A0A061IIE7_CRIGR Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Interacts with beta-1 and beta-2, but not with beta-3.

AlphaFold DB (A0A1U7R3M4), UniProt , Accession A0A061IIE7, Species CRIGR (Cricetulus griseus, Chinese hamster), Gene Gng10, Length 68 aa.

						>A0A061IIE7_CRIGR|A0A061IIE7|Gng10
MSSGASVSALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLLGVPAGSNPFREPRSCALL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.9	Very low	76.9	Confident	250 Å²	250	92.7 Å²	92.7	100%	1.232	58%	0.583	S	S	*	*				0	66.1	0	-63.8	170.9	70.6	0	0	110.6
2	S	57.2	Low	78.6	Confident	94 Å²	94	100.2 Å²	100.2	66%	0.657	59%	0.592	S	S	*	*			trans	-120.9	-11.8	-177.9	-173.8	0	0	0	0	113	G4 A5	S2-G4 VanDerWaalsContact C-N 3.32Å; S2-G4 PolarHBondContact O-N 2.75Å; S2-A5 PolarHBondContact O-N 3.42Å
3	S	61.2	Low	79.9	Confident	93 Å²	93	99.6 Å²	99.6	65%	0.65	58%	0.584	S	S	*	*	H	α-helix	trans	-70.9	-18.7	-172.6	-33.6	0	0	0	0	115	S6 V7	S3-S6 PolarHBondContact O-OG 2.98Å; S3-V7 VanDerWaalsContact O-CG2 3.29Å; S3-V7 WeakPolarHBondContact O-CG2 3.46Å; S3-V7 PolarHBondContact O-N 3.1Å
4	G	62.3	Low	81.2	Confident	56 Å²	56	97.5 Å²	97.5	58%	0.577	57%	0.573	S	S	*	*	H	α-helix	trans	-78.2	-34.1	178.5	0	0	0	0	0	113.5	S2 V7 S8	S2-G4 VanDerWaalsContact C-N 3.32Å; S2-G4 PolarHBondContact O-N 2.75Å; G4-V7 PolarHBondContact O-N 2.85Å; G4-S8 PolarHBondContact O-N 3.43Å
5	A	65.9	Low	82.3	Confident	68 Å²	68	98.5 Å²	98.5	56%	0.562	57%	0.569	S	S	*	*	H	α-helix	trans	-67.2	-40.2	178.5	0	0	0	0	0	111.3	S2 S8 A9	S2-A5 PolarHBondContact O-N 3.42Å; A5-S8 PolarHBondContact O-N 3.23Å; A5-S8 PolarHBondContact O-OG 3.36Å; A5-A9 PolarHBondContact O-N 3.49Å; A5-A9 VanDerWaalsContact O-N 3.16Å
6	S	83.9	Confident	83.3	Confident	62 Å²	62	97.9 Å²	97.9	43%	0.434	56%	0.56	S	S	.	*	H	α-helix	trans	-66.1	-39.1	176.5	56.5	0	0	0	0	112.8	S3 A9 L10	S3-S6 PolarHBondContact O-OG 2.98Å; S6-A9 PolarHBondContact O-N 3.22Å; S6-L10 WeakPolarHBondContact O-CG 3.27Å; S6-L10 PolarHBondContact O-N 3.05Å
7	V	91	Very high	84.1	Confident	75 Å²	75	97.5 Å²	97.5	46%	0.455	56%	0.555	S	S	.	*	H	α-helix	trans	-64.6	-42.8	176.8	173.2	0	0	0	0	111.4	S3 G4 A9 L10 Q11	S3-V7 VanDerWaalsContact O-CG2 3.29Å; S3-V7 WeakPolarHBondContact O-CG2 3.46Å; S3-V7 PolarHBondContact O-N 3.1Å; G4-V7 PolarHBondContact O-N 2.85Å; V7-A9 VanDerWaalsContact C-N 3.33Å; V7-A9 PolarHBondContact O-N 3.44Å; V7-L10 PolarHBondContact O-N 3.35Å; V7-Q11 WeakPolarHBondContact O-CG 3.38Å; V7-Q11 PolarHBondContact O-N 2.85Å
8	S	91.1	Very high	84.9	Confident	42 Å²	42	98.8 Å²	98.8	29%	0.294	55%	0.553	S	S	.	*	H	α-helix	trans	-65.2	-35.2	177.6	73.4	0	0	0	0	113.1	G4 A5 R12	G4-S8 PolarHBondContact O-N 3.43Å; A5-S8 PolarHBondContact O-N 3.23Å; A5-S8 PolarHBondContact O-OG 3.36Å; S8-R12 WeakPolarHBondContact O-CG 3.39Å; S8-R12 PolarHBondContact O-N 3.41Å
9	A	93.6	Very high	85.6	Confident	53 Å²	53	100 Å²	100	44%	0.438	56%	0.558	S	S	.	*	H	α-helix	trans	-67.4	-42.4	175.2	0	0	0	0	0	111.4	A5 S6 V7 R12 L13	A5-A9 PolarHBondContact O-N 3.49Å; A5-A9 VanDerWaalsContact O-N 3.16Å; S6-A9 PolarHBondContact O-N 3.22Å; V7-A9 VanDerWaalsContact C-N 3.33Å; V7-A9 PolarHBondContact O-N 3.44Å; A9-R12 PolarHBondContact O-N 3.33Å; A9-L13 PolarHBondContact O-N 3.19Å
