A0A087X2S3_POEFO Loading...

Transmembrane protein 14C

Required for normal heme biosynthesis.

AlphaFold DB (A0A3B3U8T8), UniProt , Accession A0A087X2S3, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 106 aa.

						>A0A087X2S3_POEFO|A0A087X2S3
MDWIGFGYALFVSAGGVIGYAKAGSVTSLVAGIVFGMAAAVGVYLTSQNPRNVWLSLGTAGTLAVVMGLRFVNSWKFMPAGLMTLASVLMLTKIIFGMLKSRQHKS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47	Very low	62.2	Low	223 Å²	223	131.5 Å²	131.5	100%	1.099	66%	0.664	S	S	*	*				0	99.6	0	-78.8	73.8	162	0	0	108.5	W3	M1-W3 VanDerWaalsContact C-N 3.35Å; M1-W3 PolarHBondContact O-N 3.49Å
2	D	48	Very low	62.8	Low	141 Å²	141	126.8 Å²	126.8	75%	0.754	65%	0.647	S	S	*	*			trans	-78.5	80	-166.9	-59.9	-91.9	0	0	0	112	I4 G5 F6	D2-I4 PolarHBondContact O-N 3.28Å; D2-I4 VanDerWaalsContact O-N 3.09Å; D2-G5 PolarHBondContact O-N 3.22Å; D2-F6 PolarHBondContact O-N 2.91Å
3	W	56.8	Low	63.4	Low	231 Å²	231	122.7 Å²	122.7	88%	0.875	64%	0.637	S	S	*	*	H	α-helix	trans	-49.7	-32.5	174.2	-166.3	-99.2	0	0	0	112.8	M1 G5 F6 G7	M1-W3 VanDerWaalsContact C-N 3.35Å; M1-W3 PolarHBondContact O-N 3.49Å; W3-G5 VanDerWaalsContact C-N 3.34Å; W3-G5 PolarHBondContact O-N 2.79Å; W3-F6 PolarHBondContact O-N 2.87Å; W3-G7 PolarHBondContact O-N 2.86Å; W3-G7 VanDerWaalsContact O-N 3.15Å
4	I	63.7	Low	64	Low	137 Å²	137	117.1 Å²	117.1	70%	0.703	62%	0.618	S	S	*	*	H	α-helix	trans	-66.6	-35.4	177.8	-60.8	173.7	0	0	0	111.6	D2 Y8	D2-I4 PolarHBondContact O-N 3.28Å; D2-I4 VanDerWaalsContact O-N 3.09Å; I4-Y8 WeakPolarHBondContact O-CB 3.31Å; I4-Y8 PolarHBondContact O-N 3.41Å; I4-Y8 VanDerWaalsContact O-N 3.07Å
5	G	62.8	Low	63.9	Low	42 Å²	42	112.3 Å²	112.3	43%	0.433	61%	0.607	S	S	.	*	H	α-helix	trans	-69	-39.2	178.2	0	0	0	0	0	112.1	D2 W3 Y8 A9	D2-G5 PolarHBondContact O-N 3.22Å; W3-G5 VanDerWaalsContact C-N 3.34Å; W3-G5 PolarHBondContact O-N 2.79Å; G5-Y8 PolarHBondContact O-N 3.09Å; G5-A9 WeakPolarHBondContact O-CB 3.2Å; G5-A9 PolarHBondContact O-N 2.95Å
6	F	65.9	Low	63.5	Low	162 Å²	162	108.1 Å²	108.1	71%	0.711	60%	0.598	S	S	*	*	H	α-helix	trans	-68.7	-42	177.9	-129.1	-90.2	0	0	0	111.8	D2 W3 Y8 A9 L10	D2-F6 PolarHBondContact O-N 2.91Å; W3-F6 PolarHBondContact O-N 2.87Å; F6-Y8 VanDerWaalsContact C-N 3.33Å; F6-Y8 PolarHBondContact O-N 2.81Å; F6-A9 PolarHBondContact O-N 3.18Å; F6-L10 WeakPolarHBondContact O-CB 3.49Å; F6-L10 PolarHBondContact O-N 3.47Å
