A0A075B717_HUMAN Loading...

POU class 2 homeobox 1

AlphaFold DB (Q16075), UniProt , Accession A0A075B717, Species HUMAN (Homo sapiens, Human), Gene POU2F1, Length 57 aa.

						>A0A075B717_HUMAN|A0A075B717|POU2F1
MADGGAASQDESSAAAAAAADWKSKKSFPAFLITKLLSVFNESVQRKNAVFLYLTQE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.3	Very low	50.4	Low	253 Å²	253	118.5 Å²	118.5	100%	1.246	74%	0.742	S	S	*	*				0	108.2	0	-80.3	147.2	168.9	0	0	107
2	A	50.4	Low	50.3	Low	103 Å²	103	115.4 Å²	115.4	85%	0.851	73%	0.728	S	S	*	*			trans	-140.6	97.2	174.7	0	0	0	0	0	106.2
3	D	51.2	Low	50.5	Low	157 Å²	157	111.2 Å²	111.2	84%	0.84	70%	0.704	S	S	*	*			trans	-171	120.5	136.2	-140.3	-18.1	0	0	0	109
4	G	54.6	Low	51.1	Low	77 Å²	77	107.9 Å²	107.9	79%	0.794	69%	0.692	S	S	*	*			trans	-176.2	14.5	-177	0	0	0	0	0	113.3
5	G	51.7	Low	51.6	Low	47 Å²	47	105 Å²	105	49%	0.485	68%	0.682	S	S	.	*	S	Bend	trans	-111.4	-7	-175.7	0	0	0	0	0	115
6	A	52.6	Low	52	Low	73 Å²	73	102 Å²	102	60%	0.603	67%	0.668	S	S	*	*	S	Bend	trans	-87	-23	-171.6	0	0	0	0	0	114.4
7	A	51.8	Low	52.5	Low	76 Å²	76	99.5 Å²	99.5	63%	0.628	66%	0.658	S	S	*	*	H	α-helix	trans	-77.2	-29.8	-174.2	0	0	0	0	0	113.5
8	S	53.1	Low	52.9	Low	90 Å²	90	97.4 Å²	97.4	63%	0.629	65%	0.65	S	S	*	*	H	α-helix	trans	-91.2	-17.1	-172.3	-45.1	0	0	0	0	114.2
9	Q	50.9	Low	53.3	Low	153 Å²	153	95.3 Å²	95.3	72%	0.715	64%	0.641	S	S	*	*	H	α-helix	trans	-89.2	-27.9	-172.1	-151.7	170.3	-11.9	0	0	112.4	S13	Q9-S13 PolarHBondContact O-OG 3.47Å
10	D	49.7	Very low	53.8	Low	126 Å²	126	94.2 Å²	94.2	67%	0.674	64%	0.638	S	S	*	*	H	α-helix	trans	-79.4	-36.3	-177.6	-145.4	-130.2	0	0	0	112.5	S13 A14	D10-S13 WeakPolarHBondContact CA-OG 3.37Å; D10-S13 PolarHBondContact O-N 2.95Å; D10-S13 PolarHBondContact O-OG 3.2Å; D10-A14 PolarHBondContact O-N 2.95Å
11	E	49	Very low	54.1	Low	148 Å²	148	94.2 Å²	94.2	69%	0.692	63%	0.632	S	S	*	*	H	α-helix	trans	-66.7	-37	174.7	-76.1	-177.2	110.1	0	0	112.5	S13 A14 A15	E11-S13 VanDerWaalsContact C-N 3.32Å; E11-S13 PolarHBondContact O-N 3.41Å; E11-A14 PolarHBondContact O-N 3.31Å; E11-A15 PolarHBondContact O-N 3.19Å; E11-A15 VanDerWaalsContact O-N 3.09Å
12	S	49.3	Very low	55	Low	82 Å²	82	88 Å²	88	57%	0.573	60%	0.595	S	S	*	*	H	α-helix	trans	-67	-34.4	177.9	-172.9	0	0	0	0	112	A16	S12-A16 VanDerWaalsContact O-CB 3.22Å; S12-A16 WeakPolarHBondContact O-CB 3.49Å; S12-A16 PolarHBondContact O-N 2.94Å
13	S	53.5	Low	55.7	Low	61 Å²	61	91.5 Å²	91.5	43%	0.427	59%	0.591	S	S	.	*	H	α-helix	trans	-73.1	-35.8	176.3	29.7	0	0	0	0	113.1	Q9 D10 E11 A16 A17	Q9-S13 PolarHBondContact O-OG 3.47Å; D10-S13 WeakPolarHBondContact CA-OG 3.37Å; D10-S13 PolarHBondContact O-N 2.95Å; D10-S13 PolarHBondContact O-OG 3.2Å; E11-S13 VanDerWaalsContact C-N 3.32Å; E11-S13 PolarHBondContact O-N 3.41Å; S13-A16 PolarHBondContact O-N 3.18Å; S13-A17 VanDerWaalsContact O-CB 3.25Å; S13-A17 WeakPolarHBondContact O-CB 3.45Å; S13-A17 PolarHBondContact O-N 2.79Å
14	A	58.3	Low	56.3	Low	64 Å²	64	86.7 Å²	86.7	53%	0.529	57%	0.569	S	S	.	*	H	α-helix	trans	-67.9	-42.5	175.8	0	0	0	0	0	111.9	D10 E11 A17 A18	D10-A14 PolarHBondContact O-N 2.95Å; E11-A14 PolarHBondContact O-N 3.31Å; A14-A17 PolarHBondContact O-N 3.38Å; A14-A18 WeakPolarHBondContact O-CB 3.29Å; A14-A18 PolarHBondContact O-N 3.09Å
