67-K97 IonicContact OE1-NZ 3.45Å; E67-K97 PolarHBondContact OE1-NZ 2.85Å
68	N	97.4	Very high	95.1	Very high	75 Å²	75	63.4 Å²	63.4	40%	0.401	31%	0.312	S	S	.	.	E	Extended strand (participates in β ladder)	trans	53.3	48.8	-179.9	-55.3	-61.1	0	0	0	112	Y94 S96	N68-Y94 WeakPolarHBondContact CA-OH 3.3Å; N68-Y94 HydrophobicContact CB-CE2 4.23Å; N68-Y94 PolarHBondContact OD1-OH 2.65Å; N68-S96 PolarHBondContact N-O 3.22Å
69	V	98.1	Very high	94.3	Very high	0 Å²	0	63.7 Å²	63.7	0%	0	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.9	125.9	-172.1	-173	0	0	0	0	110.4	L51 L52 L66 E67 Y94 I95 M98	L51-V69 HydrophobicContact CB-CG1 4.08Å; L51-V69 HydrophobicContact CD2-CG1 3.96Å; L52-V69 CarbonylContact O-C 3.53Å; L52-V69 WeakPolarHBondContact O-CA 3.45Å; L66-V69 HydrophobicContact CB-CG2 3.38Å; L66-V69 HydrophobicContact CD1-CG2 4.18Å; L66-V69 HydrophobicContact CG-CG2 4.43Å; E67-V69 VanDerWaalsContact C-N 3.32Å; E67-V69 PolarHBondContact O-N 3.02Å; V69-Y94 CarbonylContact O-C 3.56Å; V69-Y94 WeakPolarHBondContact O-CA 3.38Å; V69-I95 HydrophobicContact CB-CB 4.35Å; V69-I95 PolarHBondContact N-O 3.25Å; V69-I95 PolarHBondContact O-N 2.88Å; V69-M98 HydrophobicContact CG1-SD 4.26Å; V69-M98 HydrophobicContact CG2-CB 4.13Å
70	K	97.8	Very high	93.5	Very high	82 Å²	82	63.4 Å²	63.4	36%	0.357	33%	0.329	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.9	106.4	165	-176.5	174	177.9	153.1	0	108.6	L52 M72 D92	L52-K70 HydrophobicContact CB-CB 4.46Å; L52-K70 PolarHBondContact N-O 3.34Å; L52-K70 PolarHBondContact O-N 2.88Å; K70-M72 HydrophobicContact CD-CG 4.43Å; K70-M72 HydrophobicContact CD-SD 4.33Å; K70-M72 HydrophobicContact CG-CG 4.04Å; K70-M72 HydrophobicContact CG-SD 4.44Å; K70-D92 WeakPolarHBondContact CE-OD2 3.41Å; K70-D92 HydrophobicContact CG-CB 4.41Å; K70-D92 IonicContact NZ-OD2 2.65Å; K70-D92 PolarHBondContact NZ-OD2 3.49Å
71	E	97.8	Very high	92.8	Very high	12 Å²	12	66.9 Å²	66.9	6%	0.056	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.4	131.7	171.3	-177	-179.4	-108.7	0	0	109.1	K49 K50 L51 W73 D92 R93	K49-E71 HydrophobicContact CB-CG 4.31Å; K49-E71 HydrophobicContact CD-CG 3.89Å; K49-E71 WeakPolarHBondContact CD-OE1 3.35Å; K49-E71 IonicContact NZ-OE1 3.25Å; K49-E71 PolarHBondContact NZ-OE1 3.03Å; K49-E71 IonicContact NZ-OE2 2.7Å; K49-E71 PolarHBondContact NZ-OE2 3.49Å; K50-E71 CarbonylContact O-C 3.57Å; K50-E71 WeakPolarHBondContact O-CA 3.47Å; L51-E71 HydrophobicContact CD2-CB 3.59Å; L51-E71 HydrophobicContact CD2-CG 3.57Å; E71-W73 HydrophobicContact CG-CE3 4.12Å; E71-W73 HydrophobicContact CG-CZ3 4.37Å; E71-D92 CarbonylContact O-C 3.59Å; E71-D92 WeakPolarHBondContact O-CA 3.17Å; E71-D92 WeakPolarHBondContact O-CB 3.38Å; E71-R93 HydrophobicContact CB-CG 4.09Å; E71-R93 PolarHBondContact N-O 3.44Å; E71-R93 PolarHBondContact O-N 2.84Å; E71-R93 IonicContact OE1-NH2 3.65Å; E71-R93 PolarHBondContact OE1-NH2 2.77Å; E71-R93 IonicContact OE2-CZ 3.84Å; E71-R93 IonicContact OE2-NE 3.5Å; E71-R93 PolarHBondContact OE2-NE 3.22Å; E71-R93 IonicContact OE2-NH2 3.94Å; E71-R93 PolarHBondContact OE2-NH2 3.25Å