7	G	76.1	Confident	63.3	Low	44 Å²	44	107.8 Å²	107.8	45%	0.454	60%	0.6	S	S	.	*	H	α-helix	trans	-61.4	-40.6	173.6	0	0	0	0	0	112.7	W3 F11	W3-G7 PolarHBondContact O-N 2.86Å; W3-G7 VanDerWaalsContact O-N 3.15Å; G7-F11 VanDerWaalsContact O-CB 3.31Å; G7-F11 WeakPolarHBondContact O-CB 3.22Å; G7-F11 PolarHBondContact O-N 3.45Å
8	Y	52.3	Low	63	Low	132 Å²	132	107.8 Å²	107.8	52%	0.518	60%	0.597	S	S	.	*	H	α-helix	trans	-67.5	-41.7	175.9	-170	-108.3	0	0	0	112.3	I4 G5 F6 F11 V12 K93	I4-Y8 WeakPolarHBondContact O-CB 3.31Å; I4-Y8 PolarHBondContact O-N 3.41Å; I4-Y8 VanDerWaalsContact O-N 3.07Å; G5-Y8 PolarHBondContact O-N 3.09Å; F6-Y8 VanDerWaalsContact C-N 3.33Å; F6-Y8 PolarHBondContact O-N 2.81Å; Y8-F11 PolarHBondContact O-N 2.73Å; Y8-V12 HydrophobicContact CD1-CG2 4.09Å; Y8-V12 HydrophobicContact CD2-CG2 4.44Å; Y8-V12 HydrophobicContact CE1-CG2 3.77Å; Y8-V12 HydrophobicContact CE2-CG2 4.14Å; Y8-V12 HydrophobicContact CG-CG2 4.42Å; Y8-V12 VanDerWaalsContact O-CB 3.28Å; Y8-V12 WeakPolarHBondContact O-CB 3.36Å; Y8-V12 VanDerWaalsContact O-CG2 3.25Å; Y8-V12 WeakPolarHBondContact O-CG2 3.15Å; Y8-V12 PolarHBondContact O-N 2.91Å; Y8-K93 PolarHBondContact OH-NZ 3.39Å
9	A	60.1	Low	62.4	Low	50 Å²	50	104.1 Å²	104.1	41%	0.413	59%	0.586	S	S	.	*	H	α-helix	trans	-64.5	-40.5	177.2	0	0	0	0	0	112.1	G5 F6 S13	G5-A9 WeakPolarHBondContact O-CB 3.2Å; G5-A9 PolarHBondContact O-N 2.95Å; F6-A9 PolarHBondContact O-N 3.18Å; A9-S13 WeakPolarHBondContact O-CB 3.4Å; A9-S13 PolarHBondContact O-N 3.16Å; A9-S13 PolarHBondContact O-OG 2.85Å
10	L	77.7	Confident	61.7	Low	121 Å²	121	109 Å²	109	63%	0.634	60%	0.596	S	S	*	*	H	α-helix	trans	-68.3	-40.3	177.9	-148.8	102.6	0	0	0	111.3	F6 S13 A14	F6-L10 WeakPolarHBondContact O-CB 3.49Å; F6-L10 PolarHBondContact O-N 3.47Å; L10-S13 PolarHBondContact O-N 2.99Å; L10-A14 VanDerWaalsContact O-CB 3.23Å; L10-A14 WeakPolarHBondContact O-CB 3.26Å; L10-A14 PolarHBondContact O-N 3.38Å
11	F	74.3	Confident	61.1	Low	163 Å²	163	108.1 Å²	108.1	72%	0.715	60%	0.603	S	S	*	*	H	α-helix	trans	-70	-40.7	178	-167.1	-96.9	0	0	0	112.3	G7 Y8 G15	G7-F11 VanDerWaalsContact O-CB 3.31Å; G7-F11 WeakPolarHBondContact O-CB 3.22Å; G7-F11 PolarHBondContact O-N 3.45Å; Y8-F11 PolarHBondContact O-N 2.73Å; F11-G15 PolarHBondContact O-N 2.84Å