15	A	58.8	Low	56.6	Low	65 Å²	65	92.4 Å²	92.4	54%	0.537	57%	0.573	S	S	.	*	H	α-helix	trans	-65.7	-39.3	174.8	0	0	0	0	0	112.2	E11 A19	E11-A15 PolarHBondContact O-N 3.19Å; E11-A15 VanDerWaalsContact O-N 3.09Å; A15-A19 VanDerWaalsContact O-CB 3.32Å; A15-A19 WeakPolarHBondContact O-CB 3.49Å; A15-A19 PolarHBondContact O-N 3.45Å
16	A	58.6	Low	57.2	Low	57 Å²	57	99.6 Å²	99.6	47%	0.471	59%	0.59	S	S	.	*	H	α-helix	trans	-69.5	-38.1	176.5	0	0	0	0	0	112.8	S12 S13 A19 A20	S12-A16 VanDerWaalsContact O-CB 3.22Å; S12-A16 WeakPolarHBondContact O-CB 3.49Å; S12-A16 PolarHBondContact O-N 2.94Å; S13-A16 PolarHBondContact O-N 3.18Å; A16-A19 CarbonylContact O-C 3.46Å; A16-A19 PolarHBondContact O-N 3.41Å; A16-A20 PolarHBondContact O-N 3.42Å
17	A	60.3	Low	57.8	Low	59 Å²	59	97.3 Å²	97.3	49%	0.488	57%	0.57	S	S	.	*	H	α-helix	trans	-65.3	-43.6	174.4	0	0	0	0	0	111.5	S13 A14 A19 A20 D21	S13-A17 VanDerWaalsContact O-CB 3.25Å; S13-A17 WeakPolarHBondContact O-CB 3.45Å; S13-A17 PolarHBondContact O-N 2.79Å; A14-A17 PolarHBondContact O-N 3.38Å; A17-A19 VanDerWaalsContact C-N 3.26Å; A17-A19 PolarHBondContact O-N 3.47Å; A17-A20 PolarHBondContact O-N 2.94Å; A17-D21 PolarHBondContact O-N 3.03Å; A17-D21 VanDerWaalsContact O-N 3.15Å
18	A	59.5	Low	58.9	Low	62 Å²	62	98.4 Å²	98.4	51%	0.512	56%	0.561	S	S	.	*	H	α-helix	trans	-62.5	-34.8	173.6	0	0	0	0	0	112.2	A14 A20	A14-A18 WeakPolarHBondContact O-CB 3.29Å; A14-A18 PolarHBondContact O-N 3.09Å; A18-A20 VanDerWaalsContact C-N 3.31Å; A18-A20 PolarHBondContact O-N 3.41Å
19	A	60.5	Low	60.2	Low	58 Å²	58	97.4 Å²	97.4	48%	0.479	55%	0.553	S	S	.	*	H	α-helix	trans	-78.3	-5.9	174.2	0	0	0	0	0	114.4	A15 A16 A17 W22	A15-A19 VanDerWaalsContact O-CB 3.32Å; A15-A19 WeakPolarHBondContact O-CB 3.49Å; A15-A19 PolarHBondContact O-N 3.45Å; A16-A19 CarbonylContact O-C 3.46Å; A16-A19 PolarHBondContact O-N 3.41Å; A17-A19 VanDerWaalsContact C-N 3.26Å; A17-A19 PolarHBondContact O-N 3.47Å; A19-W22 VanDerWaalsContact C-CD1 3.46Å; A19-W22 PolarHBondContact O-NE1 2.91Å
20	A	62.1	Low	61.7	Low	72 Å²	72	92.8 Å²	92.8	60%	0.595	54%	0.541	S	S	*	.	H	α-helix	trans	-96.9	-26.8	171.3	0	0	0	0	0	111.8	A16 A17 A18	A16-A20 PolarHBondContact O-N 3.42Å; A17-A20 PolarHBondContact O-N 2.94Å; A18-A20 VanDerWaalsContact C-N 3.31Å; A18-A20 PolarHBondContact O-N 3.41Å
21	D	61	Low	63.4	Low	95 Å²	95	90.3 Å²	90.3	51%	0.508	52%	0.524	S	S	.	.	H	α-helix	trans	-75.5	-25.2	-172.4	-141	-56.2	0	0	0	113.9	A17 K23 S24 S27	A17-D21 PolarHBondContact O-N 3.03Å; A17-D21 VanDerWaalsContact O-N 3.15Å; D21-K23 PolarHBondContact O-N 2.89Å; D21-S24 WeakPolarHBondContact O-CB 3.3Å; D21-S24 PolarHBondContact O-N 3.42Å; D21-S27 PolarHBondContact O-OG 2.83Å; D21-S27 WeakPolarHBondContact OD1-CB 3.24Å; D21-S27 PolarHBondContact OD1-OG 3.06Å