72	M	97.4	Very high	91.8	Very high	54 Å²	54	65.1 Å²	65.1	27%	0.266	36%	0.364	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	134.1	-177.6	-61.3	170.1	-73.1	0	0	109.8	L42 K50 L52 K70 K91 D92	L42-M72 HydrophobicContact CD1-CE 4.18Å; K50-M72 HydrophobicContact CB-CE 4.27Å; K50-M72 PolarHBondContact N-O 3.1Å; K50-M72 PolarHBondContact O-N 3.18Å; L52-M72 HydrophobicContact CB-CE 3.84Å; K70-M72 HydrophobicContact CD-CG 4.43Å; K70-M72 HydrophobicContact CD-SD 4.33Å; K70-M72 HydrophobicContact CG-CG 4.04Å; K70-M72 HydrophobicContact CG-SD 4.44Å; M72-K91 WeakPolarHBondContact CA-O 3.32Å; M72-D92 HydrophobicContact CG-CB 4.15Å
73	W	96.2	Very high	91	Very high	51 Å²	51	71.2 Å²	71.2	19%	0.193	39%	0.386	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.5	163	175.6	69.1	102	0	0	0	111	K49 E71 E75 K91 R93	K49-W73 HydrophobicContact CD-CB 4.5Å; K49-W73 HydrophobicContact CG-CB 3.98Å; E71-W73 HydrophobicContact CG-CE3 4.12Å; E71-W73 HydrophobicContact CG-CZ3 4.37Å; W73-E75 PolarHBondContact NE1-OE1 2.76Å; W73-K91 HydrophobicContact CD2-CB 4.04Å; W73-K91 HydrophobicContact CE3-CB 4.47Å; W73-K91 HydrophobicContact CH2-CB 4.05Å; W73-K91 HydrophobicContact CZ2-CB 3.6Å; W73-K91 HydrophobicContact CZ2-CD 3.92Å; W73-K91 HydrophobicContact CZ2-CG 4.44Å; W73-K91 HydrophobicContact CZ3-CB 4.46Å; W73-K91 PolarHBondContact N-O 2.91Å; W73-K91 PolarHBondContact O-N 2.7Å; W73-K91 VanDerWaalsContact O-O 3.1Å; W73-R93 HydrophobicContact CH2-CB 4.16Å; W73-R93 HydrophobicContact CH2-CG 4.11Å; W73-R93 HydrophobicContact CZ3-CB 4.18Å; W73-R93 HydrophobicContact CZ3-CG 3.84Å
74	T	94.2	Very high	90.1	Very high	77 Å²	77	79.7 Å²	79.7	47%	0.472	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.3	124.5	176	-55.4	0	0	0	0	108.8	P88 V89 N90	T74-P88 HydrophobicContact CG2-CB 3.43Å; T74-P88 VanDerWaalsContact CG2-CB 3.43Å; T74-V89 WeakPolarHBondContact CA-O 3.32Å; T74-N90 PolarHBondContact OG1-OD1 3.39Å
75	E	90.8	Very high	89.1	Confident	77 Å²	77	89.1 Å²	89.1	36%	0.36	46%	0.463	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.4	136.1	169.7	-78.8	178.4	-156.2	0	0	110	W73 P77 V89 K91	W73-E75 PolarHBondContact NE1-OE1 2.76Å; E75-P77 WeakPolarHBondContact O-CD 3.46Å; E75-V89 PolarHBondContact N-O 3.23Å; E75-V89 PolarHBondContact O-N 2.94Å; E75-K91 VanDerWaalsContact CD-NZ 3.26Å; E75-K91 HydrophobicContact CG-CD 4.38Å; E75-K91 WeakPolarHBondContact OE1-CD 3.15Å; E75-K91 IonicContact OE1-NZ 2.9Å; E75-K91 PolarHBondContact OE1-NZ 2.8Å; E75-K91 WeakPolarHBondContact OE2-CE 3.5Å; E75-K91 IonicContact OE2-NZ 3.07Å; E75-K91 PolarHBondContact OE2-NZ 2.83Å