12	V	69.2	Low	61	Low	76 Å²	76	105.7 Å²	105.7	46%	0.461	59%	0.587	S	S	.	*	H	α-helix	trans	-64.8	-41.2	173	165.2	0	0	0	0	110.9	Y8 G16	Y8-V12 HydrophobicContact CD1-CG2 4.09Å; Y8-V12 HydrophobicContact CD2-CG2 4.44Å; Y8-V12 HydrophobicContact CE1-CG2 3.77Å; Y8-V12 HydrophobicContact CE2-CG2 4.14Å; Y8-V12 HydrophobicContact CG-CG2 4.42Å; Y8-V12 VanDerWaalsContact O-CB 3.28Å; Y8-V12 WeakPolarHBondContact O-CB 3.36Å; Y8-V12 VanDerWaalsContact O-CG2 3.25Å; Y8-V12 WeakPolarHBondContact O-CG2 3.15Å; Y8-V12 PolarHBondContact O-N 2.91Å; V12-G16 PolarHBondContact O-N 2.79Å
13	S	70.8	Confident	61	Low	73 Å²	73	102.5 Å²	102.5	51%	0.51	58%	0.58	S	S	.	*	H	α-helix	trans	-69.1	-43	178.4	-58.6	0	0	0	0	111.4	A9 L10 G16 V17	A9-S13 WeakPolarHBondContact O-CB 3.4Å; A9-S13 PolarHBondContact O-N 3.16Å; A9-S13 PolarHBondContact O-OG 2.85Å; L10-S13 PolarHBondContact O-N 2.99Å; S13-G16 PolarHBondContact O-N 3.33Å; S13-V17 VanDerWaalsContact O-CG2 3.28Å; S13-V17 WeakPolarHBondContact O-CG2 3.18Å; S13-V17 PolarHBondContact O-N 2.8Å
14	A	71.1	Confident	60.6	Low	45 Å²	45	95.4 Å²	95.4	37%	0.372	58%	0.579	S	S	.	*	H	α-helix	trans	-64.2	-43.8	174.7	0	0	0	0	0	111.7	L10 G16 V17 I18	L10-A14 VanDerWaalsContact O-CB 3.23Å; L10-A14 WeakPolarHBondContact O-CB 3.26Å; L10-A14 PolarHBondContact O-N 3.38Å; A14-G16 VanDerWaalsContact C-N 3.31Å; A14-G16 PolarHBondContact O-N 2.8Å; A14-V17 PolarHBondContact O-N 3.4Å; A14-I18 WeakPolarHBondContact O-CB 3.43Å; A14-I18 WeakPolarHBondContact O-CD1 3.32Å; A14-I18 WeakPolarHBondContact O-CG1 3.5Å; A14-I18 PolarHBondContact O-N 2.84Å
15	G	63.3	Low	60	Low	44 Å²	44	92.1 Å²	92.1	45%	0.454	57%	0.567	S	S	.	*	H	α-helix	trans	-63.7	-35.3	174.9	0	0	0	0	0	113	F11 G19	F11-G15 PolarHBondContact O-N 2.84Å; G15-G19 PolarHBondContact O-N 2.75Å
16	G	56.8	Low	59.4	Low	45 Å²	45	95.4 Å²	95.4	46%	0.464	58%	0.579	S	S	.	*	H	α-helix	trans	-68.6	-45.1	175	0	0	0	0	0	112.7	V12 S13 A14 G19 Y20	V12-G16 PolarHBondContact O-N 2.79Å; S13-G16 PolarHBondContact O-N 3.33Å; A14-G16 VanDerWaalsContact C-N 3.31Å; A14-G16 PolarHBondContact O-N 2.8Å; G16-G19 PolarHBondContact O-N 3.42Å; G16-Y20 WeakPolarHBondContact O-CB 3.45Å; G16-Y20 PolarHBondContact O-N 3.03Å
17	V	60.4	Low	58.5	Low	104 Å²	104	92.5 Å²	92.5	63%	0.63	58%	0.575	S	S	*	*	H	α-helix	trans	-67.5	-42	178.4	174	0	0	0	0	111.2	S13 A14 G19 Y20 A21	S13-V17 VanDerWaalsContact O-CG2 3.28Å; S13-V17 WeakPolarHBondContact O-CG2 3.18Å; S13-V17 PolarHBondContact O-N 2.8Å; A14-V17 PolarHBondContact O-N 3.4Å; V17-G19 VanDerWaalsContact C-N 3.33Å; V17-Y20 PolarHBondContact O-N 3.22Å; V17-A21 WeakPolarHBondContact O-CB 3.29Å; V17-A21 PolarHBondContact O-N 2.99Å
