A0A067XJX6_HUMAN Loading...

Unique cartilage matrix-associated protein

May be involved in the negative control of osteogenic differentiation of osteochondrogenic precursor cells in peripheral zones of fetal cartilage and at the cartilage-bone interface.

AlphaFold DB (Q8WVF2), UniProt , Accession A0A067XJX6, Species HUMAN (Homo sapiens, Human), Gene GRP, Length 138 aa.

						>A0A067XJX6_HUMAN|A0A067XJX6|GRP
MTWRQAVLLSCFSAVVLLSMLREGTSVSVGTMQMAGEEASEDAKQKIFMQESDASNFLKRRGKRSPKSRDEVNVENRQKLRVDELRREYYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.3	Low	87	Confident	208 Å²	208	114.6 Å²	114.6	100%	1.025	59%	0.593	S	S	*	*				0	119.5	0	-73.9	-140.9	156.3	0	0	108.3	Q5	M1-Q5 VanDerWaalsContact CA-OE1 3.27Å
2	T	82.8	Confident	87.6	Confident	87 Å²	87	117.8 Å²	117.8	53%	0.534	60%	0.599	S	S	.	*			trans	-83.2	142.3	-176.2	53.3	0	0	0	0	109.2	R4 Q5	T2-R4 PolarHBondContact O-N 3.4Å; T2-Q5 VanDerWaalsContact N-OE1 3.17Å; T2-Q5 WeakPolarHBondContact O-CA 3.49Å; T2-Q5 VanDerWaalsContact O-CB 3.32Å; T2-Q5 WeakPolarHBondContact O-CB 3.3Å; T2-Q5 PolarHBondContact O-N 3.01Å
3	W	84.8	Confident	88	Confident	191 Å²	191	113.3 Å²	113.3	72%	0.723	59%	0.585	S	S	*	*	H	α-helix	trans	-49.3	-30.5	-176.3	77	-76.2	0	0	0	113.9	Q5 A6 V7	W3-Q5 VanDerWaalsContact C-N 3.33Å; W3-Q5 PolarHBondContact O-N 3.3Å; W3-A6 WeakPolarHBondContact O-CB 3.17Å; W3-A6 PolarHBondContact O-N 3.18Å; W3-A6 VanDerWaalsContact O-N 3.11Å; W3-V7 HydrophobicContact CE3-CG2 3.93Å; W3-V7 HydrophobicContact CZ3-CG2 4.14Å; W3-V7 PolarHBondContact O-N 3.22Å
4	R	89.6	Confident	88.4	Confident	175 Å²	175	108.5 Å²	108.5	66%	0.66	57%	0.571	S	S	*	*	H	α-helix	trans	-56.5	-42.4	171.9	-66.3	-175.9	176.3	-174.4	-1	112.7	T2 A6 V7 L8	T2-R4 PolarHBondContact O-N 3.4Å; R4-A6 VanDerWaalsContact C-N 3.34Å; R4-V7 PolarHBondContact O-N 3.46Å; R4-L8 WeakPolarHBondContact O-CB 3.4Å; R4-L8 VanDerWaalsContact O-CG 3.24Å; R4-L8 WeakPolarHBondContact O-CG 3.42Å; R4-L8 PolarHBondContact O-N 2.96Å
5	Q	88.4	Confident	88.7	Confident	89 Å²	89	107.7 Å²	107.7	42%	0.416	57%	0.572	S	S	.	*	H	α-helix	trans	-64.4	-38.4	175.3	-65.7	175.7	-37.6	0	0	111.3	M1 T2 W3 L8 L9	M1-Q5 VanDerWaalsContact CA-OE1 3.27Å; T2-Q5 VanDerWaalsContact N-OE1 3.17Å; T2-Q5 WeakPolarHBondContact O-CA 3.49Å; T2-Q5 VanDerWaalsContact O-CB 3.32Å; T2-Q5 WeakPolarHBondContact O-CB 3.3Å; T2-Q5 PolarHBondContact O-N 3.01Å; W3-Q5 VanDerWaalsContact C-N 3.33Å; W3-Q5 PolarHBondContact O-N 3.3Å; Q5-L8 PolarHBondContact O-N 3.24Å; Q5-L9 VanDerWaalsContact O-CB 3.31Å; Q5-L9 WeakPolarHBondContact O-CB 3.47Å; Q5-L9 WeakPolarHBondContact O-CD1 3.46Å; Q5-L9 WeakPolarHBondContact O-CG 3.38Å; Q5-L9 PolarHBondContact O-N 3.33Å
6	A	89	Confident	88.9	Confident	63 Å²	63	104.8 Å²	104.8	52%	0.521	56%	0.559	S	S	.	*	H	α-helix	trans	-65.5	-43.9	177.3	0	0	0	0	0	112	W3 R4 L9 S10	W3-A6 WeakPolarHBondContact O-CB 3.17Å; W3-A6 PolarHBondContact O-N 3.18Å; W3-A6 VanDerWaalsContact O-N 3.11Å; R4-A6 VanDerWaalsContact C-N 3.34Å; A6-L9 PolarHBondContact O-N 2.91Å; A6-S10 WeakPolarHBondContact O-CB 3.27Å; A6-S10 PolarHBondContact O-N 3.37Å
7	V	92.2	Very high	88.9	Confident	72 Å²	72	105.2 Å²	105.2	44%	0.436	56%	0.56	S	S	.	*	H	α-helix	trans	-64.1	-45.3	175.5	176.2	0	0	0	0	111	W3 R4 L9 S10 C11	W3-V7 HydrophobicContact CE3-CG2 3.93Å; W3-V7 HydrophobicContact CZ3-CG2 4.14Å; W3-V7 PolarHBondContact O-N 3.22Å; R4-V7 PolarHBondContact O-N 3.46Å; V7-L9 PolarHBondContact O-N 3.25Å; V7-S10 PolarHBondContact O-N 2.71Å; V7-C11 PolarHBondContact O-N 3.08Å; V7-C11 PolarHBondContact O-SG 3.36Å; V7-C11 VanDerWaalsContact O-SG 3.35Å
8	L	92.3	Very high	88.9	Confident	121 Å²	121	105.8 Å²	105.8	63%	0.634	56%	0.563	S	S	*	*	H	α-helix	trans	-62.1	-43.4	178.1	-72.6	171.9	0	0	0	112	R4 Q5 C11 F12	R4-L8 WeakPolarHBondContact O-CB 3.4Å; R4-L8 VanDerWaalsContact O-CG 3.24Å; R4-L8 WeakPolarHBondContact O-CG 3.42Å; R4-L8 PolarHBondContact O-N 2.96Å; Q5-L8 PolarHBondContact O-N 3.24Å; L8-C11 PolarHBondContact O-N 3.32Å; L8-F12 WeakPolarHBondContact O-CB 3.34Å; L8-F12 PolarHBondContact O-N 2.89Å
9	L	93.3	Very high	88.6	Confident	109 Å²	109	102.5 Å²	102.5	57%	0.571	55%	0.549	S	S	*	.	H	α-helix	trans	-62.7	-41.7	175.5	-75.8	166.8	0	0	0	111.7	Q5 A6 V7 F12 S13	Q5-L9 VanDerWaalsContact O-CB 3.31Å; Q5-L9 WeakPolarHBondContact O-CB 3.47Å; Q5-L9 WeakPolarHBondContact O-CD1 3.46Å; Q5-L9 WeakPolarHBondContact O-CG 3.38Å; Q5-L9 PolarHBondContact O-N 3.33Å; A6-L9 PolarHBondContact O-N 2.91Å; V7-L9 PolarHBondContact O-N 3.25Å; L9-F12 PolarHBondContact O-N 3.41Å; L9-S13 PolarHBondContact O-N 3.26Å; L9-S13 PolarHBondContact O-OG 3.42Å
10	S	93.2	Very high	88.3	Confident	74 Å²	74	103 Å²	103	52%	0.517	55%	0.55	S	S	.	.	H	α-helix	trans	-62.8	-44.4	176	-177.4	0	0	0	0	112.3	A6 V7 F12 S13 A14	A6-S10 WeakPolarHBondContact O-CB 3.27Å; A6-S10 PolarHBondContact O-N 3.37Å; V7-S10 PolarHBondContact O-N 2.71Å; S10-F12 VanDerWaalsContact C-N 3.34Å; S10-S13 WeakPolarHBondContact CA-OG 3.43Å; S10-S13 PolarHBondContact O-N 3.1Å; S10-S13 PolarHBondContact O-OG 3.13Å; S10-A14 WeakPolarHBondContact O-CB 3.1Å; S10-A14 PolarHBondContact O-N 3.37Å
11	C	92.4	Very high	87.9	Confident	72 Å²	72	103.2 Å²	103.2	49%	0.486	55%	0.55	S	S	.	*	H	α-helix	trans	-63.8	-42.3	175.6	-69	0	0	0	0	111	V7 L8 A14 V15	V7-C11 PolarHBondContact O-N 3.08Å; V7-C11 PolarHBondContact O-SG 3.36Å; V7-C11 VanDerWaalsContact O-SG 3.35Å; L8-C11 PolarHBondContact O-N 3.32Å; C11-A14 PolarHBondContact O-N 3.33Å; C11-V15 WeakPolarHBondContact O-CG2 3.42Å; C11-V15 PolarHBondContact O-N 3.29Å
12	F	93.5	Very high	88.7	Confident	152 Å²	152	102.6 Å²	102.6	67%	0.667	54%	0.536	S	S	*	.	H	α-helix	trans	-62.9	-44	178.1	-151.8	-89	0	0	0	111.3	L8 L9 S10 A14 V15 V16	L8-F12 WeakPolarHBondContact O-CB 3.34Å; L8-F12 PolarHBondContact O-N 2.89Å; L9-F12 PolarHBondContact O-N 3.41Å; S10-F12 VanDerWaalsContact C-N 3.34Å; F12-A14 VanDerWaalsContact C-N 3.34Å; F12-A14 PolarHBondContact O-N 3.13Å; F12-V15 PolarHBondContact O-N 3.42Å; F12-V16 HydrophobicContact CD1-CG2 4.08Å; F12-V16 HydrophobicContact CE1-CG2 4.16Å; F12-V16 WeakPolarHBondContact O-CG2 3.43Å; F12-V16 PolarHBondContact O-N 2.9Å
13	S	93.2	Very high	88	Confident	60 Å²	60	104.2 Å²	104.2	42%	0.42	54%	0.538	S	S	.	.	H	α-helix	trans	-63.6	-37.6	175	59.7	0	0	0	0	112.6	L9 S10 V16 L17	L9-S13 PolarHBondContact O-N 3.26Å; L9-S13 PolarHBondContact O-OG 3.42Å; S10-S13 WeakPolarHBondContact CA-OG 3.43Å; S10-S13 PolarHBondContact O-N 3.1Å; S10-S13 PolarHBondContact O-OG 3.13Å; S13-V16 PolarHBondContact O-N 3.28Å; S13-L17 WeakPolarHBondContact O-CB 3.4Å; S13-L17 VanDerWaalsContact O-CG 3.31Å; S13-L17 WeakPolarHBondContact O-CG 3.42Å; S13-L17 PolarHBondContact O-N 3.44Å
14	A	93.5	Very high	86.9	Confident	46 Å²	46	97.5 Å²	97.5	38%	0.38	53%	0.528	S	S	.	.	H	α-helix	trans	-65.2	-41.7	176.5	0	0	0	0	0	111.7	S10 C11 F12 L17 L18	S10-A14 WeakPolarHBondContact O-CB 3.1Å; S10-A14 PolarHBondContact O-N 3.37Å; C11-A14 PolarHBondContact O-N 3.33Å; F12-A14 VanDerWaalsContact C-N 3.34Å; F12-A14 PolarHBondContact O-N 3.13Å; A14-L17 PolarHBondContact O-N 3.39Å; A14-L18 WeakPolarHBondContact O-CB 3.3Å; A14-L18 VanDerWaalsContact O-CG 3.25Å; A14-L18 WeakPolarHBondContact O-CG 3.49Å; A14-L18 PolarHBondContact O-N 2.74Å
15	V	92.9	Very high	85.2	Confident	97 Å²	97	94.4 Å²	94.4	59%	0.588	53%	0.529	S	S	*	.	H	α-helix	trans	-64	-43.2	175.5	173.7	0	0	0	0	111	C11 F12 L18 S19	C11-V15 WeakPolarHBondContact O-CG2 3.42Å; C11-V15 PolarHBondContact O-N 3.29Å; F12-V15 PolarHBondContact O-N 3.42Å; V15-L18 PolarHBondContact O-N 3.01Å; V15-S19 PolarHBondContact O-N 3.46Å; V15-S19 PolarHBondContact O-OG 3.15Å; V15-S19 VanDerWaalsContact O-OG 3.1Å
16	V	91.7	Very high	83.3	Confident	61 Å²	61	93.8 Å²	93.8	37%	0.37	53%	0.534	S	S	.	.	H	α-helix	trans	-62.5	-43.6	176.3	172.3	0	0	0	0	111.4	F12 S13 L18 S19 M20	F12-V16 HydrophobicContact CD1-CG2 4.08Å; F12-V16 HydrophobicContact CE1-CG2 4.16Å; F12-V16 WeakPolarHBondContact O-CG2 3.43Å; F12-V16 PolarHBondContact O-N 2.9Å; S13-V16 PolarHBondContact O-N 3.28Å; V16-L18 VanDerWaalsContact C-N 3.34Å; V16-L18 PolarHBondContact O-N 3.15Å; V16-S19 VanDerWaalsContact CA-OG 3.31Å; V16-S19 WeakPolarHBondContact CA-OG 3.44Å; V16-S19 PolarHBondContact O-N 3.49Å; V16-S19 PolarHBondContact O-OG 3.41Å; V16-M20 HydrophobicContact CG1-CE 4.49Å; V16-M20 HydrophobicContact CG1-CG 4.41Å; V16-M20 WeakPolarHBondContact O-CG 3.18Å; V16-M20 PolarHBondContact O-N 3.08Å