76	V	87.9	Confident	88.3	Confident	90 Å²	90	87.8 Å²	87.8	55%	0.545	46%	0.456	S	S	.	.			trans	-104	107.7	166.8	-176.7	0	0	0	0	106.2	P88	V76-P88 HydrophobicContact CG2-CB 4.24Å; V76-P88 HydrophobicContact CG2-CG 4.36Å
77	P	86.2	Confident	87.8	Confident	61 Å²	61	96.3 Å²	96.3	40%	0.396	49%	0.493	S	S	.	.			trans	-54.5	144.9	178.8	-22.3	29	0	0	0	111.1	E75 S79 S86 V89	E75-P77 WeakPolarHBondContact O-CD 3.46Å; P77-S79 PolarHBondContact O-N 2.67Å; P77-S79 VanDerWaalsContact O-N 3.15Å; P77-S86 WeakPolarHBondContact CB-OG 3.47Å; P77-S86 VanDerWaalsContact CD-OG 3.3Å; P77-S86 WeakPolarHBondContact CD-OG 2.86Å; P77-S86 PolarHBondContact O-OG 3.44Å; P77-V89 HydrophobicContact CG-CG2 4.3Å
78	K	83.3	Confident	87.4	Confident	213 Å²	213	98.5 Å²	98.5	93%	0.926	51%	0.511	S	S	*	.			trans	-73.2	110.7	171.3	-68.9	-174.9	-179.6	179	0	107.5
79	S	80.1	Confident	87.2	Confident	51 Å²	51	98.2 Å²	98.2	36%	0.357	51%	0.512	S	S	.	.	P	Polyproline II helix	trans	-71.6	143.3	171.5	-156	0	0	0	0	109.3	P77 K83 K84	P77-S79 PolarHBondContact O-N 2.67Å; P77-S79 VanDerWaalsContact O-N 3.15Å; S79-K83 WeakPolarHBondContact OG-CB 3.41Å; S79-K84 WeakPolarHBondContact CB-O 3.42Å; S79-K84 PolarHBondContact OG-O 2.87Å
80	G	79.1	Confident	87.1	Confident	46 Å²	46	104.4 Å²	104.4	47%	0.474	55%	0.545	S	S	.	.	P	Polyproline II helix	trans	-59.5	154.6	174	0	0	0	0	0	111.7	G82 K83	G80-G82 PolarHBondContact O-N 2.96Å; G80-K83 PolarHBondContact O-N 3.3Å
81	K	79.3	Confident	86.9	Confident	228 Å²	228	104.8 Å²	104.8	99%	0.991	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	-51.4	123.3	-179	-164.3	178.2	-177.4	-178.4	0	110.2
82	G	76.5	Confident	86.9	Confident	87 Å²	87	108.6 Å²	108.6	90%	0.897	57%	0.568	S	S	*	*	T	Hydrogen-bonded Turn	trans	88.5	-3.7	179.1	0	0	0	0	0	116.5	G80	G80-G82 PolarHBondContact O-N 2.96Å
83	K	78.1	Confident	86.9	Confident	163 Å²	163	111.8 Å²	111.8	71%	0.709	58%	0.577	S	S	*	*	S	Bend	trans	-92.6	147.1	175.4	-69	-175.7	-179.6	-178.1	0	111.4	S79 G80	S79-K83 WeakPolarHBondContact OG-CB 3.41Å; G80-K83 PolarHBondContact O-N 3.3Å
84	K	78.5	Confident	87	Confident	198 Å²	198	115.9 Å²	115.9	86%	0.861	59%	0.593	S	S	*	*	P	Polyproline II helix	trans	-51.8	145.7	173.9	-75	-176.9	178.4	177.9	0	110.2	S79 S86	S79-K84 WeakPolarHBondContact CB-O 3.42Å; S79-K84 PolarHBondContact OG-O 2.87Å; K84-S86 PolarHBondContact O-N 2.92Å
85	K	77.4	Confident	87.2	Confident	199 Å²	199	114 Å²	114	87%	0.865	58%	0.58	S	S	*	*	P	Polyproline II helix	trans	-53.5	128.6	175.6	-69.9	-174.3	-179.8	179.3	0	108.9
86	S	82.8	Confident	87.5	Confident	35 Å²	35	113.9 Å²	113.9	25%	0.245	59%	0.588	C	S	.	*	P	Polyproline II helix	trans	-66.8	151.3	177	49.6	0	0	0	0	110.6	P77 K84	P77-S86 WeakPolarHBondContact CB-OG 3.47Å; P77-S86 VanDerWaalsContact CD-OG 3.3Å; P77-S86 WeakPolarHBondContact CD-OG 2.86Å; P77-S86 PolarHBondContact O-OG 3.44Å; K84-S86 PolarHBondContact O-N 2.92Å