18	I	57.1	Low	57.1	Low	107 Å²	107	94.7 Å²	94.7	55%	0.549	58%	0.583	S	S	.	*	H	α-helix	trans	-67.4	-35.4	175.4	-64.8	166.2	0	0	0	111	A14 K22	A14-I18 WeakPolarHBondContact O-CB 3.43Å; A14-I18 WeakPolarHBondContact O-CD1 3.32Å; A14-I18 WeakPolarHBondContact O-CG1 3.5Å; A14-I18 PolarHBondContact O-N 2.84Å; I18-K22 WeakPolarHBondContact O-CB 3.43Å; I18-K22 PolarHBondContact O-N 3.25Å
19	G	52.6	Low	57.1	Low	37 Å²	37	94.2 Å²	94.2	38%	0.381	59%	0.589	S	S	.	*	H	α-helix	trans	-66.9	-40.8	173.6	0	0	0	0	0	112.8	G15 G16 V17 K22 A23	G15-G19 PolarHBondContact O-N 2.75Å; G16-G19 PolarHBondContact O-N 3.42Å; V17-G19 VanDerWaalsContact C-N 3.33Å; G19-K22 PolarHBondContact O-N 2.72Å; G19-A23 WeakPolarHBondContact O-CB 3.13Å; G19-A23 PolarHBondContact O-N 3.46Å
20	Y	48.2	Very low	57.1	Low	203 Å²	203	95.5 Å²	95.5	80%	0.796	59%	0.592	S	S	*	*	H	α-helix	trans	-69.6	-39.6	179	-150.7	-93.5	0	0	0	112	G16 V17 K22	G16-Y20 WeakPolarHBondContact O-CB 3.45Å; G16-Y20 PolarHBondContact O-N 3.03Å; V17-Y20 PolarHBondContact O-N 3.22Å; Y20-K22 PolarHBondContact O-N 3.45Å
21	A	48.3	Very low	56	Low	90 Å²	90	92.1 Å²	92.1	74%	0.744	58%	0.581	S	S	*	*	H	α-helix	trans	-65.5	-20.7	175.3	0	0	0	0	0	113.4	V17	V17-A21 WeakPolarHBondContact O-CB 3.29Å; V17-A21 PolarHBondContact O-N 2.99Å
22	K	46.5	Very low	54.7	Low	173 Å²	173	86.5 Å²	86.5	75%	0.752	57%	0.569	S	S	*	*	H	α-helix	trans	-101	-19.1	-173.8	-163.2	172.2	-69.2	-161.7	0	114.3	I18 G19 Y20	I18-K22 WeakPolarHBondContact O-CB 3.43Å; I18-K22 PolarHBondContact O-N 3.25Å; G19-K22 PolarHBondContact O-N 2.72Å; Y20-K22 PolarHBondContact O-N 3.45Å
23	A	47.9	Very low	54.4	Low	73 Å²	73	87.5 Å²	87.5	60%	0.603	57%	0.571	S	S	*	*			trans	-93.5	12.5	-167.4	0	0	0	0	0	116.2	G19 S25	G19-A23 WeakPolarHBondContact O-CB 3.13Å; G19-A23 PolarHBondContact O-N 3.46Å; A23-S25 PolarHBondContact O-N 3.08Å
24	G	47.5	Very low	54.2	Low	83 Å²	83	88.3 Å²	88.3	86%	0.856	57%	0.572	S	S	*	*			trans	-45.3	87.5	-174.5	0	0	0	0	0	115.5
25	S	51.9	Low	53.5	Low	67 Å²	67	92.7 Å²	92.7	47%	0.469	58%	0.583	S	S	.	*			trans	-156.4	105.5	177.8	-158.1	0	0	0	0	112.1	A23 T27 S28	A23-S25 PolarHBondContact O-N 3.08Å; S25-T27 PolarHBondContact O-N 2.88Å; S25-T27 PolarHBondContact OG-OG1 3.47Å; S25-S28 PolarHBondContact O-N 2.89Å; S25-S28 VanDerWaalsContact O-N 3.11Å