17	L	89.2	Confident	81.3	Confident	111 Å²	111	96.4 Å²	96.4	58%	0.581	54%	0.543	S	S	*	.	H	α-helix	trans	-61.3	-43.6	174.9	-74.9	171.6	0	0	0	111.3	S13 A14 M20 L21	S13-L17 WeakPolarHBondContact O-CB 3.4Å; S13-L17 VanDerWaalsContact O-CG 3.31Å; S13-L17 WeakPolarHBondContact O-CG 3.42Å; S13-L17 PolarHBondContact O-N 3.44Å; A14-L17 PolarHBondContact O-N 3.39Å; L17-M20 PolarHBondContact O-N 3.29Å; L17-L21 WeakPolarHBondContact O-CB 3.32Å; L17-L21 WeakPolarHBondContact O-CD1 3.46Å; L17-L21 PolarHBondContact O-N 3.41Å
18	L	88.2	Confident	78.7	Confident	116 Å²	116	97.3 Å²	97.3	61%	0.607	55%	0.553	S	S	*	*	H	α-helix	trans	-66.3	-36.1	177.8	-72.2	171.1	0	0	0	112.7	A14 V15 V16 R22	A14-L18 WeakPolarHBondContact O-CB 3.3Å; A14-L18 VanDerWaalsContact O-CG 3.25Å; A14-L18 WeakPolarHBondContact O-CG 3.49Å; A14-L18 PolarHBondContact O-N 2.74Å; V15-L18 PolarHBondContact O-N 3.01Å; V16-L18 VanDerWaalsContact C-N 3.34Å; V16-L18 PolarHBondContact O-N 3.15Å; L18-R22 VanDerWaalsContact O-CB 3.28Å; L18-R22 WeakPolarHBondContact O-CB 3.37Å; L18-R22 PolarHBondContact O-N 3.06Å
19	S	83.4	Confident	76.3	Confident	43 Å²	43	98 Å²	98	30%	0.301	56%	0.562	S	S	.	*	H	α-helix	trans	-69	-40.8	173.7	48.6	0	0	0	0	111.9	V15 V16 R22 E23	V15-S19 PolarHBondContact O-N 3.46Å; V15-S19 PolarHBondContact O-OG 3.15Å; V15-S19 VanDerWaalsContact O-OG 3.1Å; V16-S19 VanDerWaalsContact CA-OG 3.31Å; V16-S19 WeakPolarHBondContact CA-OG 3.44Å; V16-S19 PolarHBondContact O-N 3.49Å; V16-S19 PolarHBondContact O-OG 3.41Å; S19-R22 PolarHBondContact O-N 3.26Å; S19-E23 WeakPolarHBondContact O-CB 3.47Å; S19-E23 WeakPolarHBondContact O-CG 3.39Å; S19-E23 PolarHBondContact O-N 3.2Å
20	M	83.1	Confident	73.9	Confident	113 Å²	113	95.4 Å²	95.4	56%	0.557	56%	0.562	S	S	*	*	H	α-helix	trans	-66	-39.2	174.9	-65.5	-68.4	158.7	0	0	111.7	V16 L17 E23 G24	V16-M20 HydrophobicContact CG1-CE 4.49Å; V16-M20 HydrophobicContact CG1-CG 4.41Å; V16-M20 WeakPolarHBondContact O-CG 3.18Å; V16-M20 PolarHBondContact O-N 3.08Å; L17-M20 PolarHBondContact O-N 3.29Å; M20-E23 PolarHBondContact O-N 2.84Å; M20-G24 PolarHBondContact O-N 3.11Å
21	L	79.4	Confident	71.6	Confident	108 Å²	108	97.5 Å²	97.5	57%	0.565	57%	0.572	S	S	*	*	H	α-helix	trans	-63.6	-42.1	171.6	-92.1	144.8	0	0	0	110.9	L17 G24 T25	L17-L21 WeakPolarHBondContact O-CB 3.32Å; L17-L21 WeakPolarHBondContact O-CD1 3.46Å; L17-L21 PolarHBondContact O-N 3.41Å; L21-G24 CarbonylContact O-C 3.3Å; L21-G24 PolarHBondContact O-N 3.2Å; L21-T25 WeakPolarHBondContact O-CB 3.44Å; L21-T25 WeakPolarHBondContact O-CG2 3.37Å; L21-T25 PolarHBondContact O-N 3.44Å; L21-T25 PolarHBondContact O-OG1 3.46Å
22	R	76.6	Confident	69.2	Low	194 Å²	194	102.9 Å²	102.9	73%	0.732	59%	0.592	S	S	*	*	H	α-helix	trans	-63.2	-44.5	176.8	-173.1	174	176.3	-170.7	-2.4	111.5	L18 S19 T25 S26	L18-R22 VanDerWaalsContact O-CB 3.28Å; L18-R22 WeakPolarHBondContact O-CB 3.37Å; L18-R22 PolarHBondContact O-N 3.06Å; S19-R22 PolarHBondContact O-N 3.26Å; R22-T25 VanDerWaalsContact CA-OG1 3.28Å; R22-T25 WeakPolarHBondContact CA-OG1 3.28Å; R22-T25 CarbonylContact O-C 3.6Å; R22-T25 PolarHBondContact O-N 3.36Å; R22-T25 PolarHBondContact O-OG1 3.35Å; R22-S26 PolarHBondContact O-N 2.92Å; R22-S26 PolarHBondContact O-OG 3.01Å
23	E	67.7	Low	66.5	Low	122 Å²	122	102.8 Å²	102.8	57%	0.57	59%	0.594	S	S	*	*	H	α-helix	trans	-66.1	-39.6	176.3	-72.4	172.6	-158.7	0	0	112	S19 M20 S26	S19-E23 WeakPolarHBondContact O-CB 3.47Å; S19-E23 WeakPolarHBondContact O-CG 3.39Å; S19-E23 PolarHBondContact O-N 3.2Å; M20-E23 PolarHBondContact O-N 2.84Å; E23-S26 WeakPolarHBondContact CA-OG 3.47Å; E23-S26 CarbonylContact O-C 3.52Å; E23-S26 VanDerWaalsContact O-C 3.3Å; E23-S26 WeakPolarHBondContact O-CA 3.49Å; E23-S26 PolarHBondContact O-N 3.4Å; E23-S26 VanDerWaalsContact O-N 3.13Å; E23-S26 PolarHBondContact O-OG 2.63Å
24	G	61.3	Low	63.8	Low	50 Å²	50	107.8 Å²	107.8	52%	0.515	61%	0.612	S	S	.	*	H	α-helix	trans	-69.9	-28.6	173.1	0	0	0	0	0	113.7	M20 L21 S26 V27	M20-G24 PolarHBondContact O-N 3.11Å; L21-G24 CarbonylContact O-C 3.3Å; L21-G24 PolarHBondContact O-N 3.2Å; G24-S26 VanDerWaalsContact C-N 3.3Å; G24-V27 PolarHBondContact O-N 3.04Å
25	T	55	Low	61.4	Low	109 Å²	109	110.9 Å²	110.9	67%	0.669	64%	0.638	S	S	*	*	H	α-helix	trans	-81.6	-11.7	170.4	61	0	0	0	0	112.4	L21 R22 V27	L21-T25 WeakPolarHBondContact O-CB 3.44Å; L21-T25 WeakPolarHBondContact O-CG2 3.37Å; L21-T25 PolarHBondContact O-N 3.44Å; L21-T25 PolarHBondContact O-OG1 3.46Å; R22-T25 VanDerWaalsContact CA-OG1 3.28Å; R22-T25 WeakPolarHBondContact CA-OG1 3.28Å; R22-T25 CarbonylContact O-C 3.6Å; R22-T25 PolarHBondContact O-N 3.36Å; R22-T25 PolarHBondContact O-OG1 3.35Å; T25-V27 VanDerWaalsContact C-N 3.29Å
26	S	48.9	Very low	58.9	Low	76 Å²	76	109 Å²	109	53%	0.531	64%	0.638	S	S	.	*	T	Hydrogen-bonded Turn	trans	-95.5	43.8	163.2	64.9	0	0	0	0	111.7	R22 E23 G24 S28	R22-S26 PolarHBondContact O-N 2.92Å; R22-S26 PolarHBondContact O-OG 3.01Å; E23-S26 WeakPolarHBondContact CA-OG 3.47Å; E23-S26 CarbonylContact O-C 3.52Å; E23-S26 VanDerWaalsContact O-C 3.3Å; E23-S26 WeakPolarHBondContact O-CA 3.49Å; E23-S26 PolarHBondContact O-N 3.4Å; E23-S26 VanDerWaalsContact O-N 3.13Å; E23-S26 PolarHBondContact O-OG 2.63Å; G24-S26 VanDerWaalsContact C-N 3.3Å; S26-S28 PolarHBondContact O-N 3.36Å
27	V	46.4	Very low	56.8	Low	118 Å²	118	114.2 Å²	114.2	72%	0.715	66%	0.658	S	S	*	*			trans	-71	77.1	139.7	176	0	0	0	0	104.7	G24 T25 V29	G24-V27 PolarHBondContact O-N 3.04Å; T25-V27 VanDerWaalsContact C-N 3.29Å; V27-V29 PolarHBondContact O-N 2.53Å
28	S	37	Very low	54.7	Low	91 Å²	91	117.2 Å²	117.2	64%	0.636	67%	0.669	S	S	*	*				47.9	78.3	97	-166.8	0	0	0	0	108.4	S26 G30	S26-S28 PolarHBondContact O-N 3.36Å; S28-G30 PolarHBondContact O-N 3.17Å
29	V	43.4	Very low	53.1	Low	136 Å²	136	115.5 Å²	115.5	82%	0.824	67%	0.671	S	S	*	*			trans	-50.9	101	150.2	176.3	0	0	0	0	103.8	V27 T31	V27-V29 PolarHBondContact O-N 2.53Å; V29-T31 PolarHBondContact O-N 3.25Å
30	G	41.6	Very low	51.7	Low	55 Å²	55	116.2 Å²	116.2	57%	0.567	68%	0.676	S	S	*	*			trans	-49.2	121.3	178.4	0	0	0	0	0	107.2	S28 M32	S28-G30 PolarHBondContact O-N 3.17Å; G30-M32 PolarHBondContact O-N 3.4Å
31	T	45.3	Very low	50.5	Low	118 Å²	118	117.2 Å²	117.2	72%	0.724	68%	0.68	S	S	*	*			trans	-63.5	71.7	166	-48.8	0	0	0	0	107.4	V29 Q33	V29-T31 PolarHBondContact O-N 3.25Å; T31-Q33 HydrophobicContact CG2-CG 3.91Å; T31-Q33 PolarHBondContact O-N 3.18Å
32	M	41.1	Very low	49.7	Very low	185 Å²	185	117.5 Å²	117.5	91%	0.911	68%	0.682	S	S	*	*			trans	-82.4	78.8	152.9	-128.3	-169.9	-132.6	0	0	104.9	G30 M34	G30-M32 PolarHBondContact O-N 3.4Å; M32-M34 PolarHBondContact O-N 3Å; M32-M34 VanDerWaalsContact O-N 3.11Å
33	Q	38.6	Very low	49.1	Very low	150 Å²	150	111.1 Å²	111.1	70%	0.701	67%	0.671	S	S	*	*			trans	-51.4	114	144.5	-76.7	171.7	-17.8	0	0	105.8	T31	T31-Q33 HydrophobicContact CG2-CG 3.91Å; T31-Q33 PolarHBondContact O-N 3.18Å
34	M	35.4	Very low	48.8	Very low	164 Å²	164	111.5 Å²	111.5	81%	0.808	67%	0.67	S	S	*	*	S	Bend		158.9	125.7	125.2	-78.2	-53.3	167.5	0	0	109.1	M32	M32-M34 PolarHBondContact O-N 3Å; M32-M34 VanDerWaalsContact O-N 3.11Å
35	A	43	Very low	48.9	Very low	112 Å²	112	115.4 Å²	115.4	93%	0.926	68%	0.675	S	S	*	*	S	Bend	trans	73.8	90.9	161.2	0	0	0	0	0	117.5
36	G	40.4	Very low	49.6	Very low	56 Å²	56	119.2 Å²	119.2	58%	0.577	68%	0.682	S	S	*	*			trans	143.4	60.1	154.3	0	0	0	0	0	114.5	E38 A39	G36-E38 PolarHBondContact O-N 2.87Å; G36-A39 PolarHBondContact O-N 2.71Å
37	E	46.9	Very low	50.9	Low	172 Å²	172	122 Å²	122	80%	0.804	69%	0.69	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.2	-9.1	178.7	-158	151.8	160.5	0	0	113.8
38	E	47	Very low	52.5	Low	174 Å²	174	123.7 Å²	123.7	81%	0.813	69%	0.688	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83	-22.2	-178.4	-58.2	-67.2	150.8	0	0	114.7	G36	G36-E38 PolarHBondContact O-N 2.87Å