87	K	87.4	Confident	88	Confident	179 Å²	179	116.5 Å²	116.5	78%	0.778	59%	0.592	S	S	*	*	P	Polyproline II helix	trans	-61.9	141.2	177	-66.2	-177.6	179.2	-179.5	0	110.1	V89	K87-V89 PolarHBondContact O-N 2.84Å
88	P	90.3	Very high	88.5	Confident	90 Å²	90	115.2 Å²	115.2	58%	0.584	58%	0.581	S	S	*	*	P	Polyproline II helix	trans	-60	135.2	171.5	-19	30.5	0	0	0	110.6	T74 V76	T74-P88 HydrophobicContact CG2-CB 3.43Å; T74-P88 VanDerWaalsContact CG2-CB 3.43Å; V76-P88 HydrophobicContact CG2-CB 4.24Å; V76-P88 HydrophobicContact CG2-CG 4.36Å
89	V	92.7	Very high	89.3	Confident	70 Å²	70	111.7 Å²	111.7	42%	0.424	57%	0.566	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-114.6	125.5	179.5	-177.1	0	0	0	0	108.7	T74 E75 P77 K87	T74-V89 WeakPolarHBondContact CA-O 3.32Å; E75-V89 PolarHBondContact N-O 3.23Å; E75-V89 PolarHBondContact O-N 2.94Å; P77-V89 HydrophobicContact CG-CG2 4.3Å; K87-V89 PolarHBondContact O-N 2.84Å
90	N	94.5	Very high	90.1	Very high	130 Å²	130	110.1 Å²	110.1	70%	0.695	55%	0.553	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-79.6	130.1	174.1	-67.7	-25	0	0	0	109.5	T74	T74-N90 PolarHBondContact OG1-OD1 3.39Å
91	K	95.4	Very high	91	Very high	90 Å²	90	114.6 Å²	114.6	39%	0.391	56%	0.556	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-120.9	150.3	173	-71.3	-169.5	177.8	176.1	0	109.9	M72 W73 E75	M72-K91 WeakPolarHBondContact CA-O 3.32Å; W73-K91 HydrophobicContact CD2-CB 4.04Å; W73-K91 HydrophobicContact CE3-CB 4.47Å; W73-K91 HydrophobicContact CH2-CB 4.05Å; W73-K91 HydrophobicContact CZ2-CB 3.6Å; W73-K91 HydrophobicContact CZ2-CD 3.92Å; W73-K91 HydrophobicContact CZ2-CG 4.44Å; W73-K91 HydrophobicContact CZ3-CB 4.46Å; W73-K91 PolarHBondContact N-O 2.91Å; W73-K91 PolarHBondContact O-N 2.7Å; W73-K91 VanDerWaalsContact O-O 3.1Å; E75-K91 VanDerWaalsContact CD-NZ 3.26Å; E75-K91 HydrophobicContact CG-CD 4.38Å; E75-K91 WeakPolarHBondContact OE1-CD 3.15Å; E75-K91 IonicContact OE1-NZ 2.9Å; E75-K91 PolarHBondContact OE1-NZ 2.8Å; E75-K91 WeakPolarHBondContact OE2-CE 3.5Å; E75-K91 IonicContact OE2-NZ 3.07Å; E75-K91 PolarHBondContact OE2-NZ 2.83Å
92	D	96.7	Very high	91.9	Very high	91 Å²	91	104.1 Å²	104.1	49%	0.487	51%	0.512	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137	157.2	172.4	60	-13.2	0	0	0	111.5	K70 E71 M72	K70-D92 WeakPolarHBondContact CE-OD2 3.41Å; K70-D92 HydrophobicContact CG-CB 4.41Å; K70-D92 IonicContact NZ-OD2 2.65Å; K70-D92 PolarHBondContact NZ-OD2 3.49Å; E71-D92 CarbonylContact O-C 3.59Å; E71-D92 WeakPolarHBondContact O-CA 3.17Å; E71-D92 WeakPolarHBondContact O-CB 3.38Å; M72-D92 HydrophobicContact CG-CB 4.15Å