10	L	95	Very high	86.2	Confident	104 Å²	104	99.7 Å²	99.7	55%	0.545	55%	0.552	S	S	.	*	H	α-helix	trans	-64.4	-39.1	176.2	-71.7	170.2	0	0	0	112.1	S6 V7 R12 L13 V14	S6-L10 WeakPolarHBondContact O-CG 3.27Å; S6-L10 PolarHBondContact O-N 3.05Å; V7-L10 PolarHBondContact O-N 3.35Å; L10-R12 PolarHBondContact O-N 3.16Å; L10-L13 PolarHBondContact O-N 3.44Å; L10-V14 WeakPolarHBondContact O-CG2 3.4Å; L10-V14 PolarHBondContact O-N 3.2Å
11	Q	96.2	Very high	86.8	Confident	123 Å²	123	98.2 Å²	98.2	58%	0.575	55%	0.552	S	S	*	*	H	α-helix	trans	-60	-46.1	174.5	-74.6	170.5	-15.6	0	0	111.6	V7 L13 V14 E15	V7-Q11 WeakPolarHBondContact O-CG 3.38Å; V7-Q11 PolarHBondContact O-N 2.85Å; Q11-L13 VanDerWaalsContact C-N 3.32Å; Q11-L13 PolarHBondContact O-N 2.99Å; Q11-V14 PolarHBondContact O-N 3.17Å; Q11-E15 WeakPolarHBondContact O-CG 3.22Å; Q11-E15 PolarHBondContact O-N 3.42Å
12	R	96.3	Very high	89.1	Confident	182 Å²	182	89 Å²	89	69%	0.687	52%	0.522	S	S	*	.	H	α-helix	trans	-61.3	-40.6	175.7	-67.2	179.5	-151	162.4	5.6	112.2	S8 A9 L10 V14 E15 Q16	S8-R12 WeakPolarHBondContact O-CG 3.39Å; S8-R12 PolarHBondContact O-N 3.41Å; A9-R12 PolarHBondContact O-N 3.33Å; L10-R12 PolarHBondContact O-N 3.16Å; R12-V14 VanDerWaalsContact C-N 3.34Å; R12-E15 PolarHBondContact O-N 3.3Å; R12-Q16 PolarHBondContact O-N 3.46Å
13	L	96.6	Very high	91.1	Very high	93 Å²	93	88.5 Å²	88.5	49%	0.487	51%	0.514	S	S	.	.	H	α-helix	trans	-62.3	-42.8	176.5	179.7	62.7	0	0	0	111.5	A9 L10 Q11 Q16 L17	A9-L13 PolarHBondContact O-N 3.19Å; L10-L13 PolarHBondContact O-N 3.44Å; Q11-L13 VanDerWaalsContact C-N 3.32Å; Q11-L13 PolarHBondContact O-N 2.99Å; L13-Q16 WeakPolarHBondContact O-CB 3.34Å; L13-Q16 PolarHBondContact O-N 3.36Å; L13-L17 HydrophobicContact CD1-CD1 4.39Å; L13-L17 HydrophobicContact CD1-CG 4.33Å; L13-L17 HydrophobicContact CG-CD1 4.1Å; L13-L17 HydrophobicContact CG-CG 4.46Å; L13-L17 VanDerWaalsContact O-CG 3.29Å; L13-L17 WeakPolarHBondContact O-CG 3.4Å; L13-L17 PolarHBondContact O-N 3Å
14	V	97.4	Very high	92.8	Very high	70 Å²	70	92.8 Å²	92.8	42%	0.424	52%	0.524	S	S	.	.	H	α-helix	trans	-63.3	-43.3	177.2	168.8	0	0	0	0	111.3	L10 Q11 R12 Q16 L17 K18	L10-V14 WeakPolarHBondContact O-CG2 3.4Å; L10-V14 PolarHBondContact O-N 3.2Å; Q11-V14 PolarHBondContact O-N 3.17Å; R12-V14 VanDerWaalsContact C-N 3.34Å; V14-Q16 VanDerWaalsContact C-N 3.32Å; V14-Q16 PolarHBondContact O-N 3.41Å; V14-L17 PolarHBondContact O-N 2.96Å; V14-K18 HydrophobicContact CG1-CD 4.39Å; V14-K18 WeakPolarHBondContact O-CG 3.33Å; V14-K18 PolarHBondContact O-N 2.92Å
15	E	97.8	Very high	94.5	Very high	112 Å²	112	98.7 Å²	98.7	52%	0.523	53%	0.529	S	S	.	.	H	α-helix	trans	-61.9	-40	175.3	-67.3	-53	136.1	0	0	112	Q11 R12 K18 L19	Q11-E15 WeakPolarHBondContact O-CG 3.22Å; Q11-E15 PolarHBondContact O-N 3.42Å; R12-E15 PolarHBondContact O-N 3.3Å; E15-K18 PolarHBondContact O-N 3.3Å; E15-K18 IonicContact OE1-NZ 2.75Å; E15-K18 PolarHBondContact OE1-NZ 3.37Å; E15-K18 IonicContact OE2-NZ 3.79Å; E15-L19 PolarHBondContact O-N 3.41Å
16	Q	98	Very high	96	Very high	90 Å²	90	100 Å²	100	42%	0.421	53%	0.526	S	S	.	.	H	α-helix	trans	-62.3	-46.1	174	-178.5	62.3	22.5	0	0	112.1	R12 L13 V14 K18 L19 E20	R12-Q16 PolarHBondContact O-N 3.46Å; L13-Q16 WeakPolarHBondContact O-CB 3.34Å; L13-Q16 PolarHBondContact O-N 3.36Å; V14-Q16 VanDerWaalsContact C-N 3.32Å; V14-Q16 PolarHBondContact O-N 3.41Å; Q16-K18 VanDerWaalsContact C-N 3.32Å; Q16-K18 PolarHBondContact O-N 2.9Å; Q16-L19 WeakPolarHBondContact O-CB 3.32Å; Q16-L19 PolarHBondContact O-N 2.96Å; Q16-L19 VanDerWaalsContact O-N 3.17Å; Q16-E20 WeakPolarHBondContact CG-OE1 3.46Å; Q16-E20 PolarHBondContact NE2-OE1 3.49Å; Q16-E20 PolarHBondContact O-N 2.88Å