39	A	54.4	Low	54.7	Low	79 Å²	79	124.4 Å²	124.4	65%	0.653	68%	0.683	S	S	*	*	H	α-helix	trans	-88.7	-17.6	-173.3	0	0	0	0	0	114.3	G36	G36-A39 PolarHBondContact O-N 2.71Å
40	S	52.5	Low	56.6	Low	58 Å²	58	124.2 Å²	124.2	41%	0.406	67%	0.673	S	S	.	*	H	α-helix	trans	-85.6	-22.5	-176.1	81.7	0	0	0	0	113.5	K44	S40-K44 WeakPolarHBondContact O-CG 3.35Å; S40-K44 PolarHBondContact O-N 2.85Å
41	E	58.3	Low	58.6	Low	134 Å²	134	129.7 Å²	129.7	63%	0.626	68%	0.684	S	S	*	*	H	α-helix	trans	-70.7	-39.6	179	-62.8	-136.3	140.8	0	0	111.7	K44 Q45	E41-K44 PolarHBondContact O-N 3.4Å; E41-Q45 PolarHBondContact O-N 2.93Å
42	D	63.2	Low	60.3	Low	114 Å²	114	126.5 Å²	126.5	61%	0.61	67%	0.666	S	S	*	*	H	α-helix	trans	-69.5	-38	-178	-152.4	25.7	0	0	0	111.9	Q45 K46	D42-Q45 PolarHBondContact O-N 3.36Å; D42-K46 PolarHBondContact O-N 3.3Å; D42-K46 VanDerWaalsContact O-N 3.08Å
43	A	63.6	Low	62.3	Low	60 Å²	60	121.9 Å²	121.9	50%	0.496	65%	0.645	S	S	.	*	H	α-helix	trans	-68	-36.6	172.9	0	0	0	0	0	112.5	K46 I47	A43-K46 PolarHBondContact O-N 3.07Å; A43-I47 PolarHBondContact O-N 3.46Å
44	K	61	Low	64.3	Low	130 Å²	130	116.5 Å²	116.5	57%	0.565	63%	0.626	S	S	*	*	H	α-helix	trans	-67.6	-42.3	172.9	-78.3	174.3	-178	171.3	0	111.3	S40 E41 K46 I47 F48	S40-K44 WeakPolarHBondContact O-CG 3.35Å; S40-K44 PolarHBondContact O-N 2.85Å; E41-K44 PolarHBondContact O-N 3.4Å; K44-K46 PolarHBondContact O-N 3.46Å; K44-I47 PolarHBondContact O-N 2.83Å; K44-I47 VanDerWaalsContact O-N 3.15Å; K44-F48 VanDerWaalsContact O-CD2 3.27Å; K44-F48 WeakPolarHBondContact O-CD2 3.12Å; K44-F48 PolarHBondContact O-N 3.32Å
45	Q	64.3	Low	66.5	Low	133 Å²	133	111.1 Å²	111.1	62%	0.621	61%	0.605	S	S	*	*	H	α-helix	trans	-59.6	-31.7	174.4	-85.6	-176.1	3.4	0	0	112.7	E41 D42 F48	E41-Q45 PolarHBondContact O-N 2.93Å; D42-Q45 PolarHBondContact O-N 3.36Å; Q45-F48 CarbonylContact O-C 3.59Å
46	K	68.4	Low	68.2	Low	188 Å²	188	109.9 Å²	109.9	82%	0.817	58%	0.583	S	S	*	*	H	α-helix	trans	-71.1	-28.7	177.2	-162.8	170.8	-176.2	177.8	0	114	D42 A43 K44	D42-K46 PolarHBondContact O-N 3.3Å; D42-K46 VanDerWaalsContact O-N 3.08Å; A43-K46 PolarHBondContact O-N 3.07Å; K44-K46 PolarHBondContact O-N 3.46Å
47	I	76.8	Confident	70	Confident	135 Å²	135	112.2 Å²	112.2	69%	0.692	58%	0.577	S	S	*	*	H	α-helix	trans	-80.9	-38.9	175.8	-60.2	170.5	0	0	0	110.2	A43 K44	A43-I47 PolarHBondContact O-N 3.46Å; K44-I47 PolarHBondContact O-N 2.83Å; K44-I47 VanDerWaalsContact O-N 3.15Å
48	F	80.3	Confident	71.3	Confident	153 Å²	153	110.1 Å²	110.1	67%	0.671	57%	0.571	S	S	*	*	S	Bend	trans	-98.4	96.4	-178.2	-64.2	-72.7	0	0	0	111.1	K44 Q45 Q50	K44-F48 VanDerWaalsContact O-CD2 3.27Å; K44-F48 WeakPolarHBondContact O-CD2 3.12Å; K44-F48 PolarHBondContact O-N 3.32Å; Q45-F48 CarbonylContact O-C 3.59Å; F48-Q50 PolarHBondContact O-N 2.99Å
49	M	82.8	Confident	72.6	Confident	107 Å²	107	108.5 Å²	108.5	53%	0.527	56%	0.561	S	S	.	*			trans	-56.2	135.1	170.2	178.7	170.4	50.9	0	0	110.7	D53 A54	M49-D53 HydrophobicContact CG-CB 3.81Å; M49-D53 HydrophobicContact SD-CB 4.12Å; M49-A54 HydrophobicContact CE-CB 3.69Å; M49-A54 HydrophobicContact CG-CB 4.37Å; M49-A54 HydrophobicContact SD-CB 4.5Å
50	Q	84.5	Confident	73.3	Confident	131 Å²	131	115.2 Å²	115.2	61%	0.612	57%	0.57	S	S	*	*			trans	-56.3	140.2	178.4	-164.5	174.2	40	0	0	111.2	F48 S52 D53 A54	F48-Q50 PolarHBondContact O-N 2.99Å; Q50-S52 WeakPolarHBondContact CG-OG 3.33Å; Q50-S52 PolarHBondContact O-N 3.16Å; Q50-S52 VanDerWaalsContact O-N 3.15Å; Q50-S52 PolarHBondContact OE1-OG 3.06Å; Q50-D53 PolarHBondContact O-N 3.03Å; Q50-A54 PolarHBondContact O-N 2.85Å
51	E	81.9	Confident	74	Confident	171 Å²	171	120.9 Å²	120.9	80%	0.799	58%	0.582	S	S	*	*	H	α-helix	trans	-57.3	-34.6	-173.7	67.4	171.2	-165.1	0	0	113.4	A54 S55	E51-A54 PolarHBondContact O-N 2.98Å; E51-S55 WeakPolarHBondContact O-CB 3.32Å; E51-S55 PolarHBondContact O-N 3.21Å
52	S	81.7	Confident	74.5	Confident	50 Å²	50	117.7 Å²	117.7	35%	0.35	59%	0.585	S	S	.	*	H	α-helix	trans	-62	-45.3	176.5	44.3	0	0	0	0	111.2	Q50 S55 N56	Q50-S52 WeakPolarHBondContact CG-OG 3.33Å; Q50-S52 PolarHBondContact O-N 3.16Å; Q50-S52 VanDerWaalsContact O-N 3.15Å; Q50-S52 PolarHBondContact OE1-OG 3.06Å; S52-S55 PolarHBondContact O-N 3.45Å; S52-S55 PolarHBondContact O-OG 3.44Å; S52-N56 PolarHBondContact O-N 2.95Å; S52-N56 PolarHBondContact O-ND2 3.47Å; S52-N56 VanDerWaalsContact O-ND2 3.13Å
53	D	82.5	Confident	74.9	Confident	88 Å²	88	121.6 Å²	121.6	47%	0.471	60%	0.597	S	S	.	*	H	α-helix	trans	-71.5	-40.5	178.5	-72	-11.1	0	0	0	111.5	M49 Q50 S55 N56 F57	M49-D53 HydrophobicContact CG-CB 3.81Å; M49-D53 HydrophobicContact SD-CB 4.12Å; Q50-D53 PolarHBondContact O-N 3.03Å; D53-S55 VanDerWaalsContact C-N 3.29Å; D53-S55 PolarHBondContact O-N 3.43Å; D53-N56 PolarHBondContact O-N 3.15Å; D53-N56 VanDerWaalsContact O-N 3.13Å; D53-F57 PolarHBondContact O-N 3.37Å; D53-F57 VanDerWaalsContact O-N 3.1Å
54	A	81.5	Confident	75.4	Confident	37 Å²	37	128.5 Å²	128.5	31%	0.306	61%	0.61	S	S	.	*	H	α-helix	trans	-59.7	-40.2	173.4	0	0	0	0	0	111.9	M49 Q50 E51 N56 F57	M49-A54 HydrophobicContact CE-CB 3.69Å; M49-A54 HydrophobicContact CG-CB 4.37Å; M49-A54 HydrophobicContact SD-CB 4.5Å; Q50-A54 PolarHBondContact O-N 2.85Å; E51-A54 PolarHBondContact O-N 2.98Å; A54-N56 VanDerWaalsContact C-N 3.25Å; A54-N56 PolarHBondContact O-N 3.4Å; A54-F57 WeakPolarHBondContact O-CB 3.45Å; A54-F57 PolarHBondContact O-N 2.8Å
55	S	80.9	Confident	76.3	Confident	52 Å²	52	126.4 Å²	126.4	36%	0.364	61%	0.612	S	S	.	*	H	α-helix	trans	-63.3	-32.6	177.7	86.2	0	0	0	0	112.4	E51 S52 D53 K59	E51-S55 WeakPolarHBondContact O-CB 3.32Å; E51-S55 PolarHBondContact O-N 3.21Å; S52-S55 PolarHBondContact O-N 3.45Å; S52-S55 PolarHBondContact O-OG 3.44Å; D53-S55 VanDerWaalsContact C-N 3.29Å; D53-S55 PolarHBondContact O-N 3.43Å; S55-K59 WeakPolarHBondContact O-CD 3.32Å; S55-K59 VanDerWaalsContact O-CG 3.3Å; S55-K59 WeakPolarHBondContact O-CG 3.28Å
56	N	79.4	Confident	77.2	Confident	86 Å²	86	125.9 Å²	125.9	46%	0.46	62%	0.62	S	S	.	*	H	α-helix	trans	-81.2	-25	179.9	-71.5	-40.1	0	0	0	112.8	S52 D53 A54 L58 K59 R60	S52-N56 PolarHBondContact O-N 2.95Å; S52-N56 PolarHBondContact O-ND2 3.47Å; S52-N56 VanDerWaalsContact O-ND2 3.13Å; D53-N56 PolarHBondContact O-N 3.15Å; D53-N56 VanDerWaalsContact O-N 3.13Å; A54-N56 VanDerWaalsContact C-N 3.25Å; A54-N56 PolarHBondContact O-N 3.4Å; N56-L58 PolarHBondContact O-N 2.75Å; N56-K59 PolarHBondContact O-N 3.29Å; N56-R60 WeakPolarHBondContact O-CB 3.42Å; N56-R60 PolarHBondContact O-N 2.82Å
57	F	78.4	Confident	78	Confident	104 Å²	104	120.8 Å²	120.8	46%	0.456	60%	0.598	S	S	.	*	H	α-helix	trans	-58.1	-46.3	179.3	-175.6	-100.1	0	0	0	112.4	D53 A54	D53-F57 PolarHBondContact O-N 3.37Å; D53-F57 VanDerWaalsContact O-N 3.1Å; A54-F57 WeakPolarHBondContact O-CB 3.45Å; A54-F57 PolarHBondContact O-N 2.8Å
58	L	73	Confident	78.7	Confident	128 Å²	128	116.7 Å²	116.7	67%	0.67	58%	0.581	S	S	*	*	H	α-helix	trans	-74.9	-37.4	177.1	-63.4	178.7	0	0	0	112	N56 R60 R61 G62	N56-L58 PolarHBondContact O-N 2.75Å; L58-R60 VanDerWaalsContact C-N 3.33Å; L58-R60 PolarHBondContact O-N 2.92Å; L58-R61 PolarHBondContact O-N 3.13Å; L58-G62 PolarHBondContact O-N 2.8Å
59	K	75.1	Confident	79.4	Confident	140 Å²	140	119.1 Å²	119.1	61%	0.609	59%	0.586	S	S	*	*	H	α-helix	trans	-60.8	-41.1	177.2	-71.2	172.2	-174	167	0	112.1	S55 N56 R61 G62	S55-K59 WeakPolarHBondContact O-CD 3.32Å; S55-K59 VanDerWaalsContact O-CG 3.3Å; S55-K59 WeakPolarHBondContact O-CG 3.28Å; N56-K59 PolarHBondContact O-N 3.29Å; K59-R61 VanDerWaalsContact C-N 3.28Å; K59-R61 PolarHBondContact O-N 3.37Å; K59-G62 PolarHBondContact O-N 2.98Å
60	R	69.7	Low	79.9	Confident	221 Å²	221	119.7 Å²	119.7	83%	0.834	59%	0.591	S	S	*	*	H	α-helix	trans	-64.7	-32.5	178.4	-167.3	173.4	-178.9	176.3	0.3	112.1	N56 L58 G62	N56-R60 WeakPolarHBondContact O-CB 3.42Å; N56-R60 PolarHBondContact O-N 2.82Å; L58-R60 VanDerWaalsContact C-N 3.33Å; L58-R60 PolarHBondContact O-N 2.92Å; R60-G62 VanDerWaalsContact C-N 3.35Å