22	W	58.6	Low	65.2	Low	124 Å²	124	86.8 Å²	86.8	47%	0.47	51%	0.509	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60.2	-16.8	-176.5	65.9	-86.5	0	0	0	115.3	A19 S24 F31	A19-W22 VanDerWaalsContact C-CD1 3.46Å; A19-W22 PolarHBondContact O-NE1 2.91Å; W22-S24 PolarHBondContact O-N 3.31Å; W22-F31 HydrophobicContact CB-CD1 4.27Å; W22-F31 HydrophobicContact CB-CD2 4.25Å; W22-F31 HydrophobicContact CB-CG 4.12Å
23	K	63.8	Low	67	Low	176 Å²	176	87.7 Å²	87.7	77%	0.765	51%	0.507	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.9	-14.1	178	-151.6	170.9	-173.3	178.1	0	112.4	D21	D21-K23 PolarHBondContact O-N 2.89Å
24	S	63.9	Low	68.7	Low	55 Å²	55	89.2 Å²	89.2	39%	0.385	51%	0.513	S	S	.	.	S	Bend	trans	-81.2	125.9	174.9	173	0	0	0	0	111.2	D21 W22 K26 S27 F28	D21-S24 WeakPolarHBondContact O-CB 3.3Å; D21-S24 PolarHBondContact O-N 3.42Å; W22-S24 PolarHBondContact O-N 3.31Å; S24-K26 PolarHBondContact O-N 3.34Å; S24-K26 PolarHBondContact OG-N 2.87Å; S24-S27 WeakPolarHBondContact CB-OG 3.48Å; S24-S27 PolarHBondContact O-N 2.84Å; S24-S27 VanDerWaalsContact O-N 3.08Å; S24-S27 PolarHBondContact O-OG 3.47Å; S24-S27 VanDerWaalsContact O-OG 3.08Å; S24-F28 PolarHBondContact O-N 2.64Å; S24-F28 VanDerWaalsContact O-N 3.11Å
25	K	61.4	Low	70.2	Confident	198 Å²	198	91.7 Å²	91.7	86%	0.861	51%	0.512	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.3	-18.9	177.5	-69	-177.2	-179.5	-179.6	0	113.6
26	K	64.3	Low	71.8	Confident	197 Å²	197	94.5 Å²	94.5	86%	0.857	52%	0.517	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.3	-30.3	177.8	-74	-177.4	178.3	177.9	0	113.3	S24	S24-K26 PolarHBondContact O-N 3.34Å; S24-K26 PolarHBondContact OG-N 2.87Å
27	S	64.7	Low	73.5	Confident	26 Å²	26	96.9 Å²	96.9	18%	0.182	52%	0.522	C	S	.	.	T	Hydrogen-bonded Turn	trans	-97.5	-16.4	-177.9	57.8	0	0	0	0	112.8	D21 S24 A30 F31	D21-S27 PolarHBondContact O-OG 2.83Å; D21-S27 WeakPolarHBondContact OD1-CB 3.24Å; D21-S27 PolarHBondContact OD1-OG 3.06Å; S24-S27 WeakPolarHBondContact CB-OG 3.48Å; S24-S27 PolarHBondContact O-N 2.84Å; S24-S27 VanDerWaalsContact O-N 3.08Å; S24-S27 PolarHBondContact O-OG 3.47Å; S24-S27 VanDerWaalsContact O-OG 3.08Å; S27-A30 PolarHBondContact O-N 2.85Å; S27-A30 VanDerWaalsContact O-N 3.16Å; S27-F31 WeakPolarHBondContact O-CB 3.42Å; S27-F31 PolarHBondContact O-N 3.23Å
28	F	74.8	Confident	75.1	Confident	98 Å²	98	96.6 Å²	96.6	43%	0.43	52%	0.516	S	S	.	.	H	α-helix	trans	-55.3	-43.6	178.5	-174	-103	0	0	0	114.4	S24 A30 F31 L32	S24-F28 PolarHBondContact O-N 2.64Å; S24-F28 VanDerWaalsContact O-N 3.11Å; F28-A30 PolarHBondContact O-N 2.99Å; F28-F31 PolarHBondContact O-N 3.37Å; F28-L32 HydrophobicContact CD1-CD1 3.8Å; F28-L32 HydrophobicContact CD1-CG 4.39Å; F28-L32 HydrophobicContact CE1-CD1 3.29Å; F28-L32 HydrophobicContact CE1-CG 4.04Å; F28-L32 HydrophobicContact CE2-CD1 4.48Å; F28-L32 HydrophobicContact CE2-CG 4.4Å; F28-L32 HydrophobicContact CZ-CD1 3.68Å; F28-L32 HydrophobicContact CZ-CD2 4.25Å; F28-L32 HydrophobicContact CZ-CG 4.03Å; F28-L32 WeakPolarHBondContact O-CG 3.36Å; F28-L32 PolarHBondContact O-N 3.19Å
29	P	81.7	Confident	76.7	Confident	70 Å²	70	97.6 Å²	97.6	46%	0.455	52%	0.516	S	S	.	.	H	α-helix	trans	-63.4	-41.4	175.6	-22.3	34.7	0	0	0	112.8	L32 I33	P29-L32 PolarHBondContact O-N 2.94Å; P29-I33 WeakPolarHBondContact O-CD1 3.38Å; P29-I33 WeakPolarHBondContact O-CG1 3.48Å; P29-I33 PolarHBondContact O-N 2.69Å