93	R	97.5	Very high	92.9	Very high	122 Å²	122	104.1 Å²	104.1	46%	0.46	49%	0.492	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.3	152.9	167.1	71.3	-176.4	171.1	158.9	4	110.2	E71 W73 I95	E71-R93 HydrophobicContact CB-CG 4.09Å; E71-R93 PolarHBondContact N-O 3.44Å; E71-R93 PolarHBondContact O-N 2.84Å; E71-R93 IonicContact OE1-NH2 3.65Å; E71-R93 PolarHBondContact OE1-NH2 2.77Å; E71-R93 IonicContact OE2-CZ 3.84Å; E71-R93 IonicContact OE2-NE 3.5Å; E71-R93 PolarHBondContact OE2-NE 3.22Å; E71-R93 IonicContact OE2-NH2 3.94Å; E71-R93 PolarHBondContact OE2-NH2 3.25Å; W73-R93 HydrophobicContact CH2-CB 4.16Å; W73-R93 HydrophobicContact CH2-CG 4.11Å; W73-R93 HydrophobicContact CZ3-CB 4.18Å; W73-R93 HydrophobicContact CZ3-CG 3.84Å; R93-I95 HydrophobicContact CG-CD1 4.33Å; R93-I95 HydrophobicContact CG-CG1 4.42Å
94	Y	98.1	Very high	93.7	Very high	136 Å²	136	98.6 Å²	98.6	53%	0.533	47%	0.474	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.2	137.9	178	-177.1	-96.9	0	0	0	111.1	N68 V69	N68-Y94 WeakPolarHBondContact CA-OH 3.3Å; N68-Y94 HydrophobicContact CB-CE2 4.23Å; N68-Y94 PolarHBondContact OD1-OH 2.65Å; V69-Y94 CarbonylContact O-C 3.56Å; V69-Y94 WeakPolarHBondContact O-CA 3.38Å
95	I	98.2	Very high	94.6	Very high	38 Å²	38	90.6 Å²	90.6	20%	0.195	44%	0.441	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.5	116.6	-178.6	-58.3	170.2	0	0	0	107.7	V69 R93 K97 M98	V69-I95 HydrophobicContact CB-CB 4.35Å; V69-I95 PolarHBondContact N-O 3.25Å; V69-I95 PolarHBondContact O-N 2.88Å; R93-I95 HydrophobicContact CG-CD1 4.33Å; R93-I95 HydrophobicContact CG-CG1 4.42Å; I95-K97 VanDerWaalsContact CG2-O 3.32Å; I95-K97 WeakPolarHBondContact CG2-O 3.17Å; I95-K97 PolarHBondContact O-N 3.23Å; I95-M98 HydrophobicContact CB-CE 4.44Å; I95-M98 HydrophobicContact CD1-CE 3.24Å; I95-M98 HydrophobicContact CG1-CE 4.4Å; I95-M98 HydrophobicContact CG2-CB 4.1Å; I95-M98 HydrophobicContact CG2-CE 4.29Å
96	S	98.1	Very high	95.6	Very high	75 Å²	75	86.2 Å²	86.2	52%	0.524	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-65	-43.2	-173.2	-49.5	0	0	0	0	112.8	E67 N68	E67-S96 WeakPolarHBondContact CA-O 3.27Å; N68-S96 PolarHBondContact N-O 3.22Å
97	K	98.1	Very high	96.2	Very high	145 Å²	145	87.8 Å²	87.8	63%	0.63	43%	0.434	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-139.4	136.8	177.7	-56.4	-170.3	-174.3	-61.6	0	109.5	L66 E67 I95	L66-K97 WeakPolarHBondContact O-CA 3.37Å; E67-K97 HydrophobicContact CG-CG 4.29Å; E67-K97 IonicContact OE1-NZ 3.45Å; E67-K97 PolarHBondContact OE1-NZ 2.85Å; I95-K97 VanDerWaalsContact CG2-O 3.32Å; I95-K97 WeakPolarHBondContact CG2-O 3.17Å; I95-K97 PolarHBondContact O-N 3.23Å
98	M	97.6	Very high	96.6	Very high	34 Å²	34	81.3 Å²	81.3	17%	0.167	41%	0.409	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.2	136.1	-177.2	171.4	-179.2	-79.6	0	0	110.2	L51 L66 V69 I95	L51-M98 HydrophobicContact CD1-SD 4.01Å; L51-M98 HydrophobicContact CD2-SD 4.42Å; L66-M98 HydrophobicContact CB-CB 4.41Å; L66-M98 HydrophobicContact CD1-SD 4.34Å; L66-M98 PolarHBondContact N-O 2.93Å; L66-M98 PolarHBondContact O-N 3.07Å; V69-M98 HydrophobicContact CG1-SD 4.26Å; V69-M98 HydrophobicContact CG2-CB 4.13Å; I95-M98 HydrophobicContact CB-CE 4.44Å; I95-M98 HydrophobicContact CD1-CE 3.24Å; I95-M98 HydrophobicContact CG1-CE 4.4Å; I95-M98 HydrophobicContact CG2-CB 4.1Å; I95-M98 HydrophobicContact CG2-CE 4.29Å