17	L	98.2	Very high	96.7	Very high	90 Å²	90	104.6 Å²	104.6	47%	0.471	54%	0.538	S	S	.	.	H	α-helix	trans	-65	-35.6	179.8	-70.9	172.2	0	0	0	112.3	L13 V14 L19 E20 A21	L13-L17 HydrophobicContact CD1-CD1 4.39Å; L13-L17 HydrophobicContact CD1-CG 4.33Å; L13-L17 HydrophobicContact CG-CD1 4.1Å; L13-L17 HydrophobicContact CG-CG 4.46Å; L13-L17 VanDerWaalsContact O-CG 3.29Å; L13-L17 WeakPolarHBondContact O-CG 3.4Å; L13-L17 PolarHBondContact O-N 3Å; V14-L17 PolarHBondContact O-N 2.96Å; L17-L19 VanDerWaalsContact C-N 3.32Å; L17-E20 PolarHBondContact O-N 3.12Å; L17-A21 VanDerWaalsContact O-CB 3.22Å; L17-A21 WeakPolarHBondContact O-CB 3.29Å; L17-A21 PolarHBondContact O-N 3.45Å
18	K	98.3	Very high	97.1	Very high	121 Å²	121	107 Å²	107	53%	0.526	55%	0.552	S	S	.	*	H	α-helix	trans	-61.4	-42.1	173.3	-73.5	171.7	-176	169.9	0	111.4	V14 E15 Q16 G22	V14-K18 HydrophobicContact CG1-CD 4.39Å; V14-K18 WeakPolarHBondContact O-CG 3.33Å; V14-K18 PolarHBondContact O-N 2.92Å; E15-K18 PolarHBondContact O-N 3.3Å; E15-K18 IonicContact OE1-NZ 2.75Å; E15-K18 PolarHBondContact OE1-NZ 3.37Å; E15-K18 IonicContact OE2-NZ 3.79Å; Q16-K18 VanDerWaalsContact C-N 3.32Å; Q16-K18 PolarHBondContact O-N 2.9Å; K18-G22 PolarHBondContact O-N 3.27Å
19	L	98.2	Very high	97.4	Very high	122 Å²	122	109.1 Å²	109.1	64%	0.639	57%	0.567	S	S	*	*	H	α-helix	trans	-63.2	-48.5	176.2	-176.6	69.7	0	0	0	111.1	E15 Q16 L17 A21 G22	E15-L19 PolarHBondContact O-N 3.41Å; Q16-L19 WeakPolarHBondContact O-CB 3.32Å; Q16-L19 PolarHBondContact O-N 2.96Å; Q16-L19 VanDerWaalsContact O-N 3.17Å; L17-L19 VanDerWaalsContact C-N 3.32Å; L19-A21 VanDerWaalsContact C-N 3.33Å; L19-A21 PolarHBondContact O-N 2.81Å; L19-G22 PolarHBondContact O-N 2.96Å; L19-G22 VanDerWaalsContact O-N 3.16Å
20	E	97.9	Very high	97.7	Very high	93 Å²	93	110.9 Å²	110.9	44%	0.435	57%	0.566	S	S	.	*	H	α-helix	trans	-65.7	-33.9	179.7	-70.9	175.7	-167.4	0	0	113.2	Q16 L17 G22 V23 R25	Q16-E20 WeakPolarHBondContact CG-OE1 3.46Å; Q16-E20 PolarHBondContact NE2-OE1 3.49Å; Q16-E20 PolarHBondContact O-N 2.88Å; L17-E20 PolarHBondContact O-N 3.12Å; E20-G22 VanDerWaalsContact C-N 3.29Å; E20-G22 PolarHBondContact O-N 2.99Å; E20-V23 PolarHBondContact O-N 2.95Å; E20-R25 PolarHBondContact O-NH2 3.01Å
21	A	97.9	Very high	97.8	Very high	69 Å²	69	107.4 Å²	107.4	57%	0.57	55%	0.553	S	S	*	*	H	α-helix	trans	-65.4	-35.2	174.3	0	0	0	0	0	111.7	L17 L19 V23	L17-A21 VanDerWaalsContact O-CB 3.22Å; L17-A21 WeakPolarHBondContact O-CB 3.29Å; L17-A21 PolarHBondContact O-N 3.45Å; L19-A21 VanDerWaalsContact C-N 3.33Å; L19-A21 PolarHBondContact O-N 2.81Å; A21-V23 PolarHBondContact O-N 2.89Å
22	G	97.4	Very high	97.9	Very high	57 Å²	57	104.1 Å²	104.1	59%	0.588	55%	0.547	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76.7	0.1	178	0	0	0	0	0	115.2	K18 L19 E20 E24	K18-G22 PolarHBondContact O-N 3.27Å; L19-G22 PolarHBondContact O-N 2.96Å; L19-G22 VanDerWaalsContact O-N 3.16Å; E20-G22 VanDerWaalsContact C-N 3.29Å; E20-G22 PolarHBondContact O-N 2.99Å; G22-E24 PolarHBondContact O-N 3.23Å
23	V	97.9	Very high	98.1	Very high	83 Å²	83	97.8 Å²	97.8	50%	0.503	53%	0.533	S	S	.	.			trans	-72.1	119	175.5	178.8	0	0	0	0	109.9	E20 A21 R25	E20-V23 PolarHBondContact O-N 2.95Å; A21-V23 PolarHBondContact O-N 2.89Å; V23-R25 PolarHBondContact O-N 2.92Å; V23-R25 PolarHBondContact O-NH1 3.42Å