30	A	82.8	Confident	78.3	Confident	56 Å²	56	101.4 Å²	101.4	46%	0.463	52%	0.522	S	S	.	.	H	α-helix	trans	-65.3	-44	177.9	0	0	0	0	0	111.2	S27 F28 L32 I33 T34	S27-A30 PolarHBondContact O-N 2.85Å; S27-A30 VanDerWaalsContact O-N 3.16Å; F28-A30 PolarHBondContact O-N 2.99Å; A30-L32 PolarHBondContact O-N 3.25Å; A30-I33 PolarHBondContact O-N 2.87Å; A30-T34 WeakPolarHBondContact O-CB 3.22Å; A30-T34 PolarHBondContact O-N 3.5Å; A30-T34 PolarHBondContact O-OG1 3.37Å
31	F	84.2	Confident	79.8	Confident	74 Å²	74	101.9 Å²	101.9	33%	0.325	52%	0.515	S	S	.	.	H	α-helix	trans	-58.2	-46.1	175.1	173.5	-98.5	0	0	0	112.3	W22 S27 F28 T34 K35	W22-F31 HydrophobicContact CB-CD1 4.27Å; W22-F31 HydrophobicContact CB-CD2 4.25Å; W22-F31 HydrophobicContact CB-CG 4.12Å; S27-F31 WeakPolarHBondContact O-CB 3.42Å; S27-F31 PolarHBondContact O-N 3.23Å; F28-F31 PolarHBondContact O-N 3.37Å; F31-T34 PolarHBondContact O-N 2.93Å; F31-K35 HydrophobicContact CD1-CG 4.47Å; F31-K35 HydrophobicContact CD2-CG 4.46Å; F31-K35 HydrophobicContact CE1-CG 4.01Å; F31-K35 HydrophobicContact CE2-CG 4Å; F31-K35 HydrophobicContact CZ-CD 4.39Å; F31-K35 HydrophobicContact CZ-CG 3.76Å; F31-K35 WeakPolarHBondContact O-CB 3.25Å; F31-K35 WeakPolarHBondContact O-CG 3.43Å; F31-K35 PolarHBondContact O-N 3.36Å
32	L	86.6	Confident	81.3	Confident	73 Å²	73	102.2 Å²	102.2	38%	0.382	51%	0.513	S	S	.	.	H	α-helix	trans	-61.5	-45.3	176.7	-77.8	176.7	0	0	0	111.8	F28 P29 A30 K35 L36	F28-L32 HydrophobicContact CD1-CD1 3.8Å; F28-L32 HydrophobicContact CD1-CG 4.39Å; F28-L32 HydrophobicContact CE1-CD1 3.29Å; F28-L32 HydrophobicContact CE1-CG 4.04Å; F28-L32 HydrophobicContact CE2-CD1 4.48Å; F28-L32 HydrophobicContact CE2-CG 4.4Å; F28-L32 HydrophobicContact CZ-CD1 3.68Å; F28-L32 HydrophobicContact CZ-CD2 4.25Å; F28-L32 HydrophobicContact CZ-CG 4.03Å; F28-L32 WeakPolarHBondContact O-CG 3.36Å; F28-L32 PolarHBondContact O-N 3.19Å; P29-L32 PolarHBondContact O-N 2.94Å; A30-L32 PolarHBondContact O-N 3.25Å; L32-K35 PolarHBondContact O-N 3.05Å; L32-L36 WeakPolarHBondContact O-CB 3.3Å; L32-L36 VanDerWaalsContact O-CG 3.28Å; L32-L36 WeakPolarHBondContact O-CG 3.31Å; L32-L36 PolarHBondContact O-N 3.5Å
33	I	88.4	Confident	82.9	Confident	101 Å²	101	98.9 Å²	98.9	52%	0.518	51%	0.508	S	S	.	.	H	α-helix	trans	-60.2	-48.9	177.5	-68.6	163.3	0	0	0	110.2	P29 A30 K35 L36 L37	P29-I33 WeakPolarHBondContact O-CD1 3.38Å; P29-I33 WeakPolarHBondContact O-CG1 3.48Å; P29-I33 PolarHBondContact O-N 2.69Å; A30-I33 PolarHBondContact O-N 2.87Å; I33-K35 VanDerWaalsContact C-N 3.32Å; I33-K35 PolarHBondContact O-N 3.28Å; I33-L36 PolarHBondContact O-N 3.02Å; I33-L37 HydrophobicContact CG2-CD1 3.86Å; I33-L37 HydrophobicContact CG2-CG 4.4Å; I33-L37 WeakPolarHBondContact O-CB 3.34Å; I33-L37 WeakPolarHBondContact O-CG 3.47Å; I33-L37 PolarHBondContact O-N 3.47Å