99	F	98.3	Very high	96.9	Very high	139 Å²	139	81.4 Å²	81.4	61%	0.61	41%	0.405	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94.6	125.2	160.4	178.5	-98	0	0	0	108.8	N63 V65	N63-F99 HydrophobicContact CB-CE2 4.16Å; N63-F99 HydrophobicContact CB-CZ 3.98Å; V65-F99 HydrophobicContact CG2-CD2 4.29Å
100	L	97.9	Very high	96.9	Very high	17 Å²	17	81.6 Å²	81.6	9%	0.089	40%	0.398	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.1	126.8	176.8	179.8	66.2	0	0	0	109.2	I43 L51 N63 M64 L66 V105	I43-L100 HydrophobicContact CD1-CD2 4.14Å; I43-L100 HydrophobicContact CG2-CD2 4.12Å; L51-L100 HydrophobicContact CD1-CD1 3.99Å; L51-L100 HydrophobicContact CD1-CD2 3.76Å; L51-L100 HydrophobicContact CD1-CG 4.43Å; N63-L100 CarbonylContact C-O 3.58Å; N63-L100 VanDerWaalsContact CA-O 3.32Å; N63-L100 WeakPolarHBondContact CA-O 3.43Å; M64-L100 HydrophobicContact CB-CB 4.5Å; M64-L100 PolarHBondContact N-O 2.96Å; M64-L100 PolarHBondContact O-N 2.84Å; L66-L100 HydrophobicContact CD1-CB 4.19Å; L66-L100 HydrophobicContact CD1-CD2 4.16Å; L100-V105 HydrophobicContact CD2-CG2 3.68Å; L100-V105 HydrophobicContact CG-CG2 4.24Å
101	R	97.9	Very high	96.6	Very high	140 Å²	140	78.7 Å²	78.7	53%	0.528	38%	0.382	S	S	.	.			trans	-80.8	136.9	174.5	-168	174.9	164.8	74.6	22.7	110.9	N63 D103 S104	N63-R101 WeakPolarHBondContact OD1-CA 3.36Å; R101-D103 WeakPolarHBondContact CD-OD2 3.18Å; R101-D103 WeakPolarHBondContact CG-OD2 3.33Å; R101-D103 IonicContact CZ-OD1 3.73Å; R101-D103 IonicContact CZ-OD2 2.78Å; R101-D103 IonicContact NE-OD1 2.83Å; R101-D103 PolarHBondContact NE-OD1 2.89Å; R101-D103 IonicContact NE-OD2 3.84Å; R101-D103 PolarHBondContact NE-OD2 2.81Å; R101-D103 IonicContact NH2-OD1 3.2Å; R101-D103 PolarHBondContact NH2-OD1 2.9Å; R101-D103 IonicContact NH2-OD2 3.72Å; R101-D103 PolarHBondContact O-N 2.9Å; R101-S104 WeakPolarHBondContact O-CB 3.46Å; R101-S104 PolarHBondContact O-N 3.24Å
102	G	97.4	Very high	95.9	Very high	8 Å²	8	78.9 Å²	78.9	8%	0.082	39%	0.393	C	S	.	.	G	3₁₀ helix	trans	-67.8	-29.4	-169.9	0	0	0	0	0	115.1	H61 C62 N63 S104 V105	H61-G102 WeakPolarHBondContact O-CA 3.42Å; C62-G102 VanDerWaalsContact C-CA 3.49Å; C62-G102 WeakPolarHBondContact O-CA 3.26Å; N63-G102 PolarHBondContact OD1-N 3.04Å; G102-S104 PolarHBondContact O-N 2.86Å; G102-S104 VanDerWaalsContact O-N 3.1Å; G102-V105 WeakPolarHBondContact O-CB 3.3Å; G102-V105 PolarHBondContact O-N 2.91Å