26	V	49.3	Very low	53	Low	111 Å²	111	92.5 Å²	92.5	67%	0.673	58%	0.581	S	S	*	*	H	α-helix	trans	-49	-25.7	170.8	-161.1	0	0	0	0	111.9	S28 L29 V30	V26-S28 VanDerWaalsContact C-N 3.33Å; V26-S28 PolarHBondContact O-N 2.91Å; V26-L29 WeakPolarHBondContact O-CB 3.1Å; V26-L29 PolarHBondContact O-N 3.45Å; V26-V30 HydrophobicContact CG1-CG2 4.43Å; V26-V30 WeakPolarHBondContact O-CG2 3.35Å; V26-V30 PolarHBondContact O-N 2.89Å
27	T	48.2	Very low	53.3	Low	101 Å²	101	96.8 Å²	96.8	62%	0.62	59%	0.591	S	S	*	*	H	α-helix	trans	-59.9	-35.4	178	-23.7	0	0	0	0	113.7	S25 A31	S25-T27 PolarHBondContact O-N 2.88Å; S25-T27 PolarHBondContact OG-OG1 3.47Å; T27-A31 VanDerWaalsContact O-CB 3.25Å; T27-A31 WeakPolarHBondContact O-CB 3.25Å; T27-A31 PolarHBondContact O-N 2.95Å
28	S	44.8	Very low	53.1	Low	91 Å²	91	94.5 Å²	94.5	64%	0.636	58%	0.583	S	S	*	*	H	α-helix	trans	-78	-34.6	178.4	-166.5	0	0	0	0	111.9	S25 V26 A31 G32	S25-S28 PolarHBondContact O-N 2.89Å; S25-S28 VanDerWaalsContact O-N 3.11Å; V26-S28 VanDerWaalsContact C-N 3.33Å; V26-S28 PolarHBondContact O-N 2.91Å; S28-A31 PolarHBondContact O-N 3.26Å; S28-G32 PolarHBondContact O-N 3.02Å
29	L	53.8	Low	52.8	Low	121 Å²	121	92.2 Å²	92.2	63%	0.634	58%	0.58	S	S	*	*	H	α-helix	trans	-63.2	-45.1	171.9	-162.6	89.6	0	0	0	110.3	V26 G32 I33	V26-L29 WeakPolarHBondContact O-CB 3.1Å; V26-L29 PolarHBondContact O-N 3.45Å; L29-G32 PolarHBondContact O-N 3.36Å; L29-I33 HydrophobicContact CD2-CD1 4.19Å; L29-I33 HydrophobicContact CG-CD1 4.05Å; L29-I33 WeakPolarHBondContact O-CB 3.43Å; L29-I33 WeakPolarHBondContact O-CD1 3.39Å; L29-I33 WeakPolarHBondContact O-CG1 3.03Å; L29-I33 PolarHBondContact O-N 3.11Å
30	V	59.4	Low	52.8	Low	78 Å²	78	93.4 Å²	93.4	47%	0.473	59%	0.586	S	S	.	*	H	α-helix	trans	-66.1	-43.8	176.8	175.2	0	0	0	0	111.1	V26 G32 I33 V34	V26-V30 HydrophobicContact CG1-CG2 4.43Å; V26-V30 WeakPolarHBondContact O-CG2 3.35Å; V26-V30 PolarHBondContact O-N 2.89Å; V30-G32 VanDerWaalsContact C-N 3.33Å; V30-G32 PolarHBondContact O-N 3.33Å; V30-I33 PolarHBondContact O-N 3.45Å; V30-V34 HydrophobicContact CG1-CG2 4.22Å; V30-V34 WeakPolarHBondContact O-CB 3.36Å; V30-V34 WeakPolarHBondContact O-CG2 3.09Å; V30-V34 PolarHBondContact O-N 2.7Å
31	A	53.8	Low	53	Low	50 Å²	50	87.8 Å²	87.8	41%	0.413	57%	0.573	S	S	.	*	H	α-helix	trans	-62.4	-40.9	176.4	0	0	0	0	0	111.9	T27 S28 V34 F35	T27-A31 VanDerWaalsContact O-CB 3.25Å; T27-A31 WeakPolarHBondContact O-CB 3.25Å; T27-A31 PolarHBondContact O-N 2.95Å; S28-A31 PolarHBondContact O-N 3.26Å; A31-V34 PolarHBondContact O-N 3.34Å; A31-F35 WeakPolarHBondContact O-CB 3.4Å; A31-F35 PolarHBondContact O-N 3.23Å