61	R	66.9	Low	80.4	Confident	176 Å²	176	117.4 Å²	117.4	66%	0.664	58%	0.58	S	S	*	*	H	α-helix	trans	-74.9	-21.6	175.9	-70.2	-175.9	178.2	-123.1	-1.3	113.6	L58 K59 K63	L58-R61 PolarHBondContact O-N 3.13Å; K59-R61 VanDerWaalsContact C-N 3.28Å; K59-R61 PolarHBondContact O-N 3.37Å; R61-K63 VanDerWaalsContact C-N 3.29Å; R61-K63 PolarHBondContact O-N 2.77Å
62	G	69.4	Low	81	Confident	68 Å²	68	111.8 Å²	111.8	70%	0.701	56%	0.558	S	S	*	*	H	α-helix	trans	-65.7	-26.9	-178.9	0	0	0	0	0	114.4	L58 K59 R60	L58-G62 PolarHBondContact O-N 2.8Å; K59-G62 PolarHBondContact O-N 2.98Å; R60-G62 VanDerWaalsContact C-N 3.35Å
63	K	70.6	Confident	81.7	Confident	195 Å²	195	112.8 Å²	112.8	85%	0.848	56%	0.559	S	S	*	*			trans	-103.9	72.6	173.5	-72.7	177.4	-179.1	178.3	0	109.9	R61 S65	R61-K63 VanDerWaalsContact C-N 3.29Å; R61-K63 PolarHBondContact O-N 2.77Å; K63-S65 PolarHBondContact O-N 2.9Å
64	R	75.4	Confident	82.4	Confident	205 Å²	205	112.2 Å²	112.2	77%	0.774	56%	0.559	S	S	*	*	P	Polyproline II helix	trans	-61.9	130	161.6	-159.4	173.3	-179.7	115.3	1.5	106.8
65	S	79.3	Confident	83	Confident	87 Å²	87	114.8 Å²	114.8	61%	0.608	56%	0.564	S	S	*	*	P	Polyproline II helix	trans	-55.5	147.4	172.1	52.3	0	0	0	0	108.6	K63 K67	K63-S65 PolarHBondContact O-N 2.9Å; S65-K67 PolarHBondContact O-N 2.87Å
66	P	83.3	Confident	83.8	Confident	122 Å²	122	116.2 Å²	116.2	79%	0.792	57%	0.568	S	S	*	*	P	Polyproline II helix	trans	-47.5	136.5	166.2	-25.2	34.1	0	0	0	108.6	S68	P66-S68 PolarHBondContact O-N 3.19Å
67	K	85.2	Confident	84.6	Confident	80 Å²	80	120.6 Å²	120.6	35%	0.348	58%	0.578	S	S	.	*	P	Polyproline II helix	trans	-57.1	132.4	-177.7	-158.6	168.1	-151.4	138.7	0	109.7	S65 E71 V72 E75	S65-K67 PolarHBondContact O-N 2.87Å; K67-E71 HydrophobicContact CD-CB 4.12Å; K67-E71 HydrophobicContact CG-CB 3.6Å; K67-E71 HydrophobicContact CG-CG 4.49Å; K67-E71 WeakPolarHBondContact CG-OE2 3.48Å; K67-V72 HydrophobicContact CB-CG2 3.88Å; K67-V72 HydrophobicContact CD-CG2 3.71Å; K67-V72 HydrophobicContact CG-CG2 3.8Å; K67-E75 WeakPolarHBondContact CE-OE1 3.44Å; K67-E75 WeakPolarHBondContact CE-OE2 3.38Å; K67-E75 IonicContact NZ-OE1 2.53Å; K67-E75 PolarHBondContact NZ-OE1 2.97Å; K67-E75 IonicContact NZ-OE2 2.63Å; K67-E75 PolarHBondContact NZ-OE2 2.96Å
68	S	91.7	Very high	85.5	Confident	49 Å²	49	120.6 Å²	120.6	34%	0.343	58%	0.579	S	S	.	*	P	Polyproline II helix	trans	-64	150.9	175.2	66.8	0	0	0	0	110	P66 D70 E71 V72	P66-S68 PolarHBondContact O-N 3.19Å; S68-D70 PolarHBondContact O-N 3.18Å; S68-E71 WeakPolarHBondContact CB-OE1 3.43Å; S68-E71 WeakPolarHBondContact O-CB 3.33Å; S68-E71 PolarHBondContact O-N 3.2Å; S68-E71 WeakPolarHBondContact OG-CB 3.28Å; S68-E71 WeakPolarHBondContact OG-CG 3.46Å; S68-E71 PolarHBondContact OG-N 2.82Å; S68-E71 PolarHBondContact OG-OE1 2.83Å; S68-V72 PolarHBondContact O-N 3.34Å; S68-V72 VanDerWaalsContact O-N 3.08Å
69	R	93.6	Very high	86.6	Confident	204 Å²	204	122 Å²	122	77%	0.77	58%	0.58	S	S	*	*	H	α-helix	trans	-59.9	-34.9	-179	-172.4	150.5	96	133.5	-2.2	112	V72 N73	R69-V72 PolarHBondContact O-N 2.71Å; R69-N73 WeakPolarHBondContact O-CB 3.44Å; R69-N73 PolarHBondContact O-N 2.81Å; R69-N73 PolarHBondContact O-ND2 3.32Å
70	D	94.5	Very high	87.7	Confident	120 Å²	120	121 Å²	121	64%	0.642	58%	0.581	S	S	*	*	H	α-helix	trans	-68.4	-41.3	178.1	-62.9	-25.5	0	0	0	111.8	S68 V72 N73 V74	S68-D70 PolarHBondContact O-N 3.18Å; D70-V72 VanDerWaalsContact C-N 3.35Å; D70-V72 PolarHBondContact O-N 3.36Å; D70-N73 PolarHBondContact O-N 3.03Å; D70-V74 VanDerWaalsContact O-CG2 3.3Å; D70-V74 WeakPolarHBondContact O-CG2 3.43Å; D70-V74 PolarHBondContact O-N 2.84Å
71	E	93.8	Very high	89.1	Confident	82 Å²	82	117.9 Å²	117.9	38%	0.383	57%	0.569	S	S	.	*	H	α-helix	trans	-58.8	-44.8	172	-80.2	167.4	-115.8	0	0	111.8	K67 S68 N73 V74 E75	K67-E71 HydrophobicContact CD-CB 4.12Å; K67-E71 HydrophobicContact CG-CB 3.6Å; K67-E71 HydrophobicContact CG-CG 4.49Å; K67-E71 WeakPolarHBondContact CG-OE2 3.48Å; S68-E71 WeakPolarHBondContact CB-OE1 3.43Å; S68-E71 WeakPolarHBondContact O-CB 3.33Å; S68-E71 PolarHBondContact O-N 3.2Å; S68-E71 WeakPolarHBondContact OG-CB 3.28Å; S68-E71 WeakPolarHBondContact OG-CG 3.46Å; S68-E71 PolarHBondContact OG-N 2.82Å; S68-E71 PolarHBondContact OG-OE1 2.83Å; E71-N73 VanDerWaalsContact C-N 3.32Å; E71-N73 PolarHBondContact O-N 3.4Å; E71-V74 PolarHBondContact O-N 2.8Å; E71-E75 WeakPolarHBondContact O-CG 3.34Å; E71-E75 PolarHBondContact O-N 3.47Å
72	V	94.8	Very high	90.6	Very high	54 Å²	54	114.1 Å²	114.1	33%	0.327	57%	0.566	S	S	.	*	H	α-helix	trans	-60.9	-43	176.1	176	0	0	0	0	111	K67 S68 R69 D70 E75 N76	K67-V72 HydrophobicContact CB-CG2 3.88Å; K67-V72 HydrophobicContact CD-CG2 3.71Å; K67-V72 HydrophobicContact CG-CG2 3.8Å; S68-V72 PolarHBondContact O-N 3.34Å; S68-V72 VanDerWaalsContact O-N 3.08Å; R69-V72 PolarHBondContact O-N 2.71Å; D70-V72 VanDerWaalsContact C-N 3.35Å; D70-V72 PolarHBondContact O-N 3.36Å; V72-E75 PolarHBondContact O-N 3.23Å; V72-N76 WeakPolarHBondContact O-CB 3.28Å; V72-N76 VanDerWaalsContact O-CG 3.25Å; V72-N76 PolarHBondContact O-N 2.83Å; V72-N76 PolarHBondContact O-ND2 3.16Å
73	N	96.4	Very high	91.9	Very high	70 Å²	70	112.7 Å²	112.7	37%	0.374	54%	0.542	S	S	.	.	H	α-helix	trans	-64.4	-42.1	179	-71.4	-24	0	0	0	112.1	R69 D70 E71 N76 R77	R69-N73 WeakPolarHBondContact O-CB 3.44Å; R69-N73 PolarHBondContact O-N 2.81Å; R69-N73 PolarHBondContact O-ND2 3.32Å; D70-N73 PolarHBondContact O-N 3.03Å; E71-N73 VanDerWaalsContact C-N 3.32Å; E71-N73 PolarHBondContact O-N 3.4Å; N73-N76 PolarHBondContact O-N 3.25Å; N73-R77 WeakPolarHBondContact O-CG 3.03Å; N73-R77 PolarHBondContact O-N 3.03Å
74	V	96.5	Very high	93.3	Very high	76 Å²	76	108.7 Å²	108.7	46%	0.461	53%	0.526	S	S	.	.	H	α-helix	trans	-63.9	-43.1	177	171.3	0	0	0	0	110.9	D70 E71 R77 Q78	D70-V74 VanDerWaalsContact O-CG2 3.3Å; D70-V74 WeakPolarHBondContact O-CG2 3.43Å; D70-V74 PolarHBondContact O-N 2.84Å; E71-V74 PolarHBondContact O-N 2.8Å; V74-R77 WeakPolarHBondContact O-CB 3.39Å; V74-R77 PolarHBondContact O-N 3.02Å; V74-Q78 WeakPolarHBondContact O-CG 3.24Å; V74-Q78 PolarHBondContact O-N 3.19Å
75	E	95	Very high	94.3	Very high	91 Å²	91	104.2 Å²	104.2	43%	0.425	52%	0.517	S	S	.	.	H	α-helix	trans	-65.8	-41.4	176.6	-74.6	-172.3	167.3	0	0	113	K67 E71 V72 R77 Q78 K79	K67-E75 WeakPolarHBondContact CE-OE1 3.44Å; K67-E75 WeakPolarHBondContact CE-OE2 3.38Å; K67-E75 IonicContact NZ-OE1 2.53Å; K67-E75 PolarHBondContact NZ-OE1 2.97Å; K67-E75 IonicContact NZ-OE2 2.63Å; K67-E75 PolarHBondContact NZ-OE2 2.96Å; E71-E75 WeakPolarHBondContact O-CG 3.34Å; E71-E75 PolarHBondContact O-N 3.47Å; V72-E75 PolarHBondContact O-N 3.23Å; E75-R77 VanDerWaalsContact C-N 3.28Å; E75-R77 PolarHBondContact O-N 3.39Å; E75-Q78 PolarHBondContact O-N 2.89Å; E75-Q78 VanDerWaalsContact O-N 3.16Å; E75-K79 WeakPolarHBondContact O-CB 3.29Å; E75-K79 PolarHBondContact O-N 3.36Å
76	N	97.1	Very high	95.2	Very high	82 Å²	82	106.7 Å²	106.7	44%	0.439	51%	0.513	S	S	.	.	H	α-helix	trans	-60.6	-40.5	175.4	-74.9	-22.5	0	0	0	111.3	V72 N73 K79 L80	V72-N76 WeakPolarHBondContact O-CB 3.28Å; V72-N76 VanDerWaalsContact O-CG 3.25Å; V72-N76 PolarHBondContact O-N 2.83Å; V72-N76 PolarHBondContact O-ND2 3.16Å; N73-N76 PolarHBondContact O-N 3.25Å; N76-K79 PolarHBondContact O-N 3.32Å; N76-L80 VanDerWaalsContact O-CG 3.32Å; N76-L80 WeakPolarHBondContact O-CG 3.26Å; N76-L80 PolarHBondContact O-N 2.85Å
77	R	97.1	Very high	96	Very high	179 Å²	179	108.6 Å²	108.6	68%	0.675	50%	0.504	S	S	*	.	H	α-helix	trans	-62.3	-42.8	173.7	-72.3	174	-179.8	-172.4	0.2	112.2	N73 V74 E75 L80 R81	N73-R77 WeakPolarHBondContact O-CG 3.03Å; N73-R77 PolarHBondContact O-N 3.03Å; V74-R77 WeakPolarHBondContact O-CB 3.39Å; V74-R77 PolarHBondContact O-N 3.02Å; E75-R77 VanDerWaalsContact C-N 3.28Å; E75-R77 PolarHBondContact O-N 3.39Å; R77-L80 PolarHBondContact O-N 2.94Å; R77-R81 WeakPolarHBondContact O-CG 3.31Å; R77-R81 PolarHBondContact O-N 2.87Å