103	D	97.3	Very high	94.5	Very high	87 Å²	87	79.9 Å²	79.9	47%	0.465	40%	0.398	S	S	.	.	G	3₁₀ helix	trans	-65	-13	174.7	23.6	-80.1	0	0	0	114.2	R101	R101-D103 WeakPolarHBondContact CD-OD2 3.18Å; R101-D103 WeakPolarHBondContact CG-OD2 3.33Å; R101-D103 IonicContact CZ-OD1 3.73Å; R101-D103 IonicContact CZ-OD2 2.78Å; R101-D103 IonicContact NE-OD1 2.83Å; R101-D103 PolarHBondContact NE-OD1 2.89Å; R101-D103 IonicContact NE-OD2 3.84Å; R101-D103 PolarHBondContact NE-OD2 2.81Å; R101-D103 IonicContact NH2-OD1 3.2Å; R101-D103 PolarHBondContact NH2-OD1 2.9Å; R101-D103 IonicContact NH2-OD2 3.72Å; R101-D103 PolarHBondContact O-N 2.9Å
104	S	96.4	Very high	92.8	Very high	47 Å²	47	81.4 Å²	81.4	33%	0.329	41%	0.413	S	S	.	.	G	3₁₀ helix	trans	-86.3	-13.7	171.5	-65.7	0	0	0	0	113.7	C45 R46 R101 G102	C45-S104 CarbonylContact C-O 3.47Å; C45-S104 WeakPolarHBondContact CA-O 3.35Å; R46-S104 PolarHBondContact N-O 2.81Å; R101-S104 WeakPolarHBondContact O-CB 3.46Å; R101-S104 PolarHBondContact O-N 3.24Å; G102-S104 PolarHBondContact O-N 2.86Å; G102-S104 VanDerWaalsContact O-N 3.1Å
105	V	97	Very high	90.6	Very high	30 Å²	30	79.4 Å²	79.4	18%	0.182	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.2	131.6	-175.2	178.8	0	0	0	0	110.2	I43 L100 G102 V108	I43-V105 HydrophobicContact CG2-CG1 4.01Å; I43-V105 HydrophobicContact CG2-CG2 4.1Å; L100-V105 HydrophobicContact CD2-CG2 3.68Å; L100-V105 HydrophobicContact CG-CG2 4.24Å; G102-V105 WeakPolarHBondContact O-CB 3.3Å; G102-V105 PolarHBondContact O-N 2.91Å; V105-V108 HydrophobicContact CG1-CG2 3.62Å
106	I	97.1	Very high	88.3	Confident	107 Å²	107	80.9 Å²	80.9	55%	0.549	45%	0.45	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.4	-53.2	172.5	-55.6	176.8	0	0	0	110.2	N44 R46	N44-I106 PolarHBondContact O-N 2.75Å; R46-I106 HydrophobicContact CB-CD1 4.32Å; R46-I106 HydrophobicContact CB-CG1 4.42Å; R46-I106 HydrophobicContact CG-CD1 4.49Å
107	V	96.4	Very high	85.3	Confident	69 Å²	69	90.6 Å²	90.6	42%	0.418	48%	0.482	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.8	139.1	-176.5	-171.1	0	0	0	0	109.2	I43 N44 L109	I43-V107 WeakPolarHBondContact CA-O 3.42Å; N44-V107 HydrophobicContact CB-CB 4.47Å; N44-V107 PolarHBondContact N-O 2.78Å; V107-L109 HydrophobicContact CB-CD1 4.34Å; V107-L109 HydrophobicContact CG1-CD1 3.56Å; V107-L109 HydrophobicContact CG1-CG 4.35Å
108	V	96.6	Very high	84.6	Confident	42 Å²	42	87.9 Å²	87.9	26%	0.255	48%	0.475	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.4	126.7	170.3	-172.8	0	0	0	0	109	L31 V41 I43 M64 V105	L31-V108 HydrophobicContact CD2-CG1 3.86Å; V41-V108 HydrophobicContact CB-CG1 4.18Å; I43-V108 HydrophobicContact CG1-CG1 4.12Å; I43-V108 HydrophobicContact CG1-CG2 4.24Å; M64-V108 HydrophobicContact CE-CG2 4.04Å; V105-V108 HydrophobicContact CG1-CG2 3.62Å