24	E	97.9	Very high	98.1	Very high	183 Å²	183	98 Å²	98	86%	0.855	53%	0.532	S	S	*	.			trans	-63.1	127.6	172.6	-71.8	-62.5	144.2	0	0	110.6	G22	G22-E24 PolarHBondContact O-N 3.23Å
25	R	97.8	Very high	98.2	Very high	180 Å²	180	100.5 Å²	100.5	68%	0.679	54%	0.542	S	S	*	.			trans	-110.2	142.4	-178.2	-65.1	177.5	-173.3	74.2	2.4	110.2	E20 V23	E20-R25 PolarHBondContact O-NH2 3.01Å; V23-R25 PolarHBondContact O-N 2.92Å; V23-R25 PolarHBondContact O-NH1 3.42Å
26	I	98.1	Very high	98.2	Very high	97 Å²	97	101.1 Å²	101.1	50%	0.497	55%	0.545	S	S	.	.			trans	-87.8	162.4	168.4	63.7	172.1	0	0	0	110.9	A31	I26-A31 HydrophobicContact CD1-CB 3.8Å; I26-A31 HydrophobicContact CG1-CB 4.29Å
27	K	98.5	Very high	98.2	Very high	158 Å²	158	102.1 Å²	102.1	69%	0.687	55%	0.55	S	S	*	.			trans	-65.1	139.2	174.7	-68.2	-177.4	-178.5	175.1	0	109.9	S29 Q30 A31	K27-S29 PolarHBondContact O-N 3.5Å; K27-Q30 HydrophobicContact CB-CB 4.31Å; K27-Q30 WeakPolarHBondContact O-CB 3.29Å; K27-Q30 PolarHBondContact O-N 2.95Å; K27-A31 PolarHBondContact O-N 3.26Å
28	V	98.5	Very high	98.2	Very high	124 Å²	124	105.2 Å²	105.2	75%	0.752	56%	0.556	S	S	*	*	H	α-helix	trans	-57	-37.5	175.9	178.5	0	0	0	0	111.4	Q30 A31 A32	V28-Q30 VanDerWaalsContact C-N 3.32Å; V28-Q30 PolarHBondContact O-N 3.29Å; V28-A31 PolarHBondContact O-N 3.31Å; V28-A32 WeakPolarHBondContact O-CB 3.29Å; V28-A32 PolarHBondContact O-N 3.43Å
29	S	98.5	Very high	98.2	Very high	88 Å²	88	103.3 Å²	103.3	62%	0.615	56%	0.557	S	S	*	*	H	α-helix	trans	-62.8	-36.5	176	55	0	0	0	0	113.2	K27 A33	K27-S29 PolarHBondContact O-N 3.5Å; S29-A33 WeakPolarHBondContact O-CB 3.47Å; S29-A33 PolarHBondContact O-N 3.18Å; S29-A33 VanDerWaalsContact O-N 3.1Å
30	Q	98.5	Very high	98.1	Very high	89 Å²	89	103.6 Å²	103.6	42%	0.416	56%	0.557	S	S	.	*	H	α-helix	trans	-68.3	-50.3	175.4	177.8	-177.3	-13.3	0	0	110.4	K27 V28 A32 A33 E34	K27-Q30 HydrophobicContact CB-CB 4.31Å; K27-Q30 WeakPolarHBondContact O-CB 3.29Å; K27-Q30 PolarHBondContact O-N 2.95Å; V28-Q30 VanDerWaalsContact C-N 3.32Å; V28-Q30 PolarHBondContact O-N 3.29Å; Q30-A32 VanDerWaalsContact C-N 3.27Å; Q30-A32 PolarHBondContact O-N 3.44Å; Q30-A33 PolarHBondContact O-N 3.23Å; Q30-A33 VanDerWaalsContact O-N 3.12Å; Q30-E34 VanDerWaalsContact CG-OE1 3.27Å; Q30-E34 WeakPolarHBondContact CG-OE1 3.35Å; Q30-E34 PolarHBondContact NE2-OE1 2.97Å; Q30-E34 WeakPolarHBondContact O-CG 3.48Å; Q30-E34 PolarHBondContact O-N 2.91Å
31	A	98.6	Very high	98.1	Very high	31 Å²	31	104.9 Å²	104.9	26%	0.256	56%	0.563	S	S	.	*	H	α-helix	trans	-56.6	-42.6	177.8	0	0	0	0	0	111.8	I26 K27 V28 E34 L35	I26-A31 HydrophobicContact CD1-CB 3.8Å; I26-A31 HydrophobicContact CG1-CB 4.29Å; K27-A31 PolarHBondContact O-N 3.26Å; V28-A31 PolarHBondContact O-N 3.31Å; A31-E34 PolarHBondContact O-N 3.34Å; A31-L35 VanDerWaalsContact O-CG 3.29Å; A31-L35 WeakPolarHBondContact O-CG 3.33Å; A31-L35 PolarHBondContact O-N 3.43Å
32	A	98.6	Very high	98	Very high	54 Å²	54	104 Å²	104	45%	0.446	55%	0.549	S	S	.	.	H	α-helix	trans	-63.9	-41.3	177.5	0	0	0	0	0	112.5	V28 Q30 L35 Q36	V28-A32 WeakPolarHBondContact O-CB 3.29Å; V28-A32 PolarHBondContact O-N 3.43Å; Q30-A32 VanDerWaalsContact C-N 3.27Å; Q30-A32 PolarHBondContact O-N 3.44Å; A32-L35 PolarHBondContact O-N 3.19Å; A32-Q36 WeakPolarHBondContact O-CB 3.46Å; A32-Q36 PolarHBondContact O-N 3.45Å