34	T	88.6	Confident	84.2	Confident	93 Å²	93	93.7 Å²	93.7	57%	0.571	49%	0.491	S	S	*	.	H	α-helix	trans	-59.6	-42.6	178	-58.7	0	0	0	0	111.6	A30 F31 L37 S38	A30-T34 WeakPolarHBondContact O-CB 3.22Å; A30-T34 PolarHBondContact O-N 3.5Å; A30-T34 PolarHBondContact O-OG1 3.37Å; F31-T34 PolarHBondContact O-N 2.93Å; T34-L37 PolarHBondContact O-N 3.05Å; T34-S38 WeakPolarHBondContact O-CB 3.32Å; T34-S38 PolarHBondContact O-N 3.01Å
35	K	89.4	Confident	85.5	Confident	117 Å²	117	96.5 Å²	96.5	51%	0.509	50%	0.498	S	S	.	.	H	α-helix	trans	-64.9	-44.1	176.9	-80.4	-65.8	-174.5	-174.7	0	112.6	F31 L32 I33 L37 S38 V39	F31-K35 HydrophobicContact CD1-CG 4.47Å; F31-K35 HydrophobicContact CD2-CG 4.46Å; F31-K35 HydrophobicContact CE1-CG 4.01Å; F31-K35 HydrophobicContact CE2-CG 4Å; F31-K35 HydrophobicContact CZ-CD 4.39Å; F31-K35 HydrophobicContact CZ-CG 3.76Å; F31-K35 WeakPolarHBondContact O-CB 3.25Å; F31-K35 WeakPolarHBondContact O-CG 3.43Å; F31-K35 PolarHBondContact O-N 3.36Å; L32-K35 PolarHBondContact O-N 3.05Å; I33-K35 VanDerWaalsContact C-N 3.32Å; I33-K35 PolarHBondContact O-N 3.28Å; K35-L37 VanDerWaalsContact C-N 3.35Å; K35-L37 PolarHBondContact O-N 3Å; K35-S38 PolarHBondContact O-N 3.15Å; K35-V39 WeakPolarHBondContact O-CG2 3.33Å; K35-V39 PolarHBondContact O-N 3.46Å
36	L	93.4	Very high	86.8	Confident	123 Å²	123	95.5 Å²	95.5	64%	0.644	49%	0.489	S	S	*	.	H	α-helix	trans	-62.7	-42.4	177.3	-71	170.6	0	0	0	111.5	L32 I33 V39 F40	L32-L36 WeakPolarHBondContact O-CB 3.3Å; L32-L36 VanDerWaalsContact O-CG 3.28Å; L32-L36 WeakPolarHBondContact O-CG 3.31Å; L32-L36 PolarHBondContact O-N 3.5Å; I33-L36 PolarHBondContact O-N 3.02Å; L36-V39 PolarHBondContact O-N 2.96Å; L36-F40 VanDerWaalsContact O-CB 3.28Å; L36-F40 WeakPolarHBondContact O-CB 3.42Å; L36-F40 PolarHBondContact O-N 3.46Å
37	L	94.3	Very high	88	Confident	108 Å²	108	93.5 Å²	93.5	57%	0.565	48%	0.481	S	S	*	.	H	α-helix	trans	-63.9	-41.6	176.2	-71.8	172.3	0	0	0	112.1	I33 T34 K35 F40 N41	I33-L37 HydrophobicContact CG2-CD1 3.86Å; I33-L37 HydrophobicContact CG2-CG 4.4Å; I33-L37 WeakPolarHBondContact O-CB 3.34Å; I33-L37 WeakPolarHBondContact O-CG 3.47Å; I33-L37 PolarHBondContact O-N 3.47Å; T34-L37 PolarHBondContact O-N 3.05Å; K35-L37 VanDerWaalsContact C-N 3.35Å; K35-L37 PolarHBondContact O-N 3Å; L37-F40 PolarHBondContact O-N 3.49Å; L37-N41 WeakPolarHBondContact O-CB 3.5Å; L37-N41 PolarHBondContact O-N 3.32Å
38	S	92.5	Very high	88.9	Confident	53 Å²	53	96.6 Å²	96.6	37%	0.371	50%	0.495	S	S	.	.	H	α-helix	trans	-60	-50.7	175.9	-164.7	0	0	0	0	111.3	T34 K35 F40 N41 E42	T34-S38 WeakPolarHBondContact O-CB 3.32Å; T34-S38 PolarHBondContact O-N 3.01Å; K35-S38 PolarHBondContact O-N 3.15Å; S38-F40 VanDerWaalsContact C-N 3.33Å; S38-F40 PolarHBondContact O-N 2.77Å; S38-N41 PolarHBondContact O-N 2.98Å; S38-E42 WeakPolarHBondContact O-CG 3.34Å; S38-E42 PolarHBondContact O-N 3.43Å; S38-E42 PolarHBondContact OG-OE1 2.9Å
39	V	94.3	Very high	89.5	Confident	83 Å²	83	94.6 Å²	94.6	50%	0.503	50%	0.497	S	S	.	.	H	α-helix	trans	-63.9	-39.4	180	172.9	0	0	0	0	111.4	K35 L36 S43	K35-V39 WeakPolarHBondContact O-CG2 3.33Å; K35-V39 PolarHBondContact O-N 3.46Å; L36-V39 PolarHBondContact O-N 2.96Å; V39-S43 VanDerWaalsContact O-CB 3.32Å; V39-S43 WeakPolarHBondContact O-CB 3.48Å; V39-S43 PolarHBondContact O-N 3.29Å; V39-S43 PolarHBondContact O-OG 2.96Å