109	L	95.6	Very high	84	Confident	93 Å²	93	90.7 Å²	90.7	49%	0.487	49%	0.491	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115	125.2	173.3	-66.2	91.7	0	0	0	108.7	V41 L42 V107 N111	V41-L109 CarbonylContact C-O 3.56Å; V41-L109 WeakPolarHBondContact CA-O 3.19Å; L42-L109 HydrophobicContact CB-CB 4.45Å; L42-L109 PolarHBondContact N-O 2.95Å; L42-L109 PolarHBondContact O-N 3.49Å; V107-L109 HydrophobicContact CB-CD1 4.34Å; V107-L109 HydrophobicContact CG1-CD1 3.56Å; V107-L109 HydrophobicContact CG1-CG 4.35Å; L109-N111 PolarHBondContact O-N 2.82Å
110	R	92.9	Very high	83.2	Confident	74 Å²	74	88.1 Å²	88.1	28%	0.279	49%	0.485	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.5	125.1	169.3	179.2	176.8	172.3	-171.4	-5.4	108.8	V30 Q33 N37 T39 P112	V30-R110 HydrophobicContact CG1-CB 3.78Å; Q33-R110 VanDerWaalsContact CB-NH1 3.25Å; N37-R110 PolarHBondContact ND2-NH2 3.03Å; N37-R110 VanDerWaalsContact ND2-NH2 3.11Å; T39-R110 PolarHBondContact OG1-NE 2.83Å; R110-P112 WeakPolarHBondContact O-CD 3.45Å
111	N	87.9	Confident	82.3	Confident	69 Å²	69	92.2 Å²	92.2	37%	0.369	51%	0.508	S	S	.	.			trans	-77.4	114.1	169.6	-170	10.4	0	0	0	107.5	Q40 L109 L113	Q40-N111 HydrophobicContact CB-CB 4.08Å; Q40-N111 VanDerWaalsContact O-CB 3.25Å; Q40-N111 WeakPolarHBondContact O-CB 3.42Å; Q40-N111 PolarHBondContact O-N 2.74Å; L109-N111 PolarHBondContact O-N 2.82Å; N111-L113 PolarHBondContact O-N 3.15Å
112	P	80.1	Confident	81.3	Confident	93 Å²	93	89.3 Å²	89.3	60%	0.604	51%	0.507	S	S	*	.			trans	-57	141.7	173.3	24.7	-31.7	0	0	0	108.4	R110 I114	R110-P112 WeakPolarHBondContact O-CD 3.45Å; P112-I114 PolarHBondContact O-N 3.28Å
113	L	69.1	Low	80.2	Confident	113 Å²	113	94.7 Å²	94.7	59%	0.592	54%	0.535	S	S	*	.			trans	-53.5	132.1	165.7	-67.2	173	0	0	0	106.3	T39 N111 A115	T39-L113 HydrophobicContact CG2-CD1 4.2Å; T39-L113 HydrophobicContact CG2-CD2 3.84Å; T39-L113 HydrophobicContact CG2-CG 3.73Å; N111-L113 PolarHBondContact O-N 3.15Å; L113-A115 VanDerWaalsContact C-N 3.26Å; L113-A115 PolarHBondContact O-N 3.18Å
114	I	60.6	Low	79	Confident	153 Å²	153	95.2 Å²	95.2	79%	0.785	54%	0.54	S	S	*	.			trans	-55.8	103.4	169.2	-61.9	170.5	0	0	0	104.4	P112 G116	P112-I114 PolarHBondContact O-N 3.28Å; I114-G116 PolarHBondContact O-N 2.86Å
115	A	51.7	Low	77.7	Confident	95 Å²	95	98.9 Å²	98.9	79%	0.785	56%	0.556	S	S	*	*			trans	-55.7	116.3	166.2	0	0	0	0	0	104.1	L113 K117	L113-A115 VanDerWaalsContact C-N 3.26Å; L113-A115 PolarHBondContact O-N 3.18Å; A115-K117 PolarHBondContact O-N 3.03Å
116	G	50.2	Low	76.1	Confident	69 Å²	69	104.7 Å²	104.7	71%	0.711	59%	0.587	S	S	*	*			trans	-47.5	139.9	-163	0	0	0	0	0	112.9	I114	I114-G116 PolarHBondContact O-N 2.86Å
117	K	34.6	Very low	74.2	Confident	279 Å²	279	104.5 Å²	104.5	100%	1.213	59%	0.591	S	S	*	*			trans	-69.1	0	135.4	-80.6	-174.1	175.2	-176.2	0	108.1	A115	A115-K117 PolarHBondContact O-N 3.03Å

Retrieved 117 of 117 residues in 21.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).