78	Q	96.9	Very high	96.6	Very high	103 Å²	103	108.9 Å²	108.9	48%	0.481	51%	0.507	S	S	.	.	H	α-helix	trans	-63.4	-44.3	176.1	-72.3	-178.3	-6.2	0	0	111.5	V74 E75 L80 R81 V82	V74-Q78 WeakPolarHBondContact O-CG 3.24Å; V74-Q78 PolarHBondContact O-N 3.19Å; E75-Q78 PolarHBondContact O-N 2.89Å; E75-Q78 VanDerWaalsContact O-N 3.16Å; Q78-L80 VanDerWaalsContact C-N 3.35Å; Q78-L80 PolarHBondContact O-N 2.84Å; Q78-R81 PolarHBondContact O-N 3.48Å; Q78-V82 WeakPolarHBondContact O-CG2 3.5Å; Q78-V82 PolarHBondContact O-N 2.92Å
79	K	97.2	Very high	96.9	Very high	158 Å²	158	112.5 Å²	112.5	69%	0.687	51%	0.514	S	S	*	.	H	α-helix	trans	-60.1	-43.9	177.2	-176.2	179.1	178.3	-176.4	0	111.9	E75 N76 V82 D83	E75-K79 WeakPolarHBondContact O-CB 3.29Å; E75-K79 PolarHBondContact O-N 3.36Å; N76-K79 PolarHBondContact O-N 3.32Å; K79-V82 PolarHBondContact O-N 2.88Å; K79-D83 WeakPolarHBondContact O-CB 3.31Å; K79-D83 PolarHBondContact O-N 3.21Å
80	L	98	Very high	97.1	Very high	119 Å²	119	109.7 Å²	109.7	62%	0.623	50%	0.504	S	S	*	.	H	α-helix	trans	-62.7	-44.8	177.1	-73.1	172	0	0	0	111.7	N76 R77 Q78 V82 D83 E84	N76-L80 VanDerWaalsContact O-CG 3.32Å; N76-L80 WeakPolarHBondContact O-CG 3.26Å; N76-L80 PolarHBondContact O-N 2.85Å; R77-L80 PolarHBondContact O-N 2.94Å; Q78-L80 VanDerWaalsContact C-N 3.35Å; Q78-L80 PolarHBondContact O-N 2.84Å; L80-V82 PolarHBondContact O-N 3.1Å; L80-D83 PolarHBondContact O-N 3.34Å; L80-E84 WeakPolarHBondContact O-CB 3.2Å; L80-E84 PolarHBondContact O-N 3.48Å
81	R	98.1	Very high	97.3	Very high	155 Å²	155	109 Å²	109	59%	0.585	50%	0.498	S	S	*	.	H	α-helix	trans	-61.7	-41.6	176.3	-72.3	-165.2	-61.7	-173	3	112.9	R77 Q78 D83 E84 L85	R77-R81 WeakPolarHBondContact O-CG 3.31Å; R77-R81 PolarHBondContact O-N 2.87Å; Q78-R81 PolarHBondContact O-N 3.48Å; R81-D83 VanDerWaalsContact C-N 3.32Å; R81-E84 PolarHBondContact O-N 2.85Å; R81-L85 WeakPolarHBondContact O-CB 3.25Å; R81-L85 VanDerWaalsContact O-CG 3.28Å; R81-L85 WeakPolarHBondContact O-CG 3.43Å; R81-L85 PolarHBondContact O-N 3.26Å
82	V	98	Very high	97.6	Very high	98 Å²	98	110.6 Å²	110.6	59%	0.594	51%	0.505	S	S	*	.	H	α-helix	trans	-66.6	-37.3	177	173	0	0	0	0	111.1	Q78 K79 L80 R86	Q78-V82 WeakPolarHBondContact O-CG2 3.5Å; Q78-V82 PolarHBondContact O-N 2.92Å; K79-V82 PolarHBondContact O-N 2.88Å; L80-V82 PolarHBondContact O-N 3.1Å; V82-R86 WeakPolarHBondContact O-CB 3.45Å; V82-R86 PolarHBondContact O-N 3.49Å; V82-R86 VanDerWaalsContact O-N 3.15Å
83	D	98.1	Very high	97.7	Very high	38 Å²	38	112 Å²	112	20%	0.203	51%	0.508	C	S	.	.	H	α-helix	trans	-67.4	-41.8	175.5	-165.8	57.5	0	0	0	112	K79 L80 R81 R86 R87	K79-D83 WeakPolarHBondContact O-CB 3.31Å; K79-D83 PolarHBondContact O-N 3.21Å; L80-D83 PolarHBondContact O-N 3.34Å; R81-D83 VanDerWaalsContact C-N 3.32Å; D83-R86 PolarHBondContact O-N 3.19Å; D83-R86 IonicContact OD1-CZ 3.64Å; D83-R86 IonicContact OD1-NE 3.77Å; D83-R86 IonicContact OD1-NH2 2.71Å; D83-R86 PolarHBondContact OD1-NH2 3.25Å; D83-R87 VanDerWaalsContact O-CG 3.32Å; D83-R87 WeakPolarHBondContact O-CG 3.47Å; D83-R87 PolarHBondContact O-N 2.99Å; D83-R87 IonicContact OD2-CZ 3.21Å; D83-R87 IonicContact OD2-NE 2.9Å; D83-R87 PolarHBondContact OD2-NE 3.46Å; D83-R87 IonicContact OD2-NH2 2.77Å; D83-R87 PolarHBondContact OD2-NH2 2.86Å
84	E	98.3	Very high	97.8	Very high	111 Å²	111	114.5 Å²	114.5	52%	0.519	51%	0.512	S	S	.	.	H	α-helix	trans	-60.7	-52.9	176.3	-174	168	-148.2	0	0	111.4	L80 R81 R86 R87 E88	L80-E84 WeakPolarHBondContact O-CB 3.2Å; L80-E84 PolarHBondContact O-N 3.48Å; R81-E84 PolarHBondContact O-N 2.85Å; E84-R86 PolarHBondContact O-N 2.96Å; E84-R87 WeakPolarHBondContact O-CA 3.37Å; E84-R87 WeakPolarHBondContact O-CB 3.16Å; E84-R87 PolarHBondContact O-N 3.45Å; E84-E88 WeakPolarHBondContact O-CG 3.48Å; E84-E88 PolarHBondContact O-N 2.98Å
85	L	98.4	Very high	97.9	Very high	110 Å²	110	115.6 Å²	115.6	58%	0.576	52%	0.515	S	S	*	.	H	α-helix	trans	-56.2	-38.3	176	-72.3	171.6	0	0	0	112.7	R81 Y89	R81-L85 WeakPolarHBondContact O-CB 3.25Å; R81-L85 VanDerWaalsContact O-CG 3.28Å; R81-L85 WeakPolarHBondContact O-CG 3.43Å; R81-L85 PolarHBondContact O-N 3.26Å; L85-Y89 WeakPolarHBondContact O-CB 3.39Å; L85-Y89 PolarHBondContact O-N 3.09Å
86	R	98.2	Very high	98.1	Very high	139 Å²	139	116.6 Å²	116.6	53%	0.525	52%	0.52	S	S	.	.	H	α-helix	trans	-69.3	-37.7	177.5	-178.2	175.2	61.7	176.6	0	111.6	V82 D83 E84 Y90	V82-R86 WeakPolarHBondContact O-CB 3.45Å; V82-R86 PolarHBondContact O-N 3.49Å; V82-R86 VanDerWaalsContact O-N 3.15Å; D83-R86 PolarHBondContact O-N 3.19Å; D83-R86 IonicContact OD1-CZ 3.64Å; D83-R86 IonicContact OD1-NE 3.77Å; D83-R86 IonicContact OD1-NH2 2.71Å; D83-R86 PolarHBondContact OD1-NH2 3.25Å; E84-R86 PolarHBondContact O-N 2.96Å; R86-Y90 HydrophobicContact CG-CD2 3.89Å; R86-Y90 HydrophobicContact CG-CE2 3.5Å; R86-Y90 WeakPolarHBondContact O-CD2 3.33Å; R86-Y90 PolarHBondContact O-N 2.99Å
87	R	98.5	Very high	98.1	Very high	162 Å²	162	119.2 Å²	119.2	61%	0.611	53%	0.528	S	S	*	.	H	α-helix	trans	-66.7	-47.5	175.4	-72.1	173	-168.7	-150.2	4	110.9	D83 E84 Y89 Y90 E91	D83-R87 VanDerWaalsContact O-CG 3.32Å; D83-R87 WeakPolarHBondContact O-CG 3.47Å; D83-R87 PolarHBondContact O-N 2.99Å; D83-R87 IonicContact OD2-CZ 3.21Å; D83-R87 IonicContact OD2-NE 2.9Å; D83-R87 PolarHBondContact OD2-NE 3.46Å; D83-R87 IonicContact OD2-NH2 2.77Å; D83-R87 PolarHBondContact OD2-NH2 2.86Å; E84-R87 WeakPolarHBondContact O-CA 3.37Å; E84-R87 WeakPolarHBondContact O-CB 3.16Å; E84-R87 PolarHBondContact O-N 3.45Å; R87-Y89 VanDerWaalsContact C-N 3.3Å; R87-Y89 PolarHBondContact O-N 2.82Å; R87-Y90 PolarHBondContact O-N 3.25Å; R87-Y90 VanDerWaalsContact O-N 3.16Å; R87-E91 VanDerWaalsContact O-CB 3.28Å; R87-E91 WeakPolarHBondContact O-CB 3.46Å; R87-E91 PolarHBondContact O-N 3.39Å
88	E	98.4	Very high	98.2	Very high	87 Å²	87	115.2 Å²	115.2	41%	0.407	52%	0.517	S	S	.	.	H	α-helix	trans	-54.6	-47.9	176.3	-71.1	173.3	168.9	0	0	110.5	E84 Y90 E91 E92	E84-E88 WeakPolarHBondContact O-CG 3.48Å; E84-E88 PolarHBondContact O-N 2.98Å; E88-Y90 PolarHBondContact O-N 2.98Å; E88-E91 PolarHBondContact O-N 3.31Å; E88-E92 WeakPolarHBondContact O-CB 3.38Å; E88-E92 WeakPolarHBondContact O-CG 3.46Å; E88-E92 PolarHBondContact O-N 2.86Å
89	Y	98.4	Very high	98.2	Very high	124 Å²	124	114.8 Å²	114.8	49%	0.486	52%	0.518	S	S	.	.	H	α-helix	trans	-56.3	-46.7	176.3	173.5	-105.8	0	0	0	113.4	L85 R87 Q93	L85-Y89 WeakPolarHBondContact O-CB 3.39Å; L85-Y89 PolarHBondContact O-N 3.09Å; R87-Y89 VanDerWaalsContact C-N 3.3Å; R87-Y89 PolarHBondContact O-N 2.82Å; Y89-Q93 HydrophobicContact CD2-CG 4.49Å; Y89-Q93 HydrophobicContact CE1-CG 4.32Å; Y89-Q93 HydrophobicContact CE2-CG 4.06Å; Y89-Q93 WeakPolarHBondContact O-CB 3.44Å; Y89-Q93 VanDerWaalsContact O-CG 3.26Å; Y89-Q93 WeakPolarHBondContact O-CG 3.39Å; Y89-Q93 PolarHBondContact O-N 3.47Å
90	Y	98.3	Very high	98.3	Very high	145 Å²	145	112.7 Å²	112.7	57%	0.569	51%	0.509	S	S	*	.	H	α-helix	trans	-74	-28.6	179.5	-70.8	-56.5	0	0	0	113.2	R86 R87 E88 R94	R86-Y90 HydrophobicContact CG-CD2 3.89Å; R86-Y90 HydrophobicContact CG-CE2 3.5Å; R86-Y90 WeakPolarHBondContact O-CD2 3.33Å; R86-Y90 PolarHBondContact O-N 2.99Å; R87-Y90 PolarHBondContact O-N 3.25Å; R87-Y90 VanDerWaalsContact O-N 3.16Å; E88-Y90 PolarHBondContact O-N 2.98Å; Y90-R94 WeakPolarHBondContact O-CB 3.49Å; Y90-R94 PolarHBondContact O-N 3.34Å
91	E	98.5	Very high	98.3	Very high	107 Å²	107	109.7 Å²	109.7	50%	0.5	50%	0.495	S	S	.	.	H	α-helix	trans	-69.5	-44.3	174	177.7	151.4	-126.7	0	0	111.3	R87 E88 R94 N95	R87-E91 VanDerWaalsContact O-CB 3.28Å; R87-E91 WeakPolarHBondContact O-CB 3.46Å; R87-E91 PolarHBondContact O-N 3.39Å; E88-E91 PolarHBondContact O-N 3.31Å; E91-R94 PolarHBondContact O-N 2.9Å; E91-R94 IonicContact OE1-NH2 3.23Å; E91-R94 PolarHBondContact OE1-NH2 2.84Å; E91-N95 VanDerWaalsContact O-CB 3.24Å; E91-N95 WeakPolarHBondContact O-CB 3.47Å; E91-N95 PolarHBondContact O-N 3.39Å
92	E	98.5	Very high	98.3	Very high	114 Å²	114	108.1 Å²	108.1	53%	0.533	50%	0.495	S	S	.	.	H	α-helix	trans	-58.7	-49.6	171.5	-74.2	177.2	173.6	0	0	111	E88 R94 N95 E96	E88-E92 WeakPolarHBondContact O-CB 3.38Å; E88-E92 WeakPolarHBondContact O-CG 3.46Å; E88-E92 PolarHBondContact O-N 2.86Å; E92-R94 VanDerWaalsContact C-N 3.3Å; E92-R94 PolarHBondContact O-N 3.44Å; E92-N95 PolarHBondContact O-N 3.2Å; E92-E96 WeakPolarHBondContact O-CB 3.31Å; E92-E96 VanDerWaalsContact O-CG 3.29Å; E92-E96 WeakPolarHBondContact O-CG 3.4Å; E92-E96 PolarHBondContact O-N 3Å