33	A	98.6	Very high	97.9	Very high	49 Å²	49	102.5 Å²	102.5	41%	0.405	53%	0.53	S	S	.	.	H	α-helix	trans	-65.3	-42.4	176.9	0	0	0	0	0	111.8	S29 Q30 Q36 Q37	S29-A33 WeakPolarHBondContact O-CB 3.47Å; S29-A33 PolarHBondContact O-N 3.18Å; S29-A33 VanDerWaalsContact O-N 3.1Å; Q30-A33 PolarHBondContact O-N 3.23Å; Q30-A33 VanDerWaalsContact O-N 3.12Å; A33-Q36 PolarHBondContact O-N 3.43Å; A33-Q37 WeakPolarHBondContact O-CB 3.43Å; A33-Q37 PolarHBondContact O-N 3.44Å
34	E	98.5	Very high	97.5	Very high	99 Å²	99	103.6 Å²	103.6	46%	0.463	54%	0.54	S	S	.	.	H	α-helix	trans	-62.4	-43.6	176.5	-71.2	173.2	-165.3	0	0	111.5	Q30 A31 Q37 Y38	Q30-E34 VanDerWaalsContact CG-OE1 3.27Å; Q30-E34 WeakPolarHBondContact CG-OE1 3.35Å; Q30-E34 PolarHBondContact NE2-OE1 2.97Å; Q30-E34 WeakPolarHBondContact O-CG 3.48Å; Q30-E34 PolarHBondContact O-N 2.91Å; A31-E34 PolarHBondContact O-N 3.34Å; E34-Q37 PolarHBondContact O-N 3Å; E34-Y38 WeakPolarHBondContact O-CB 3.33Å; E34-Y38 PolarHBondContact O-N 3.46Å
35	L	98.6	Very high	97.2	Very high	121 Å²	121	103 Å²	103	63%	0.634	54%	0.535	S	S	*	.	H	α-helix	trans	-62.4	-46.2	174.8	-71.7	173.1	0	0	0	111.9	A31 A32 Q37 Y38 C39	A31-L35 VanDerWaalsContact O-CG 3.29Å; A31-L35 WeakPolarHBondContact O-CG 3.33Å; A31-L35 PolarHBondContact O-N 3.43Å; A32-L35 PolarHBondContact O-N 3.19Å; L35-Q37 VanDerWaalsContact C-N 3.34Å; L35-Q37 PolarHBondContact O-N 3.3Å; L35-Y38 PolarHBondContact O-N 3.42Å; L35-C39 PolarHBondContact O-N 3.02Å; L35-C39 PolarHBondContact O-SG 3.28Å; L35-C39 VanDerWaalsContact O-SG 3.41Å
36	Q	98.1	Very high	97	Very high	126 Å²	126	97.9 Å²	97.9	59%	0.589	52%	0.521	S	S	*	.	H	α-helix	trans	-59.6	-47.2	177.4	-177.2	-176.7	27.6	0	0	111	A32 A33 Y38 C39 M40	A32-Q36 WeakPolarHBondContact O-CB 3.46Å; A32-Q36 PolarHBondContact O-N 3.45Å; A33-Q36 PolarHBondContact O-N 3.43Å; Q36-Y38 VanDerWaalsContact C-N 3.33Å; Q36-Y38 PolarHBondContact O-N 3.3Å; Q36-C39 PolarHBondContact O-N 3.48Å; Q36-M40 HydrophobicContact CG-CG 4.43Å; Q36-M40 HydrophobicContact CG-SD 3.93Å; Q36-M40 WeakPolarHBondContact O-CG 3.27Å; Q36-M40 PolarHBondContact O-N 3.48Å
37	Q	98.5	Very high	96.6	Very high	111 Å²	111	95.5 Å²	95.5	52%	0.519	52%	0.516	S	S	.	.	H	α-helix	trans	-60.4	-44	179.2	-177.9	179.3	-35.9	0	0	111.1	A33 E34 L35 C39 M40 Q41	A33-Q37 WeakPolarHBondContact O-CB 3.43Å; A33-Q37 PolarHBondContact O-N 3.44Å; E34-Q37 PolarHBondContact O-N 3Å; L35-Q37 VanDerWaalsContact C-N 3.34Å; L35-Q37 PolarHBondContact O-N 3.3Å; Q37-C39 PolarHBondContact O-N 2.95Å; Q37-M40 PolarHBondContact O-N 3.45Å; Q37-Q41 HydrophobicContact CG-CG 4.42Å; Q37-Q41 WeakPolarHBondContact O-CB 3.47Å; Q37-Q41 VanDerWaalsContact O-CG 3.27Å; Q37-Q41 WeakPolarHBondContact O-CG 3.47Å; Q37-Q41 PolarHBondContact O-N 2.86Å
38	Y	98.3	Very high	96.3	Very high	154 Å²	154	95.9 Å²	95.9	60%	0.604	53%	0.525	S	S	*	.	H	α-helix	trans	-58.8	-47.1	175.8	179.9	-93.1	0	0	0	111.7	E34 L35 Q36 M40 Q41 N42	E34-Y38 WeakPolarHBondContact O-CB 3.33Å; E34-Y38 PolarHBondContact O-N 3.46Å; L35-Y38 PolarHBondContact O-N 3.42Å; Q36-Y38 VanDerWaalsContact C-N 3.33Å; Q36-Y38 PolarHBondContact O-N 3.3Å; Y38-M40 PolarHBondContact O-N 3.16Å; Y38-Q41 PolarHBondContact O-N 3.41Å; Y38-N42 WeakPolarHBondContact CE2-ND2 3.48Å; Y38-N42 PolarHBondContact O-N 2.79Å; Y38-N42 PolarHBondContact O-ND2 3.36Å