40	F	94.1	Very high	89.7	Confident	138 Å²	138	95 Å²	95	61%	0.605	50%	0.497	S	S	*	.	H	α-helix	trans	-63	-48.5	175.9	178.6	-99.4	0	0	0	111.4	L36 L37 S38 S43 V44	L36-F40 VanDerWaalsContact O-CB 3.28Å; L36-F40 WeakPolarHBondContact O-CB 3.42Å; L36-F40 PolarHBondContact O-N 3.46Å; L37-F40 PolarHBondContact O-N 3.49Å; S38-F40 VanDerWaalsContact C-N 3.33Å; S38-F40 PolarHBondContact O-N 2.77Å; F40-S43 WeakPolarHBondContact O-CB 3.38Å; F40-S43 PolarHBondContact O-N 3.42Å; F40-V44 HydrophobicContact CD1-CG2 4.27Å; F40-V44 HydrophobicContact CE1-CG2 3.83Å; F40-V44 HydrophobicContact CE2-CG2 4.11Å; F40-V44 HydrophobicContact CZ-CG2 3.74Å; F40-V44 WeakPolarHBondContact O-CG2 3.32Å; F40-V44 PolarHBondContact O-N 2.65Å
41	N	93.3	Very high	89.8	Confident	82 Å²	82	98.3 Å²	98.3	44%	0.439	50%	0.502	S	S	.	.	H	α-helix	trans	-62.4	-46	-180	-171.4	43.8	0	0	0	111.7	L37 S38 S43 V44 Q45	L37-N41 WeakPolarHBondContact O-CB 3.5Å; L37-N41 PolarHBondContact O-N 3.32Å; S38-N41 PolarHBondContact O-N 2.98Å; N41-S43 VanDerWaalsContact C-N 3.29Å; N41-S43 PolarHBondContact O-N 2.9Å; N41-V44 PolarHBondContact O-N 3.01Å; N41-Q45 PolarHBondContact ND2-NE2 2.89Å; N41-Q45 WeakPolarHBondContact O-CB 3.44Å; N41-Q45 WeakPolarHBondContact O-CG 3.48Å; N41-Q45 PolarHBondContact O-N 3.3Å
42	E	92.7	Very high	89.6	Confident	102 Å²	102	99.4 Å²	99.4	48%	0.477	51%	0.51	S	S	.	.	H	α-helix	trans	-58.3	-40.6	174	-75.6	173.7	-144	0	0	112.2	S38 R46	S38-E42 WeakPolarHBondContact O-CG 3.34Å; S38-E42 PolarHBondContact O-N 3.43Å; S38-E42 PolarHBondContact OG-OE1 2.9Å; E42-R46 VanDerWaalsContact O-CB 3.3Å; E42-R46 WeakPolarHBondContact O-CB 3.48Å; E42-R46 PolarHBondContact O-N 3.41Å
43	S	91	Very high	89.4	Confident	53 Å²	53	104.4 Å²	104.4	37%	0.371	53%	0.526	S	S	.	.	H	α-helix	trans	-65.7	-41.6	177.9	-63.3	0	0	0	0	112.2	V39 F40 N41 K47	V39-S43 VanDerWaalsContact O-CB 3.32Å; V39-S43 WeakPolarHBondContact O-CB 3.48Å; V39-S43 PolarHBondContact O-N 3.29Å; V39-S43 PolarHBondContact O-OG 2.96Å; F40-S43 WeakPolarHBondContact O-CB 3.38Å; F40-S43 PolarHBondContact O-N 3.42Å; N41-S43 VanDerWaalsContact C-N 3.29Å; N41-S43 PolarHBondContact O-N 2.9Å; S43-K47 WeakPolarHBondContact O-CB 3.28Å; S43-K47 VanDerWaalsContact O-CG 3.32Å; S43-K47 WeakPolarHBondContact O-CG 3.4Å; S43-K47 PolarHBondContact O-N 2.99Å
44	V	91.9	Very high	89	Confident	67 Å²	67	104.9 Å²	104.9	41%	0.406	53%	0.528	S	S	.	.	H	α-helix	trans	-67.7	-46.6	176.7	171.5	0	0	0	0	110.6	F40 N41 R46 K47 N48	F40-V44 HydrophobicContact CD1-CG2 4.27Å; F40-V44 HydrophobicContact CE1-CG2 3.83Å; F40-V44 HydrophobicContact CE2-CG2 4.11Å; F40-V44 HydrophobicContact CZ-CG2 3.74Å; F40-V44 WeakPolarHBondContact O-CG2 3.32Å; F40-V44 PolarHBondContact O-N 2.65Å; N41-V44 PolarHBondContact O-N 3.01Å; V44-R46 VanDerWaalsContact C-N 3.33Å; V44-R46 PolarHBondContact O-N 3.45Å; V44-K47 PolarHBondContact O-N 2.89Å; V44-N48 WeakPolarHBondContact O-CB 3.32Å; V44-N48 PolarHBondContact O-N 3.39Å