93	Q	98.6	Very high	98.3	Very high	85 Å²	85	108.2 Å²	108.2	40%	0.397	49%	0.489	S	S	.	.	H	α-helix	trans	-59.4	-39.5	177.9	-74.1	-66	-70.1	0	0	113	Y89 E96 F97	Y89-Q93 HydrophobicContact CD2-CG 4.49Å; Y89-Q93 HydrophobicContact CE1-CG 4.32Å; Y89-Q93 HydrophobicContact CE2-CG 4.06Å; Y89-Q93 WeakPolarHBondContact O-CB 3.44Å; Y89-Q93 VanDerWaalsContact O-CG 3.26Å; Y89-Q93 WeakPolarHBondContact O-CG 3.39Å; Y89-Q93 PolarHBondContact O-N 3.47Å; Q93-E96 PolarHBondContact NE2-OE2 2.96Å; Q93-F97 PolarHBondContact O-N 3.27Å
94	R	98.5	Very high	98.3	Very high	121 Å²	121	109.7 Å²	109.7	46%	0.457	49%	0.494	S	S	.	.	H	α-helix	trans	-67.8	-46.5	176.1	-176.4	-175.8	66.2	-118.3	-3	110.9	Y90 E91 E92 F97 E98	Y90-R94 WeakPolarHBondContact O-CB 3.49Å; Y90-R94 PolarHBondContact O-N 3.34Å; E91-R94 PolarHBondContact O-N 2.9Å; E91-R94 IonicContact OE1-NH2 3.23Å; E91-R94 PolarHBondContact OE1-NH2 2.84Å; E92-R94 VanDerWaalsContact C-N 3.3Å; E92-R94 PolarHBondContact O-N 3.44Å; R94-F97 PolarHBondContact O-N 3.47Å; R94-E98 WeakPolarHBondContact CD-OE1 3.35Å; R94-E98 HydrophobicContact CG-CG 4.34Å; R94-E98 WeakPolarHBondContact CG-OE1 3.42Å; R94-E98 IonicContact NE-OE1 2.87Å; R94-E98 WeakPolarHBondContact O-CB 3.3Å; R94-E98 WeakPolarHBondContact O-CG 3.45Å; R94-E98 PolarHBondContact O-N 3.37Å
95	N	98.4	Very high	98.3	Very high	99 Å²	99	108.8 Å²	108.8	53%	0.529	49%	0.493	S	S	.	.	H	α-helix	trans	-64.1	-40.2	-179.4	-172.1	54.2	0	0	0	111.8	E91 E92 F97 E98 N99	E91-N95 VanDerWaalsContact O-CB 3.24Å; E91-N95 WeakPolarHBondContact O-CB 3.47Å; E91-N95 PolarHBondContact O-N 3.39Å; E92-N95 PolarHBondContact O-N 3.2Å; N95-F97 VanDerWaalsContact C-N 3.34Å; N95-F97 PolarHBondContact O-N 3.31Å; N95-E98 PolarHBondContact O-N 2.96Å; N95-N99 WeakPolarHBondContact O-CB 3.16Å; N95-N99 PolarHBondContact O-N 3.48Å
96	E	98.4	Very high	98.2	Very high	112 Å²	112	108.2 Å²	108.2	52%	0.523	49%	0.49	S	S	.	.	H	α-helix	trans	-59.2	-44.9	172.6	-76	174.3	-178.5	0	0	111.5	E92 Q93 F100	E92-E96 WeakPolarHBondContact O-CB 3.31Å; E92-E96 VanDerWaalsContact O-CG 3.29Å; E92-E96 WeakPolarHBondContact O-CG 3.4Å; E92-E96 PolarHBondContact O-N 3Å; Q93-E96 PolarHBondContact NE2-OE2 2.96Å; E96-F100 WeakPolarHBondContact O-CB 3.36Å; E96-F100 PolarHBondContact O-N 3.35Å
97	F	98.2	Very high	98.2	Very high	138 Å²	138	105.3 Å²	105.3	61%	0.605	48%	0.483	S	S	*	.	H	α-helix	trans	-68.7	-43.8	178.7	-179.6	-98.3	0	0	0	112.7	Q93 R94 N95 F100 V101	Q93-F97 PolarHBondContact O-N 3.27Å; R94-F97 PolarHBondContact O-N 3.47Å; N95-F97 VanDerWaalsContact C-N 3.34Å; N95-F97 PolarHBondContact O-N 3.31Å; F97-F100 PolarHBondContact O-N 2.89Å; F97-V101 HydrophobicContact CD1-CG2 4.32Å; F97-V101 HydrophobicContact CE1-CG2 3.86Å; F97-V101 HydrophobicContact CE2-CG2 4.17Å; F97-V101 HydrophobicContact CZ-CG2 3.77Å; F97-V101 WeakPolarHBondContact O-CG2 3.29Å; F97-V101 PolarHBondContact O-N 3.21Å
98	E	98.1	Very high	98.1	Very high	94 Å²	94	103.1 Å²	103.1	44%	0.439	48%	0.48	S	S	.	.	H	α-helix	trans	-60.4	-47.5	175.9	-75.8	172.5	179.7	0	0	110.5	R94 N95 F100 V101 E102	R94-E98 WeakPolarHBondContact CD-OE1 3.35Å; R94-E98 HydrophobicContact CG-CG 4.34Å; R94-E98 WeakPolarHBondContact CG-OE1 3.42Å; R94-E98 IonicContact NE-OE1 2.87Å; R94-E98 WeakPolarHBondContact O-CB 3.3Å; R94-E98 WeakPolarHBondContact O-CG 3.45Å; R94-E98 PolarHBondContact O-N 3.37Å; N95-E98 PolarHBondContact O-N 2.96Å; E98-F100 PolarHBondContact O-N 3.39Å; E98-V101 PolarHBondContact O-N 2.92Å; E98-E102 WeakPolarHBondContact O-CG 3.44Å; E98-E102 PolarHBondContact O-N 3.44Å
99	N	98.2	Very high	98	Very high	95 Å²	95	105.6 Å²	105.6	51%	0.508	49%	0.491	S	S	.	.	H	α-helix	trans	-61.9	-41.6	177.2	-167.2	25.3	0	0	0	112.1	N95 V101 E102 E103	N95-N99 WeakPolarHBondContact O-CB 3.16Å; N95-N99 PolarHBondContact O-N 3.48Å; N99-V101 PolarHBondContact O-N 2.88Å; N99-E102 PolarHBondContact O-N 2.85Å; N99-E103 VanDerWaalsContact O-CB 3.29Å; N99-E103 WeakPolarHBondContact O-CB 3.21Å; N99-E103 PolarHBondContact O-N 2.87Å
100	F	98.3	Very high	98	Very high	113 Å²	113	104.8 Å²	104.8	50%	0.496	49%	0.492	S	S	.	.	H	α-helix	trans	-61.9	-42.3	175.1	172.5	-103	0	0	0	112.5	E96 F97 E98 Q104	E96-F100 WeakPolarHBondContact O-CB 3.36Å; E96-F100 PolarHBondContact O-N 3.35Å; F97-F100 PolarHBondContact O-N 2.89Å; E98-F100 PolarHBondContact O-N 3.39Å; F100-Q104 HydrophobicContact CD1-CG 4.5Å; F100-Q104 HydrophobicContact CD2-CG 4.26Å; F100-Q104 HydrophobicContact CE1-CG 4.04Å; F100-Q104 HydrophobicContact CE2-CG 3.78Å; F100-Q104 HydrophobicContact CZ-CG 3.65Å; F100-Q104 WeakPolarHBondContact O-CB 2.83Å; F100-Q104 VanDerWaalsContact O-CG 3.3Å; F100-Q104 WeakPolarHBondContact O-CG 3.48Å; F100-Q104 PolarHBondContact O-N 2.89Å
101	V	98.2	Very high	97.9	Very high	56 Å²	56	104.7 Å²	104.7	34%	0.339	49%	0.49	S	S	.	.	H	α-helix	trans	-67.9	-41	178.5	170.9	0	0	0	0	111.1	F97 E98 N99 N105	F97-V101 HydrophobicContact CD1-CG2 4.32Å; F97-V101 HydrophobicContact CE1-CG2 3.86Å; F97-V101 HydrophobicContact CE2-CG2 4.17Å; F97-V101 HydrophobicContact CZ-CG2 3.77Å; F97-V101 WeakPolarHBondContact O-CG2 3.29Å; F97-V101 PolarHBondContact O-N 3.21Å; E98-V101 PolarHBondContact O-N 2.92Å; N99-V101 PolarHBondContact O-N 2.88Å; V101-N105 VanDerWaalsContact O-CG 3.26Å; V101-N105 PolarHBondContact O-N 2.65Å; V101-N105 VanDerWaalsContact O-N 3.07Å; V101-N105 PolarHBondContact O-ND2 2.84Å; V101-N105 VanDerWaalsContact O-ND2 3.13Å
102	E	98	Very high	97.7	Very high	122 Å²	122	102.9 Å²	102.9	57%	0.57	49%	0.49	S	S	*	.	H	α-helix	trans	-61.9	-49.4	173.9	-74.2	-172.4	172.2	0	0	111.2	E98 N99 Q104 N105 D106	E98-E102 WeakPolarHBondContact O-CG 3.44Å; E98-E102 PolarHBondContact O-N 3.44Å; N99-E102 PolarHBondContact O-N 2.85Å; E102-Q104 VanDerWaalsContact C-N 3.33Å; E102-Q104 PolarHBondContact O-N 3.22Å; E102-N105 PolarHBondContact O-N 3.13Å; E102-N105 VanDerWaalsContact O-N 3.09Å; E102-D106 WeakPolarHBondContact O-CB 3.41Å; E102-D106 PolarHBondContact O-N 3.07Å
103	E	98.1	Very high	97.5	Very high	100 Å²	100	103.1 Å²	103.1	47%	0.467	49%	0.486	S	S	.	.	H	α-helix	trans	-58.8	-42.4	177.7	-172.7	173.5	-153.3	0	0	111.7	N99 N105 D106 E107	N99-E103 VanDerWaalsContact O-CB 3.29Å; N99-E103 WeakPolarHBondContact O-CB 3.21Å; N99-E103 PolarHBondContact O-N 2.87Å; E103-N105 PolarHBondContact O-N 2.81Å; E103-D106 PolarHBondContact O-N 3.2Å; E103-E107 HydrophobicContact CG-CG 4.39Å; E103-E107 VanDerWaalsContact O-CB 3.25Å; E103-E107 WeakPolarHBondContact O-CB 3.26Å; E103-E107 WeakPolarHBondContact O-CG 3.37Å; E103-E107 PolarHBondContact O-N 2.94Å
104	Q	98.2	Very high	97.3	Very high	70 Å²	70	104 Å²	104	33%	0.327	49%	0.49	S	S	.	.	H	α-helix	trans	-64.7	-37.4	176	-74.5	-57.2	-74.7	0	0	113.4	F100 E102 E107 Q108	F100-Q104 HydrophobicContact CD1-CG 4.5Å; F100-Q104 HydrophobicContact CD2-CG 4.26Å; F100-Q104 HydrophobicContact CE1-CG 4.04Å; F100-Q104 HydrophobicContact CE2-CG 3.78Å; F100-Q104 HydrophobicContact CZ-CG 3.65Å; F100-Q104 WeakPolarHBondContact O-CB 2.83Å; F100-Q104 VanDerWaalsContact O-CG 3.3Å; F100-Q104 WeakPolarHBondContact O-CG 3.48Å; F100-Q104 PolarHBondContact O-N 2.89Å; E102-Q104 VanDerWaalsContact C-N 3.33Å; E102-Q104 PolarHBondContact O-N 3.22Å; Q104-E107 PolarHBondContact NE2-OE2 3.34Å; Q104-Q108 VanDerWaalsContact O-CB 3.26Å; Q104-Q108 WeakPolarHBondContact O-CB 3.25Å; Q104-Q108 PolarHBondContact O-N 3.47Å
105	N	97.8	Very high	97.1	Very high	91 Å²	91	101.1 Å²	101.1	49%	0.487	49%	0.492	S	S	.	.	H	α-helix	trans	-69.2	-46	176.8	-72.2	-31.7	0	0	0	111	V101 E102 E103 Q108 E109	V101-N105 VanDerWaalsContact O-CG 3.26Å; V101-N105 PolarHBondContact O-N 2.65Å; V101-N105 VanDerWaalsContact O-N 3.07Å; V101-N105 PolarHBondContact O-ND2 2.84Å; V101-N105 VanDerWaalsContact O-ND2 3.13Å; E102-N105 PolarHBondContact O-N 3.13Å; E102-N105 VanDerWaalsContact O-N 3.09Å; E103-N105 PolarHBondContact O-N 2.81Å; N105-Q108 PolarHBondContact O-N 3.04Å; N105-E109 WeakPolarHBondContact O-CB 3.22Å; N105-E109 PolarHBondContact O-N 2.93Å