32	G	48.1	Very low	53.1	Low	45 Å²	45	85.5 Å²	85.5	46%	0.464	56%	0.558	S	S	.	*	H	α-helix	trans	-65.8	-40.8	175.5	0	0	0	0	0	113.2	S28 L29 V30 G36	S28-G32 PolarHBondContact O-N 3.02Å; L29-G32 PolarHBondContact O-N 3.36Å; V30-G32 VanDerWaalsContact C-N 3.33Å; V30-G32 PolarHBondContact O-N 3.33Å; G32-G36 WeakPolarHBondContact O-CA 3.37Å; G32-G36 PolarHBondContact O-N 3.4Å
33	I	62.8	Low	53.2	Low	96 Å²	96	81.7 Å²	81.7	49%	0.492	55%	0.549	S	S	.	.	H	α-helix	trans	-67.3	-41.3	175.9	-68.9	165.6	0	0	0	110.8	L29 V30 M37	L29-I33 HydrophobicContact CD2-CD1 4.19Å; L29-I33 HydrophobicContact CG-CD1 4.05Å; L29-I33 WeakPolarHBondContact O-CB 3.43Å; L29-I33 WeakPolarHBondContact O-CD1 3.39Å; L29-I33 WeakPolarHBondContact O-CG1 3.03Å; L29-I33 PolarHBondContact O-N 3.11Å; V30-I33 PolarHBondContact O-N 3.45Å; I33-M37 WeakPolarHBondContact O-CB 3.19Å; I33-M37 PolarHBondContact O-N 3.07Å
34	V	65.4	Low	53.1	Low	90 Å²	90	86.3 Å²	86.3	55%	0.545	55%	0.552	S	S	.	*	H	α-helix	trans	-71.2	-45.9	-179.1	172.6	0	0	0	0	111.5	V30 A31 A38	V30-V34 HydrophobicContact CG1-CG2 4.22Å; V30-V34 WeakPolarHBondContact O-CB 3.36Å; V30-V34 WeakPolarHBondContact O-CG2 3.09Å; V30-V34 PolarHBondContact O-N 2.7Å; A31-V34 PolarHBondContact O-N 3.34Å; V34-A38 WeakPolarHBondContact O-CB 3.36Å; V34-A38 PolarHBondContact O-N 3.01Å
35	F	56.9	Low	53.1	Low	138 Å²	138	87.8 Å²	87.8	61%	0.605	54%	0.54	S	S	*	.	H	α-helix	trans	-68.9	-35.6	174.5	-97.1	-90.3	0	0	0	112.2	A31 A38 A39 M67	A31-F35 WeakPolarHBondContact O-CB 3.4Å; A31-F35 PolarHBondContact O-N 3.23Å; F35-A38 PolarHBondContact O-N 3.38Å; F35-A39 VanDerWaalsContact O-CB 3.31Å; F35-A39 WeakPolarHBondContact O-CB 3.32Å; F35-A39 PolarHBondContact O-N 2.76Å; F35-M67 HydrophobicContact CZ-CE 4.36Å
36	G	53.8	Low	52.6	Low	40 Å²	40	89.2 Å²	89.2	41%	0.412	55%	0.546	S	S	.	.	H	α-helix	trans	-64.7	-43.5	175.8	0	0	0	0	0	112.6	G32 A39 A40	G32-G36 WeakPolarHBondContact O-CA 3.37Å; G32-G36 PolarHBondContact O-N 3.4Å; G36-A39 PolarHBondContact O-N 2.64Å; G36-A40 VanDerWaalsContact O-CB 3.28Å; G36-A40 WeakPolarHBondContact O-CB 3.25Å; G36-A40 PolarHBondContact O-N 3.5Å