39	C	97.6	Very high	96	Very high	82 Å²	82	95.2 Å²	95.2	55%	0.554	52%	0.516	S	S	*	.	H	α-helix	trans	-59.9	-46.8	176.7	-71.3	0	0	0	0	111.5	L35 Q36 Q37 Q41 N42 A43	L35-C39 PolarHBondContact O-N 3.02Å; L35-C39 PolarHBondContact O-SG 3.28Å; L35-C39 VanDerWaalsContact O-SG 3.41Å; Q36-C39 PolarHBondContact O-N 3.48Å; Q37-C39 PolarHBondContact O-N 2.95Å; C39-Q41 PolarHBondContact O-N 3.15Å; C39-N42 PolarHBondContact O-N 3.42Å; C39-A43 WeakPolarHBondContact O-CA 3.42Å; C39-A43 VanDerWaalsContact O-CB 3.32Å; C39-A43 WeakPolarHBondContact O-CB 3.49Å; C39-A43 PolarHBondContact O-N 3.2Å
40	M	96.2	Very high	95.6	Very high	128 Å²	128	96.8 Å²	96.8	63%	0.631	52%	0.517	S	S	*	.	H	α-helix	trans	-63.5	-39.9	-179.2	-70.2	176.1	68.7	0	0	112.9	Q36 Q37 Y38 N42	Q36-M40 HydrophobicContact CG-CG 4.43Å; Q36-M40 HydrophobicContact CG-SD 3.93Å; Q36-M40 WeakPolarHBondContact O-CG 3.27Å; Q36-M40 PolarHBondContact O-N 3.48Å; Q37-M40 PolarHBondContact O-N 3.45Å; Y38-M40 PolarHBondContact O-N 3.16Å; M40-N42 VanDerWaalsContact C-N 3.28Å; M40-N42 PolarHBondContact O-N 3.24Å
41	Q	97.1	Very high	94.9	Very high	120 Å²	120	94.7 Å²	94.7	56%	0.561	52%	0.52	S	S	*	.	H	α-helix	trans	-67	-29.9	178.4	-72.5	179.4	2.9	0	0	112.9	Q37 Y38 C39	Q37-Q41 HydrophobicContact CG-CG 4.42Å; Q37-Q41 WeakPolarHBondContact O-CB 3.47Å; Q37-Q41 VanDerWaalsContact O-CG 3.27Å; Q37-Q41 WeakPolarHBondContact O-CG 3.47Å; Q37-Q41 PolarHBondContact O-N 2.86Å; Y38-Q41 PolarHBondContact O-N 3.41Å; C39-Q41 PolarHBondContact O-N 3.15Å
42	N	96.1	Very high	94.3	Very high	51 Å²	51	96.2 Å²	96.2	27%	0.273	53%	0.525	S	S	.	.	H	α-helix	trans	-101.4	-12.9	-177	-66.1	-71.4	0	0	0	113.6	Y38 C39 M40 C44 K45 D46	Y38-N42 WeakPolarHBondContact CE2-ND2 3.48Å; Y38-N42 PolarHBondContact O-N 2.79Å; Y38-N42 PolarHBondContact O-ND2 3.36Å; C39-N42 PolarHBondContact O-N 3.42Å; M40-N42 VanDerWaalsContact C-N 3.28Å; M40-N42 PolarHBondContact O-N 3.24Å; N42-C44 PolarHBondContact O-N 2.81Å; N42-C44 VanDerWaalsContact O-N 3.15Å; N42-K45 WeakPolarHBondContact O-CB 3.32Å; N42-K45 PolarHBondContact O-N 3.15Å; N42-D46 PolarHBondContact O-N 3.18Å
43	A	94.8	Very high	93.5	Very high	24 Å²	24	98.2 Å²	98.2	20%	0.198	53%	0.534	C	S	.	.	H	α-helix	trans	-50.6	-42.1	-179.4	0	0	0	0	0	112.7	C39 K45 D46 L49	C39-A43 WeakPolarHBondContact O-CA 3.42Å; C39-A43 VanDerWaalsContact O-CB 3.32Å; C39-A43 WeakPolarHBondContact O-CB 3.49Å; C39-A43 PolarHBondContact O-N 3.2Å; A43-K45 PolarHBondContact O-N 3.3Å; A43-D46 PolarHBondContact O-N 2.89Å; A43-D46 VanDerWaalsContact O-N 3.15Å; A43-L49 HydrophobicContact CB-CD2 3.6Å
44	C	90.4	Very high	92.2	Very high	106 Å²	106	98.5 Å²	98.5	72%	0.716	54%	0.536	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.4	-18.5	-179.8	-60.9	0	0	0	0	114.5	N42 L50	N42-C44 PolarHBondContact O-N 2.81Å; N42-C44 VanDerWaalsContact O-N 3.15Å; C44-L50 HydrophobicContact CB-CD1 4.41Å
45	K	90.8	Very high	91	Very high	170 Å²	170	97.6 Å²	97.6	74%	0.739	55%	0.554	S	S	*	*	T	Hydrogen-bonded Turn	trans	-99.5	-7.7	179.8	-57.2	176.8	-171.8	169.5	0	112	N42 A43 A47	N42-K45 WeakPolarHBondContact O-CB 3.32Å; N42-K45 PolarHBondContact O-N 3.15Å; A43-K45 PolarHBondContact O-N 3.3Å; K45-A47 PolarHBondContact O-N 3.28Å