45	Q	90.4	Very high	88.3	Confident	115 Å²	115	104.1 Å²	104.1	54%	0.537	52%	0.524	S	S	.	.	H	α-helix	trans	-59.5	-44.1	177.5	-74.7	-178.1	-11.6	0	0	111.6	N41 N48 A49	N41-Q45 PolarHBondContact ND2-NE2 2.89Å; N41-Q45 WeakPolarHBondContact O-CB 3.44Å; N41-Q45 WeakPolarHBondContact O-CG 3.48Å; N41-Q45 PolarHBondContact O-N 3.3Å; Q45-N48 PolarHBondContact O-N 3.27Å; Q45-A49 VanDerWaalsContact O-CB 3.3Å; Q45-A49 WeakPolarHBondContact O-CB 3.44Å; Q45-A49 PolarHBondContact O-N 3.02Å
46	R	90	Very high	87.1	Confident	176 Å²	176	106.9 Å²	106.9	66%	0.664	54%	0.539	S	S	*	.	H	α-helix	trans	-63.5	-44.1	176.9	-171.6	179.9	-67.7	163.6	1.9	111.8	E42 V44 N48 A49 V50	E42-R46 VanDerWaalsContact O-CB 3.3Å; E42-R46 WeakPolarHBondContact O-CB 3.48Å; E42-R46 PolarHBondContact O-N 3.41Å; V44-R46 VanDerWaalsContact C-N 3.33Å; V44-R46 PolarHBondContact O-N 3.45Å; R46-N48 VanDerWaalsContact C-N 3.35Å; R46-A49 PolarHBondContact O-N 2.89Å; R46-V50 WeakPolarHBondContact O-CB 3.28Å; R46-V50 VanDerWaalsContact O-CG2 3.24Å; R46-V50 WeakPolarHBondContact O-CG2 3.4Å; R46-V50 PolarHBondContact O-N 3Å
47	K	88.4	Confident	84.9	Confident	156 Å²	156	112.5 Å²	112.5	68%	0.678	56%	0.562	S	S	*	*	H	α-helix	trans	-63.1	-42	175.9	-75.2	177.1	-177.5	-179.3	0	112	S43 V44 V50 F51	S43-K47 WeakPolarHBondContact O-CB 3.28Å; S43-K47 VanDerWaalsContact O-CG 3.32Å; S43-K47 WeakPolarHBondContact O-CG 3.4Å; S43-K47 PolarHBondContact O-N 2.99Å; V44-K47 PolarHBondContact O-N 2.89Å; K47-V50 PolarHBondContact O-N 3.08Å; K47-F51 WeakPolarHBondContact O-CB 3.5Å; K47-F51 PolarHBondContact O-N 3.16Å
48	N	85.2	Confident	84.4	Confident	90 Å²	90	112.8 Å²	112.8	48%	0.481	56%	0.561	S	S	.	*	H	α-helix	trans	-66.4	-41.7	178.3	-164.9	38.8	0	0	0	111.5	V44 Q45 R46 F51 L52	V44-N48 WeakPolarHBondContact O-CB 3.32Å; V44-N48 PolarHBondContact O-N 3.39Å; Q45-N48 PolarHBondContact O-N 3.27Å; R46-N48 VanDerWaalsContact C-N 3.35Å; N48-F51 PolarHBondContact O-N 2.89Å; N48-L52 WeakPolarHBondContact O-CB 3.44Å; N48-L52 VanDerWaalsContact O-CG 3.31Å; N48-L52 WeakPolarHBondContact O-CG 3.49Å; N48-L52 PolarHBondContact O-N 3.39Å
49	A	85.8	Confident	84	Confident	57 Å²	57	115.9 Å²	115.9	47%	0.471	57%	0.572	S	S	.	*	H	α-helix	trans	-62.7	-42.9	174.8	0	0	0	0	0	112.1	Q45 R46 L52 Y53	Q45-A49 VanDerWaalsContact O-CB 3.3Å; Q45-A49 WeakPolarHBondContact O-CB 3.44Å; Q45-A49 PolarHBondContact O-N 3.02Å; R46-A49 PolarHBondContact O-N 2.89Å; A49-L52 PolarHBondContact O-N 2.93Å; A49-Y53 WeakPolarHBondContact O-CB 3.46Å; A49-Y53 PolarHBondContact O-N 3.26Å
50	V	86.9	Confident	83.4	Confident	77 Å²	77	117.7 Å²	117.7	47%	0.467	58%	0.575	S	S	.	*	H	α-helix	trans	-64.2	-42.9	174.8	170.7	0	0	0	0	111	R46 K47 Y53 L54	R46-V50 WeakPolarHBondContact O-CB 3.28Å; R46-V50 VanDerWaalsContact O-CG2 3.24Å; R46-V50 WeakPolarHBondContact O-CG2 3.4Å; R46-V50 PolarHBondContact O-N 3Å; K47-V50 PolarHBondContact O-N 3.08Å; V50-Y53 PolarHBondContact O-N 3.11Å; V50-L54 HydrophobicContact CG1-CD1 3.79Å; V50-L54 HydrophobicContact CG1-CG 4.35Å; V50-L54 WeakPolarHBondContact O-CB 3.41Å; V50-L54 VanDerWaalsContact O-CG 3.29Å; V50-L54 WeakPolarHBondContact O-CG 3.22Å; V50-L54 PolarHBondContact O-N 3.49Å