37	M	62.2	Low	52.4	Low	135 Å²	135	88.7 Å²	88.7	67%	0.665	55%	0.547	S	S	*	.	H	α-helix	trans	-65.4	-43.1	172.9	-84.2	-142.1	-176.9	0	0	112.1	I33 A39 A40 V41	I33-M37 WeakPolarHBondContact O-CB 3.19Å; I33-M37 PolarHBondContact O-N 3.07Å; M37-A39 VanDerWaalsContact C-N 3.32Å; M37-A39 PolarHBondContact O-N 2.89Å; M37-A40 PolarHBondContact O-N 3.2Å; M37-V41 WeakPolarHBondContact O-CB 3.32Å; M37-V41 VanDerWaalsContact O-CG2 3.24Å; M37-V41 WeakPolarHBondContact O-CG2 3.45Å; M37-V41 PolarHBondContact O-N 3.45Å
38	A	56	Low	52.2	Low	55 Å²	55	90.8 Å²	90.8	46%	0.455	55%	0.55	S	S	.	*	H	α-helix	trans	-62.1	-39.9	177.5	0	0	0	0	0	112.2	V34 F35 G42	V34-A38 WeakPolarHBondContact O-CB 3.36Å; V34-A38 PolarHBondContact O-N 3.01Å; F35-A38 PolarHBondContact O-N 3.38Å; A38-G42 PolarHBondContact O-N 3.49Å
39	A	50.9	Low	52.3	Low	60 Å²	60	91.3 Å²	91.3	50%	0.496	55%	0.545	S	S	.	.	H	α-helix	trans	-70.4	-42.4	176	0	0	0	0	0	112.2	F35 G36 M37 V41 G42 V43	F35-A39 VanDerWaalsContact O-CB 3.31Å; F35-A39 WeakPolarHBondContact O-CB 3.32Å; F35-A39 PolarHBondContact O-N 2.76Å; G36-A39 PolarHBondContact O-N 2.64Å; M37-A39 VanDerWaalsContact C-N 3.32Å; M37-A39 PolarHBondContact O-N 2.89Å; A39-V41 VanDerWaalsContact C-N 3.34Å; A39-V41 PolarHBondContact O-N 2.96Å; A39-G42 PolarHBondContact O-N 2.91Å; A39-V43 WeakPolarHBondContact O-CG2 3.49Å; A39-V43 PolarHBondContact O-N 3.19Å
40	A	53.1	Low	52	Low	62 Å²	62	92 Å²	92	51%	0.512	56%	0.557	S	S	.	*	H	α-helix	trans	-61.8	-42.6	176.9	0	0	0	0	0	111.6	G36 M37 V43 Y44	G36-A40 VanDerWaalsContact O-CB 3.28Å; G36-A40 WeakPolarHBondContact O-CB 3.25Å; G36-A40 PolarHBondContact O-N 3.5Å; M37-A40 PolarHBondContact O-N 3.2Å; A40-V43 PolarHBondContact O-N 2.92Å; A40-Y44 WeakPolarHBondContact O-CB 2.97Å; A40-Y44 PolarHBondContact O-N 3.11Å
41	V	53.4	Low	51.5	Low	85 Å²	85	99 Å²	99	52%	0.515	58%	0.575	S	S	.	*	H	α-helix	trans	-65.1	-44	173.2	174.2	0	0	0	0	110.2	M37 A39 V43 Y44 L45	M37-V41 WeakPolarHBondContact O-CB 3.32Å; M37-V41 VanDerWaalsContact O-CG2 3.24Å; M37-V41 WeakPolarHBondContact O-CG2 3.45Å; M37-V41 PolarHBondContact O-N 3.45Å; A39-V41 VanDerWaalsContact C-N 3.34Å; A39-V41 PolarHBondContact O-N 2.96Å; V41-V43 VanDerWaalsContact C-N 3.35Å; V41-V43 PolarHBondContact O-N 3.19Å; V41-Y44 PolarHBondContact O-N 3.35Å; V41-L45 HydrophobicContact CG1-CD1 3.4Å; V41-L45 VanDerWaalsContact CG1-CD1 3.4Å; V41-L45 WeakPolarHBondContact O-CD1 3.33Å; V41-L45 PolarHBondContact O-N 3.47Å
42	G	49.8	Very low	51.2	Low	42 Å²	42	100.3 Å²	100.3	43%	0.433	58%	0.575	S	S	.	*	H	α-helix	trans	-58	-40.7	176.6	0	0	0	0	0	114.3	A38 A39 T46	A38-G42 PolarHBondContact O-N 3.49Å; A39-G42 PolarHBondContact O-N 2.91Å; G42-T46 PolarHBondContact O-N 3.35Å; G42-T46 VanDerWaalsContact O-N 3.11Å