46	D	93.4	Very high	90.2	Very high	74 Å²	74	95.2 Å²	95.2	40%	0.396	55%	0.547	S	S	.	.			trans	-83	104.4	-179.5	-170.8	-19.5	0	0	0	110	N42 A43 L48 L49 L50	N42-D46 PolarHBondContact O-N 3.18Å; A43-D46 PolarHBondContact O-N 2.89Å; A43-D46 VanDerWaalsContact O-N 3.15Å; D46-L48 PolarHBondContact O-N 3.07Å; D46-L48 WeakPolarHBondContact OD1-CB 3.05Å; D46-L48 PolarHBondContact OD1-N 3.07Å; D46-L49 HydrophobicContact CB-CB 3.81Å; D46-L49 PolarHBondContact O-N 3.3Å; D46-L49 PolarHBondContact OD1-N 3.18Å; D46-L50 PolarHBondContact O-N 2.86Å; D46-L50 VanDerWaalsContact O-N 3.07Å
47	A	91.1	Very high	89.7	Confident	46 Å²	46	92 Å²	92	38%	0.38	53%	0.534	S	S	.	.	H	α-helix	trans	-58.6	-27.4	177	0	0	0	0	0	113.6	K45 G51 V52	K45-A47 PolarHBondContact O-N 3.28Å; A47-G51 CarbonylContact O-C 3.35Å; A47-G51 WeakPolarHBondContact O-CA 3.41Å; A47-G51 PolarHBondContact O-N 3.26Å; A47-G51 VanDerWaalsContact O-N 3.07Å; A47-V52 HydrophobicContact CB-CG1 3.4Å; A47-V52 VanDerWaalsContact CB-CG1 3.4Å
48	L	91.6	Very high	89.1	Confident	166 Å²	166	92.1 Å²	92.1	87%	0.869	54%	0.544	S	S	*	.	H	α-helix	trans	-85.3	-26.5	180	-59.5	-179.8	0	0	0	111.8	D46	D46-L48 PolarHBondContact O-N 3.07Å; D46-L48 WeakPolarHBondContact OD1-CB 3.05Å; D46-L48 PolarHBondContact OD1-N 3.07Å
49	L	92.1	Very high	88.5	Confident	111 Å²	111	93.6 Å²	93.6	58%	0.581	55%	0.554	S	S	*	*	H	α-helix	trans	-80.8	-48.4	178	-174	64.2	0	0	0	112.4	A43 D46	A43-L49 HydrophobicContact CB-CD2 3.6Å; D46-L49 HydrophobicContact CB-CB 3.81Å; D46-L49 PolarHBondContact O-N 3.3Å; D46-L49 PolarHBondContact OD1-N 3.18Å
50	L	90.1	Very high	87.7	Confident	120 Å²	120	94.4 Å²	94.4	63%	0.628	55%	0.546	S	S	*	.	H	α-helix	trans	-99.3	-8.6	-177.1	-66.1	-173	0	0	0	114.1	C44 D46	C44-L50 HydrophobicContact CB-CD1 4.41Å; D46-L50 PolarHBondContact O-N 2.86Å; D46-L50 VanDerWaalsContact O-N 3.07Å
51	G	84.8	Confident	86.9	Confident	46 Å²	46	96.2 Å²	96.2	47%	0.474	55%	0.553	S	S	.	*			trans	75.3	164.2	-168.5	0	0	0	0	0	111.9	A47	A47-G51 CarbonylContact O-C 3.35Å; A47-G51 WeakPolarHBondContact O-CA 3.41Å; A47-G51 PolarHBondContact O-N 3.26Å; A47-G51 VanDerWaalsContact O-N 3.07Å
52	V	86.1	Confident	85.9	Confident	62 Å²	62	95.6 Å²	95.6	38%	0.376	56%	0.559	S	S	.	*			trans	-113.6	143.7	173.9	-76.8	0	0	0	0	109.8	A47 N57	A47-V52 HydrophobicContact CB-CG1 3.4Å; A47-V52 VanDerWaalsContact CB-CG1 3.4Å; V52-N57 HydrophobicContact CG2-CB 3.69Å
53	P	81.1	Confident	84.6	Confident	96 Å²	96	102.6 Å²	102.6	62%	0.623	58%	0.581	S	S	*	*			trans	-49.9	144.4	170	-27.3	33.2	0	0	0	111.8	G55 S56 N57	P53-G55 PolarHBondContact O-N 3.01Å; P53-S56 WeakPolarHBondContact CD-OG 3.34Å; P53-S56 PolarHBondContact O-N 3.44Å; P53-S56 PolarHBondContact O-OG 2.95Å; P53-N57 PolarHBondContact O-N 2.93Å
54	A	70.7	Confident	83.3	Confident	55 Å²	55	105.9 Å²	105.9	46%	0.455	60%	0.603	S	S	.	*	T	Hydrogen-bonded Turn	trans	-57.5	-20.8	-176.9	0	0	0	0	0	113.9	R60	A54-R60 WeakPolarHBondContact O-CD 2.82Å; A54-R60 PolarHBondContact O-NE 3.43Å
55	G	73	Confident	82	Confident	81 Å²	81	106.8 Å²	106.8	84%	0.835	61%	0.609	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.1	-20.1	176.2	0	0	0	0	0	114.9	P53	P53-G55 PolarHBondContact O-N 3.01Å
56	S	83.2	Confident	80.8	Confident	70 Å²	70	102.8 Å²	102.8	49%	0.49	61%	0.608	S	S	.	*	T	Hydrogen-bonded Turn	trans	-104.2	-3.5	-174.3	59.4	0	0	0	0	113.6	P53 P58	P53-S56 WeakPolarHBondContact CD-OG 3.34Å; P53-S56 PolarHBondContact O-N 3.44Å; P53-S56 PolarHBondContact O-OG 2.95Å; S56-P58 VanDerWaalsContact O-CD 3.23Å; S56-P58 WeakPolarHBondContact O-CD 3.23Å