106	D	97.6	Very high	96.7	Very high	98 Å²	98	99.3 Å²	99.3	52%	0.524	48%	0.484	S	S	.	.	H	α-helix	trans	-63.2	-47.1	178.6	-74.2	-4.9	0	0	0	110.9	E102 E103 Q108 E109 E110	E102-D106 WeakPolarHBondContact O-CB 3.41Å; E102-D106 PolarHBondContact O-N 3.07Å; E103-D106 PolarHBondContact O-N 3.2Å; D106-Q108 VanDerWaalsContact C-N 3.29Å; D106-Q108 PolarHBondContact O-N 3.11Å; D106-E109 PolarHBondContact O-N 3.45Å; D106-E110 WeakPolarHBondContact O-CB 3.31Å; D106-E110 WeakPolarHBondContact O-CG 3.24Å; D106-E110 PolarHBondContact O-N 2.9Å
107	E	97.5	Very high	96.1	Very high	78 Å²	78	97.3 Å²	97.3	36%	0.364	48%	0.475	S	S	.	.	H	α-helix	trans	-58	-41.5	173.9	-77.9	-178.2	172.8	0	0	111.6	E103 Q104 R111	E103-E107 HydrophobicContact CG-CG 4.39Å; E103-E107 VanDerWaalsContact O-CB 3.25Å; E103-E107 WeakPolarHBondContact O-CB 3.26Å; E103-E107 WeakPolarHBondContact O-CG 3.37Å; E103-E107 PolarHBondContact O-N 2.94Å; Q104-E107 PolarHBondContact NE2-OE2 3.34Å; E107-R111 WeakPolarHBondContact O-CB 3.42Å; E107-R111 WeakPolarHBondContact O-CG 3.47Å; E107-R111 PolarHBondContact O-N 3.01Å
108	Q	97.1	Very high	95.8	Very high	117 Å²	117	96.6 Å²	96.6	55%	0.547	47%	0.474	S	S	.	.	H	α-helix	trans	-66.5	-42.9	177.5	-178.9	172.9	-0.7	0	0	111.9	Q104 N105 D106 S112	Q104-Q108 VanDerWaalsContact O-CB 3.26Å; Q104-Q108 WeakPolarHBondContact O-CB 3.25Å; Q104-Q108 PolarHBondContact O-N 3.47Å; N105-Q108 PolarHBondContact O-N 3.04Å; D106-Q108 VanDerWaalsContact C-N 3.29Å; D106-Q108 PolarHBondContact O-N 3.11Å; Q108-S112 WeakPolarHBondContact O-CB 3.39Å; Q108-S112 PolarHBondContact O-N 3.42Å
109	E	96.6	Very high	95.4	Very high	138 Å²	138	100 Å²	100	65%	0.645	48%	0.482	S	S	*	.	H	α-helix	trans	-63.7	-44.4	176.8	-175.6	170	176.3	0	0	111	N105 D106 S112 R113	N105-E109 WeakPolarHBondContact O-CB 3.22Å; N105-E109 PolarHBondContact O-N 2.93Å; D106-E109 PolarHBondContact O-N 3.45Å; E109-S112 WeakPolarHBondContact O-CB 3.34Å; E109-S112 PolarHBondContact O-N 2.96Å; E109-R113 VanDerWaalsContact O-CB 3.3Å; E109-R113 WeakPolarHBondContact O-CB 3.44Å; E109-R113 PolarHBondContact O-N 3.11Å
110	E	97.1	Very high	94.8	Very high	108 Å²	108	101.2 Å²	101.2	51%	0.505	48%	0.48	S	S	.	.	H	α-helix	trans	-62.5	-49.1	176.2	-74.5	-161.5	156.4	0	0	111.8	D106 S112 R113 E114	D106-E110 WeakPolarHBondContact O-CB 3.31Å; D106-E110 WeakPolarHBondContact O-CG 3.24Å; D106-E110 PolarHBondContact O-N 2.9Å; E110-S112 VanDerWaalsContact C-N 3.25Å; E110-S112 PolarHBondContact O-N 3.45Å; E110-R113 WeakPolarHBondContact O-CB 3.5Å; E110-R113 PolarHBondContact O-N 2.9Å; E110-R113 VanDerWaalsContact O-N 3.15Å; E110-E114 WeakPolarHBondContact O-CB 3.22Å; E110-E114 WeakPolarHBondContact O-CG 3.47Å; E110-E114 PolarHBondContact O-N 3.37Å
111	R	96.6	Very high	94.1	Very high	142 Å²	142	101.9 Å²	101.9	54%	0.536	49%	0.485	S	S	.	.	H	α-helix	trans	-57.9	-40.6	175.2	-73.8	-177.3	-42.9	-151.1	0.9	111.9	E107 A115	E107-R111 WeakPolarHBondContact O-CB 3.42Å; E107-R111 WeakPolarHBondContact O-CG 3.47Å; E107-R111 PolarHBondContact O-N 3.01Å; R111-A115 VanDerWaalsContact O-CB 3.26Å; R111-A115 WeakPolarHBondContact O-CB 3.41Å; R111-A115 PolarHBondContact O-N 3.47Å
112	S	94.7	Very high	93.6	Very high	70 Å²	70	108.9 Å²	108.9	49%	0.49	51%	0.505	S	S	.	.	H	α-helix	trans	-64.7	-48.1	177.2	-170.9	0	0	0	0	110.5	Q108 E109 E110 E114 A115 V116	Q108-S112 WeakPolarHBondContact O-CB 3.39Å; Q108-S112 PolarHBondContact O-N 3.42Å; E109-S112 WeakPolarHBondContact O-CB 3.34Å; E109-S112 PolarHBondContact O-N 2.96Å; E110-S112 VanDerWaalsContact C-N 3.25Å; E110-S112 PolarHBondContact O-N 3.45Å; S112-E114 PolarHBondContact O-N 3.15Å; S112-A115 PolarHBondContact O-N 2.81Å; S112-V116 VanDerWaalsContact O-CG2 3.25Å; S112-V116 WeakPolarHBondContact O-CG2 3.35Å; S112-V116 PolarHBondContact O-N 3.3Å
113	R	93.8	Very high	92.8	Very high	118 Å²	118	106.8 Å²	106.8	45%	0.445	50%	0.495	S	S	.	.	H	α-helix	trans	-58.3	-48.4	178.4	-174.8	176.4	69	82.5	-2.2	111.3	E109 E110 V116 E117	E109-R113 VanDerWaalsContact O-CB 3.3Å; E109-R113 WeakPolarHBondContact O-CB 3.44Å; E109-R113 PolarHBondContact O-N 3.11Å; E110-R113 WeakPolarHBondContact O-CB 3.5Å; E110-R113 PolarHBondContact O-N 2.9Å; E110-R113 VanDerWaalsContact O-N 3.15Å; R113-V116 PolarHBondContact O-N 3.45Å; R113-E117 WeakPolarHBondContact CG-OE1 3.4Å; R113-E117 IonicContact CZ-OE1 3.93Å; R113-E117 IonicContact NH1-OE1 3.57Å; R113-E117 PolarHBondContact NH1-OE1 2.89Å; R113-E117 IonicContact NH1-OE2 3.91Å; R113-E117 WeakPolarHBondContact O-CB 3.43Å; R113-E117 WeakPolarHBondContact O-CG 3.2Å; R113-E117 PolarHBondContact O-N 2.81Å
114	E	94.5	Very high	91.8	Very high	104 Å²	104	109.4 Å²	109.4	49%	0.486	50%	0.502	S	S	.	.	H	α-helix	trans	-60.4	-48.4	176.2	-73.2	-176.5	170.1	0	0	111.5	E110 S112 V116 E117 Q118	E110-E114 WeakPolarHBondContact O-CB 3.22Å; E110-E114 WeakPolarHBondContact O-CG 3.47Å; E110-E114 PolarHBondContact O-N 3.37Å; S112-E114 PolarHBondContact O-N 3.15Å; E114-V116 VanDerWaalsContact C-N 3.3Å; E114-V116 PolarHBondContact O-N 3.27Å; E114-E117 CarbonylContact O-C 3.45Å; E114-E117 PolarHBondContact O-N 2.78Å; E114-E117 VanDerWaalsContact O-N 3.14Å; E114-Q118 WeakPolarHBondContact O-CB 3.3Å; E114-Q118 WeakPolarHBondContact O-CG 3.49Å; E114-Q118 PolarHBondContact O-N 2.8Å
115	A	93.5	Very high	90.9	Very high	61 Å²	61	112 Å²	112	50%	0.504	52%	0.518	S	S	.	.	H	α-helix	trans	-59	-41.8	179.2	0	0	0	0	0	112.1	R111 S112 Q118 W119	R111-A115 VanDerWaalsContact O-CB 3.26Å; R111-A115 WeakPolarHBondContact O-CB 3.41Å; R111-A115 PolarHBondContact O-N 3.47Å; S112-A115 PolarHBondContact O-N 2.81Å; A115-Q118 PolarHBondContact O-N 2.93Å; A115-W119 WeakPolarHBondContact O-CB 3.33Å; A115-W119 PolarHBondContact O-N 2.93Å
116	V	89.9	Confident	89.9	Confident	60 Å²	60	110 Å²	110	36%	0.364	52%	0.519	S	S	.	.	H	α-helix	trans	-69.8	-38.7	177.1	-174.6	0	0	0	0	110.9	S112 R113 E114 R120	S112-V116 VanDerWaalsContact O-CG2 3.25Å; S112-V116 WeakPolarHBondContact O-CG2 3.35Å; S112-V116 PolarHBondContact O-N 3.3Å; R113-V116 PolarHBondContact O-N 3.45Å; E114-V116 VanDerWaalsContact C-N 3.3Å; E114-V116 PolarHBondContact O-N 3.27Å; V116-R120 VanDerWaalsContact CG1-NH2 3.26Å; V116-R120 WeakPolarHBondContact O-CB 3.25Å; V116-R120 VanDerWaalsContact O-CG 3.25Å; V116-R120 WeakPolarHBondContact O-CG 3.32Å; V116-R120 PolarHBondContact O-N 2.94Å; V116-R120 PolarHBondContact O-NE 2.98Å
117	E	86.8	Confident	88.8	Confident	70 Å²	70	112.3 Å²	112.3	33%	0.327	53%	0.531	S	S	.	.	H	α-helix	trans	-64	-42.5	173.5	-75.4	174.7	-163.5	0	0	112.6	R113 E114 R120 Q121	R113-E117 WeakPolarHBondContact CG-OE1 3.4Å; R113-E117 IonicContact CZ-OE1 3.93Å; R113-E117 IonicContact NH1-OE1 3.57Å; R113-E117 PolarHBondContact NH1-OE1 2.89Å; R113-E117 IonicContact NH1-OE2 3.91Å; R113-E117 WeakPolarHBondContact O-CB 3.43Å; R113-E117 WeakPolarHBondContact O-CG 3.2Å; R113-E117 PolarHBondContact O-N 2.81Å; E114-E117 CarbonylContact O-C 3.45Å; E114-E117 PolarHBondContact O-N 2.78Å; E114-E117 VanDerWaalsContact O-N 3.14Å; E117-R120 PolarHBondContact O-N 3.14Å; E117-Q121 WeakPolarHBondContact O-CG 3.46Å; E117-Q121 PolarHBondContact O-N 3.27Å
118	Q	91.3	Very high	87.3	Confident	123 Å²	123	115.8 Å²	115.8	58%	0.575	55%	0.547	S	S	*	.	H	α-helix	trans	-63.5	-48.3	176.4	-70	-67.5	-21.4	0	0	111.6	E114 A115 R120 Q121 W122	E114-Q118 WeakPolarHBondContact O-CB 3.3Å; E114-Q118 WeakPolarHBondContact O-CG 3.49Å; E114-Q118 PolarHBondContact O-N 2.8Å; A115-Q118 PolarHBondContact O-N 2.93Å; Q118-R120 VanDerWaalsContact C-N 3.26Å; Q118-R120 PolarHBondContact O-N 3.02Å; Q118-Q121 PolarHBondContact O-N 3.33Å; Q118-W122 PolarHBondContact O-N 2.76Å