51	F	83.5	Confident	82.8	Confident	127 Å²	127	116.5 Å²	116.5	56%	0.557	57%	0.574	S	S	*	*	H	α-helix	trans	-61.1	-47.8	176.8	179.7	-98.2	0	0	0	111.6	K47 N48 Y53 L54 T55	K47-F51 WeakPolarHBondContact O-CB 3.5Å; K47-F51 PolarHBondContact O-N 3.16Å; N48-F51 PolarHBondContact O-N 2.89Å; F51-Y53 VanDerWaalsContact C-N 3.3Å; F51-Y53 PolarHBondContact O-N 3.44Å; F51-L54 PolarHBondContact O-N 3.42Å; F51-T55 HydrophobicContact CD1-CG2 4.46Å; F51-T55 HydrophobicContact CD2-CG2 4.34Å; F51-T55 HydrophobicContact CE1-CG2 3.98Å; F51-T55 HydrophobicContact CE2-CG2 3.85Å; F51-T55 HydrophobicContact CZ-CG2 3.66Å; F51-T55 WeakPolarHBondContact O-CB 3.34Å; F51-T55 PolarHBondContact O-N 3.16Å; F51-T55 PolarHBondContact O-OG1 3.47Å
52	L	81.9	Confident	82.1	Confident	96 Å²	96	118.7 Å²	118.7	50%	0.503	58%	0.582	S	S	.	*	H	α-helix	trans	-60.7	-39.2	176.5	-72.3	172	0	0	0	112.1	N48 A49 T55 Q56	N48-L52 WeakPolarHBondContact O-CB 3.44Å; N48-L52 VanDerWaalsContact O-CG 3.31Å; N48-L52 WeakPolarHBondContact O-CG 3.49Å; N48-L52 PolarHBondContact O-N 3.39Å; A49-L52 PolarHBondContact O-N 2.93Å; L52-T55 WeakPolarHBondContact CA-OG1 3.42Å; L52-T55 PolarHBondContact O-N 3.01Å; L52-Q56 WeakPolarHBondContact O-CB 3.45Å; L52-Q56 PolarHBondContact O-N 3.08Å
53	Y	80.6	Confident	81.4	Confident	179 Å²	179	119.8 Å²	119.8	70%	0.702	59%	0.589	S	S	*	*	H	α-helix	trans	-64.6	-41.2	175.7	-178.1	-97.2	0	0	0	112.3	A49 V50 F51	A49-Y53 WeakPolarHBondContact O-CB 3.46Å; A49-Y53 PolarHBondContact O-N 3.26Å; V50-Y53 PolarHBondContact O-N 3.11Å; F51-Y53 VanDerWaalsContact C-N 3.3Å; F51-Y53 PolarHBondContact O-N 3.44Å
54	L	80.1	Confident	80.7	Confident	110 Å²	110	124.6 Å²	124.6	58%	0.576	61%	0.605	S	S	*	*	H	α-helix	trans	-77.6	-18.3	179.4	-67.7	172.2	0	0	0	114	V50 F51	V50-L54 HydrophobicContact CG1-CD1 3.79Å; V50-L54 HydrophobicContact CG1-CG 4.35Å; V50-L54 WeakPolarHBondContact O-CB 3.41Å; V50-L54 VanDerWaalsContact O-CG 3.29Å; V50-L54 WeakPolarHBondContact O-CG 3.22Å; V50-L54 PolarHBondContact O-N 3.49Å; F51-L54 PolarHBondContact O-N 3.42Å
55	T	75.6	Confident	79.9	Confident	78 Å²	78	129 Å²	129	48%	0.479	62%	0.62	S	S	.	*	H	α-helix	trans	-101.9	-0.8	179.7	44.1	0	0	0	0	113.5	F51 L52 E57	F51-T55 HydrophobicContact CD1-CG2 4.46Å; F51-T55 HydrophobicContact CD2-CG2 4.34Å; F51-T55 HydrophobicContact CE1-CG2 3.98Å; F51-T55 HydrophobicContact CE2-CG2 3.85Å; F51-T55 HydrophobicContact CZ-CG2 3.66Å; F51-T55 WeakPolarHBondContact O-CB 3.34Å; F51-T55 PolarHBondContact O-N 3.16Å; F51-T55 PolarHBondContact O-OG1 3.47Å; L52-T55 WeakPolarHBondContact CA-OG1 3.42Å; L52-T55 PolarHBondContact O-N 3.01Å; T55-E57 VanDerWaalsContact C-N 3.34Å
56	Q	62.3	Low	79	Confident	175 Å²	175	130.2 Å²	130.2	82%	0.818	63%	0.627	S	S	*	*			trans	-87.6	3.4	173.1	-111.3	-177.5	3.7	0	0	114	L52	L52-Q56 WeakPolarHBondContact O-CB 3.45Å; L52-Q56 PolarHBondContact O-N 3.08Å
57	E	47.9	Very low	78	Confident	241 Å²	241	126 Å²	126	100%	1.126	62%	0.623	S	S	*	*			trans	-79	0	167.3	-71.9	-163.1	130.2	0	0	112.7	T55	T55-E57 VanDerWaalsContact C-N 3.34Å

Retrieved 57 of 57 residues in 18.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).