57	N	86.7	Confident	79.3	Confident	60 Å²	60	107.4 Å²	107.4	32%	0.321	63%	0.632	S	S	.	*			trans	-78.5	111.1	174.6	-175.3	-5.6	0	0	0	110.3	V52 P53 F59 R60	V52-N57 HydrophobicContact CG2-CB 3.69Å; P53-N57 PolarHBondContact O-N 2.93Å; N57-F59 PolarHBondContact O-N 3.2Å; N57-F59 WeakPolarHBondContact OD1-CB 3.48Å; N57-F59 PolarHBondContact OD1-N 2.95Å; N57-R60 HydrophobicContact CB-CB 4.19Å; N57-R60 WeakPolarHBondContact O-CB 3.36Å; N57-R60 PolarHBondContact O-N 3.23Å
58	P	85.9	Confident	77.9	Confident	112 Å²	112	116.7 Å²	116.7	73%	0.727	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.2	-17.2	-179.4	29.5	-35.5	0	0	0	113.3	S56	S56-P58 VanDerWaalsContact O-CD 3.23Å; S56-P58 WeakPolarHBondContact O-CD 3.23Å
59	F	86.1	Confident	77.2	Confident	185 Å²	185	114.2 Å²	114.2	81%	0.811	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93	4.6	178.7	-57.2	-74.1	0	0	0	113.3	N57 E61	N57-F59 PolarHBondContact O-N 3.2Å; N57-F59 WeakPolarHBondContact OD1-CB 3.48Å; N57-F59 PolarHBondContact OD1-N 2.95Å; F59-E61 PolarHBondContact O-N 3.49Å
60	R	80.6	Confident	76.5	Confident	99 Å²	99	114.4 Å²	114.4	37%	0.374	67%	0.668	S	S	.	*	P	Polyproline II helix	trans	-73.2	131.8	-179.2	-172.6	175.4	-178	-96.7	-18.8	110.8	A54 N57 R63	A54-R60 WeakPolarHBondContact O-CD 2.82Å; A54-R60 PolarHBondContact O-NE 3.43Å; N57-R60 HydrophobicContact CB-CB 4.19Å; N57-R60 WeakPolarHBondContact O-CB 3.36Å; N57-R60 PolarHBondContact O-N 3.23Å; R60-R63 VanDerWaalsContact NH2-CG 3.35Å
61	E	78.7	Confident	75.7	Confident	167 Å²	167	114.1 Å²	114.1	78%	0.78	67%	0.67	S	S	*	*	P	Polyproline II helix	trans	-58.6	135.7	172.4	-71	179.7	173.1	0	0	111.6	F59 R63	F59-E61 PolarHBondContact O-N 3.49Å; E61-R63 PolarHBondContact O-N 3.49Å
62	P	76.2	Confident	75.2	Confident	106 Å²	106	118.1 Å²	118.1	69%	0.688	68%	0.682	S	S	*	*	P	Polyproline II helix	trans	-57.5	134	172.7	-21.3	31.6	0	0	0	110.6	S64	P62-S64 PolarHBondContact O-N 3.49Å; P62-S64 VanDerWaalsContact O-N 3.07Å
63	R	68.8	Low	74.5	Confident	198 Å²	198	121.6 Å²	121.6	75%	0.747	70%	0.701	S	S	*	*	S	Bend	trans	-71.1	1	179.6	-62.3	-168.1	-156.2	-142.6	-2.2	114	R60 E61 C65	R60-R63 VanDerWaalsContact NH2-CG 3.35Å; E61-R63 PolarHBondContact O-N 3.49Å; R63-C65 PolarHBondContact O-N 3.07Å
64	S	67.2	Low	74	Confident	93 Å²	93	123.3 Å²	123.3	65%	0.65	71%	0.706	S	S	*	*			trans	-93.4	102.5	-176	56	0	0	0	0	110.8	P62 A66	P62-S64 PolarHBondContact O-N 3.49Å; P62-S64 VanDerWaalsContact O-N 3.07Å; S64-A66 PolarHBondContact O-N 3.24Å
65	C	64.4	Low	74.3	Confident	125 Å²	125	128.1 Å²	128.1	85%	0.845	72%	0.724	S	S	*	*			trans	-63.8	109.1	144.5	-93.2	0	0	0	0	106.9	R63 L67	R63-C65 PolarHBondContact O-N 3.07Å; C65-L67 PolarHBondContact O-N 3.34Å
66	A	65.3	Low	74.4	Confident	87 Å²	87	131.8 Å²	131.8	72%	0.719	72%	0.716	S	S	*	*			trans	-76.8	104.5	157.1	0	0	0	0	0	106.2	S64 L68	S64-A66 PolarHBondContact O-N 3.24Å; A66-L68 PolarHBondContact O-N 3.23Å
67	L	62	Low	73.7	Confident	170 Å²	170	136.9 Å²	136.9	89%	0.89	74%	0.735	S	S	*	*			trans	-67.4	112.4	161.7	-76.1	165.6	0	0	0	106.2	C65	C65-L67 PolarHBondContact O-N 3.34Å
68	L	62	Low	72.5	Confident	241 Å²	241	143.9 Å²	143.9	100%	1.262	77%	0.772	S	S	*	*			trans	-68.8	0	170.1	-73.4	168.4	0	0	0	110.4	A66	A66-L68 PolarHBondContact O-N 3.23Å

Retrieved 68 of 68 residues in 127.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).