119	W	90.3	Very high	85.9	Confident	165 Å²	165	116 Å²	116	63%	0.625	56%	0.558	S	S	*	*	H	α-helix	trans	-60	-39.2	176.4	-170.4	80.2	0	0	0	111.6	A115 W122 H123	A115-W119 WeakPolarHBondContact O-CB 3.33Å; A115-W119 PolarHBondContact O-N 2.93Å; W119-W122 PolarHBondContact O-N 2.91Å; W119-H123 AromaticContact CD1-CD2 3.98Å; W119-H123 AromaticContact CD2-CD2 3.64Å; W119-H123 AromaticContact CE2-CD2 3.21Å; W119-H123 AromaticContact CE2-NE2 3.4Å; W119-H123 AromaticContact CH2-CD2 3.95Å; W119-H123 AromaticContact CZ2-CD2 3.4Å; W119-H123 WeakPolarHBondContact CZ2-CD2 3.26Å; W119-H123 AromaticContact CZ2-NE2 3.42Å; W119-H123 WeakPolarHBondContact CZ2-NE2 3.32Å; W119-H123 AromaticContact NE1-CD2 3.43Å; W119-H123 PolarHBondContact NE1-CD2 3.24Å; W119-H123 AromaticContact NE1-NE2 3.34Å; W119-H123 PolarHBondContact NE1-NE2 3.26Å; W119-H123 PolarHBondContact O-CD2 3.49Å; W119-H123 PolarHBondContact O-N 3.35Å; W119-H123 VanDerWaalsContact O-N 3.09Å
120	R	84.9	Confident	84.4	Confident	122 Å²	122	113.5 Å²	113.5	46%	0.46	56%	0.556	S	S	.	*	H	α-helix	trans	-65.6	-42	175	-80.5	-174.5	-77.6	-135.2	3.6	113.2	V116 E117 Q118 W122 H123 Y124	V116-R120 VanDerWaalsContact CG1-NH2 3.26Å; V116-R120 WeakPolarHBondContact O-CB 3.25Å; V116-R120 VanDerWaalsContact O-CG 3.25Å; V116-R120 WeakPolarHBondContact O-CG 3.32Å; V116-R120 PolarHBondContact O-N 2.94Å; V116-R120 PolarHBondContact O-NE 2.98Å; E117-R120 PolarHBondContact O-N 3.14Å; Q118-R120 VanDerWaalsContact C-N 3.26Å; Q118-R120 PolarHBondContact O-N 3.02Å; R120-W122 VanDerWaalsContact C-N 3.32Å; R120-H123 CarbonylContact O-C 3.52Å; R120-H123 PolarHBondContact O-N 3.33Å; R120-Y124 PolarHBondContact O-N 3.34Å; R120-Y124 VanDerWaalsContact O-N 3.12Å
121	Q	84	Confident	82.8	Confident	127 Å²	127	115.3 Å²	115.3	59%	0.593	56%	0.559	S	S	*	*	H	α-helix	trans	-63.3	-39.9	175.4	-74.5	175.4	41.6	0	0	111.5	E117 Q118 H123 Y124	E117-Q121 WeakPolarHBondContact O-CG 3.46Å; E117-Q121 PolarHBondContact O-N 3.27Å; Q118-Q121 PolarHBondContact O-N 3.33Å; Q121-H123 VanDerWaalsContact C-N 3.34Å; Q121-H123 PolarHBondContact O-N 3.48Å; Q121-Y124 WeakPolarHBondContact O-CB 3.25Å; Q121-Y124 PolarHBondContact O-N 3.21Å
122	W	86.4	Confident	81.1	Confident	203 Å²	203	115.6 Å²	115.6	77%	0.769	57%	0.571	S	S	*	*	H	α-helix	trans	-65.2	-37.4	178	-166.3	77.5	0	0	0	112.7	Q118 W119 R120	Q118-W122 PolarHBondContact O-N 2.76Å; W119-W122 PolarHBondContact O-N 2.91Å; R120-W122 VanDerWaalsContact C-N 3.32Å
123	H	82.5	Confident	79.5	Confident	78 Å²	78	120.1 Å²	120.1	36%	0.361	58%	0.578	S	S	.	*	T	Hydrogen-bonded Turn	trans	-92.2	16.1	177.1	-77.2	-70.1	0	0	0	114.6	W119 R120 Q121 D125	W119-H123 AromaticContact CD1-CD2 3.98Å; W119-H123 AromaticContact CD2-CD2 3.64Å; W119-H123 AromaticContact CE2-CD2 3.21Å; W119-H123 AromaticContact CE2-NE2 3.4Å; W119-H123 AromaticContact CH2-CD2 3.95Å; W119-H123 AromaticContact CZ2-CD2 3.4Å; W119-H123 WeakPolarHBondContact CZ2-CD2 3.26Å; W119-H123 AromaticContact CZ2-NE2 3.42Å; W119-H123 WeakPolarHBondContact CZ2-NE2 3.32Å; W119-H123 AromaticContact NE1-CD2 3.43Å; W119-H123 PolarHBondContact NE1-CD2 3.24Å; W119-H123 AromaticContact NE1-NE2 3.34Å; W119-H123 PolarHBondContact NE1-NE2 3.26Å; W119-H123 PolarHBondContact O-CD2 3.49Å; W119-H123 PolarHBondContact O-N 3.35Å; W119-H123 VanDerWaalsContact O-N 3.09Å; R120-H123 CarbonylContact O-C 3.52Å; R120-H123 PolarHBondContact O-N 3.33Å; Q121-H123 VanDerWaalsContact C-N 3.34Å; Q121-H123 PolarHBondContact O-N 3.48Å; H123-D125 PolarHBondContact O-N 2.97Å
124	Y	77.2	Confident	77.7	Confident	154 Å²	154	120.1 Å²	120.1	60%	0.604	59%	0.587	S	S	*	*			trans	-76.2	88.5	-176.7	-172.1	-108.2	0	0	0	111.7	R120 Q121 G126	R120-Y124 PolarHBondContact O-N 3.34Å; R120-Y124 VanDerWaalsContact O-N 3.12Å; Q121-Y124 WeakPolarHBondContact O-CB 3.25Å; Q121-Y124 PolarHBondContact O-N 3.21Å; Y124-G126 VanDerWaalsContact C-N 3.26Å; Y124-G126 PolarHBondContact O-N 2.96Å
125	D	79	Confident	75.8	Confident	125 Å²	125	123.8 Å²	123.8	67%	0.668	60%	0.596	S	S	*	*			trans	-82.8	4.2	179.2	-64.8	-20	0	0	0	113.6	H123 L127	H123-D125 PolarHBondContact O-N 2.97Å; D125-L127 HydrophobicContact CB-CD1 4.25Å; D125-L127 PolarHBondContact O-N 3.5Å
126	G	76.5	Confident	74.2	Confident	50 Å²	50	128.1 Å²	128.1	52%	0.515	61%	0.606	S	S	.	*	S	Bend	trans	70.1	-5.8	-177.1	0	0	0	0	0	115.8	Y124	Y124-G126 VanDerWaalsContact C-N 3.26Å; Y124-G126 PolarHBondContact O-N 2.96Å
127	L	74.4	Confident	72.3	Confident	146 Å²	146	132.9 Å²	132.9	76%	0.764	62%	0.624	S	S	*	*			trans	-79.7	-18.5	-179.7	-81.9	149.4	0	0	0	114.1	D125	D125-L127 HydrophobicContact CB-CD1 4.25Å; D125-L127 PolarHBondContact O-N 3.5Å
128	H	66.8	Low	70.7	Confident	151 Å²	151	138.9 Å²	138.9	70%	0.699	67%	0.666	S	S	*	*	S	Bend	trans	-106.2	133.5	179.5	-69	-68.6	0	0	0	110.7	S130	H128-S130 PolarHBondContact O-N 3.39Å
129	P	67.7	Low	69.7	Low	120 Å²	120	139.7 Å²	139.7	78%	0.779	67%	0.67	S	S	*	*			trans	-58.8	141.3	176.5	23.2	-30.8	0	0	0	110	Y131	P129-Y131 PolarHBondContact O-N 3.05Å
130	S	65.1	Low	68.6	Low	86 Å²	86	138.4 Å²	138.4	60%	0.601	67%	0.673	S	S	*	*			trans	-53.6	129.8	171.6	59.8	0	0	0	0	108.4	H128 L132	H128-S130 PolarHBondContact O-N 3.39Å; S130-L132 PolarHBondContact O-N 2.92Å
131	Y	63.6	Low	67.7	Low	146 Å²	146	139.3 Å²	139.3	57%	0.573	68%	0.684	S	S	*	*			trans	-49.7	110.3	176.9	135.1	-93.3	0	0	0	108.8	P129 Y133	P129-Y131 PolarHBondContact O-N 3.05Å; Y131-Y133 AromaticContact CE1-CD2 3.68Å; Y131-Y133 HydrophobicContact CE1-CD2 3.68Å; Y131-Y133 HydrophobicContact CE1-CE2 4.49Å; Y131-Y133 HydrophobicContact CE1-CG 4.22Å; Y131-Y133 VanDerWaalsContact CZ-CA 3.43Å; Y131-Y133 AromaticContact CZ-CD2 3.55Å; Y131-Y133 AromaticContact CZ-CG 3.84Å; Y131-Y133 PolarHBondContact O-N 3.12Å; Y131-Y133 VanDerWaalsContact O-N 3.11Å; Y131-Y133 WeakPolarHBondContact OH-CD2 3.37Å; Y131-Y133 WeakPolarHBondContact OH-CE2 3.38Å; Y131-Y133 VanDerWaalsContact OH-CG 3.24Å
132	L	60.8	Low	66.7	Low	149 Å²	149	140 Å²	140	78%	0.78	69%	0.69	S	S	*	*			trans	-66.7	111.4	163.8	-74.1	167.7	0	0	0	103.9	S130 N134	S130-L132 PolarHBondContact O-N 2.92Å; L132-N134 PolarHBondContact O-N 3.4Å
133	Y	59.9	Low	65.5	Low	164 Å²	164	136.1 Å²	136.1	64%	0.643	69%	0.685	S	S	*	*			trans	-44.8	106.5	171.9	-158.5	-79.2	0	0	0	107	Y131 R135	Y131-Y133 AromaticContact CE1-CD2 3.68Å; Y131-Y133 HydrophobicContact CE1-CD2 3.68Å; Y131-Y133 HydrophobicContact CE1-CE2 4.49Å; Y131-Y133 HydrophobicContact CE1-CG 4.22Å; Y131-Y133 VanDerWaalsContact CZ-CA 3.43Å; Y131-Y133 AromaticContact CZ-CD2 3.55Å; Y131-Y133 AromaticContact CZ-CG 3.84Å; Y131-Y133 PolarHBondContact O-N 3.12Å; Y131-Y133 VanDerWaalsContact O-N 3.11Å; Y131-Y133 WeakPolarHBondContact OH-CD2 3.37Å; Y131-Y133 WeakPolarHBondContact OH-CE2 3.38Å; Y131-Y133 VanDerWaalsContact OH-CG 3.24Å; Y133-R135 HydrophobicContact CD1-CG 3.58Å; Y133-R135 HydrophobicContact CE1-CG 4.22Å; Y133-R135 PolarHBondContact O-N 3.09Å
134	N	57.3	Low	64.4	Low	119 Å²	119	139.9 Å²	139.9	64%	0.636	71%	0.706	S	S	*	*			trans	-64.7	76.5	172.9	-84.5	-20	0	0	0	106	L132 H136	L132-N134 PolarHBondContact O-N 3.4Å; N134-H136 PolarHBondContact O-CD2 3.34Å; N134-H136 PolarHBondContact O-N 3.45Å
135	R	53.8	Low	63.4	Low	181 Å²	181	138.9 Å²	138.9	68%	0.683	71%	0.714	S	S	*	*			trans	-67.7	92	161.2	-65.5	-172.6	-161.6	-128	2.1	103.7	Y133 H137	Y133-R135 HydrophobicContact CD1-CG 3.58Å; Y133-R135 HydrophobicContact CE1-CG 4.22Å; Y133-R135 PolarHBondContact O-N 3.09Å; R135-H137 WeakPolarHBondContact CB-CE1 3.42Å; R135-H137 VanDerWaalsContact CD-CE1 3.46Å; R135-H137 WeakPolarHBondContact CD-CE1 3.4Å; R135-H137 PolarHBondContact O-N 3.4Å
136	H	59.3	Low	62.3	Low	151 Å²	151	140 Å²	140	70%	0.699	72%	0.717	S	S	*	*			trans	-61.3	100	159	-70.2	-82.9	0	0	0	105.4	N134 T138	N134-H136 PolarHBondContact O-CD2 3.34Å; N134-H136 PolarHBondContact O-N 3.45Å; H136-T138 VanDerWaalsContact C-N 3.26Å; H136-T138 PolarHBondContact O-N 3.43Å
137	H	50.6	Low	61.1	Low	161 Å²	161	147.5 Å²	147.5	75%	0.745	73%	0.734	S	S	*	*			trans	-81.1	83.5	166.9	-62.8	-24.6	0	0	0	106.5	R135	R135-H137 WeakPolarHBondContact CB-CE1 3.42Å; R135-H137 VanDerWaalsContact CD-CE1 3.46Å; R135-H137 WeakPolarHBondContact CD-CE1 3.4Å; R135-H137 PolarHBondContact O-N 3.4Å
138	T	53.6	Low	59.9	Low	196 Å²	196	147.6 Å²	147.6	100%	1.202	73%	0.731	S	S	*	*			trans	-143.9	0	166.1	48.6	0	0	0	0	108.4	H136	H136-T138 VanDerWaalsContact C-N 3.26Å; H136-T138 PolarHBondContact O-N 3.43Å

Retrieved 138 of 138 residues in 308.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).