43	V	49.3	Very low	51.4	Low	93 Å²	93	103 Å²	103	56%	0.564	58%	0.583	S	S	*	*	H	α-helix	trans	-76.3	-34.2	177.1	-179.2	0	0	0	0	111.4	A39 A40 V41 L45 T46 S47	A39-V43 WeakPolarHBondContact O-CG2 3.49Å; A39-V43 PolarHBondContact O-N 3.19Å; A40-V43 PolarHBondContact O-N 2.92Å; V41-V43 VanDerWaalsContact C-N 3.35Å; V41-V43 PolarHBondContact O-N 3.19Å; V43-L45 VanDerWaalsContact C-N 3.32Å; V43-L45 PolarHBondContact O-N 2.92Å; V43-T46 HydrophobicContact CG1-CG2 4.29Å; V43-T46 WeakPolarHBondContact O-CG2 3.44Å; V43-T46 PolarHBondContact O-N 2.89Å; V43-S47 PolarHBondContact O-N 3.42Å; V43-S47 VanDerWaalsContact O-N 3.13Å
44	Y	44.5	Very low	50.8	Low	170 Å²	170	109.5 Å²	109.5	67%	0.667	60%	0.601	S	S	*	*	H	α-helix	trans	-66	-36.1	176	-153.4	-100.6	0	0	0	112	A40 V41	A40-Y44 WeakPolarHBondContact O-CB 2.97Å; A40-Y44 PolarHBondContact O-N 3.11Å; V41-Y44 PolarHBondContact O-N 3.35Å
45	L	48.3	Very low	49.9	Very low	113 Å²	113	110.1 Å²	110.1	59%	0.592	60%	0.601	S	S	*	*	H	α-helix	trans	-72.9	-30.9	172.1	-81.2	97.2	0	0	0	113.2	V41 V43 S47	V41-L45 HydrophobicContact CG1-CD1 3.4Å; V41-L45 VanDerWaalsContact CG1-CD1 3.4Å; V41-L45 WeakPolarHBondContact O-CD1 3.33Å; V41-L45 PolarHBondContact O-N 3.47Å; V43-L45 VanDerWaalsContact C-N 3.32Å; V43-L45 PolarHBondContact O-N 2.92Å; L45-S47 VanDerWaalsContact C-N 3.32Å; L45-S47 PolarHBondContact O-N 2.95Å
46	T	41.8	Very low	49.2	Very low	98 Å²	98	106.2 Å²	106.2	60%	0.601	59%	0.59	S	S	*	*	H	α-helix	trans	-72.1	-25.5	178.6	-144.2	0	0	0	0	113.1	G42 V43	G42-T46 PolarHBondContact O-N 3.35Å; G42-T46 VanDerWaalsContact O-N 3.11Å; V43-T46 HydrophobicContact CG1-CG2 4.29Å; V43-T46 WeakPolarHBondContact O-CG2 3.44Å; V43-T46 PolarHBondContact O-N 2.89Å
47	S	43.8	Very low	49.2	Very low	100 Å²	100	110.3 Å²	110.3	70%	0.699	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.1	-11.2	-172.6	-164.5	0	0	0	0	115.1	V43 L45	V43-S47 PolarHBondContact O-N 3.42Å; V43-S47 VanDerWaalsContact O-N 3.13Å; L45-S47 VanDerWaalsContact C-N 3.32Å; L45-S47 PolarHBondContact O-N 2.95Å
48	Q	45.2	Very low	48.8	Very low	145 Å²	145	105.6 Å²	105.6	68%	0.678	59%	0.589	S	S	*	*	S	Bend	trans	-103.6	-18.6	-171	-86.7	-161.9	63.9	0	0	116.6
49	N	46.9	Very low	48.4	Very low	101 Å²	101	107 Å²	107	54%	0.54	59%	0.592	S	S	.	*			trans	-155.7	100.7	-178.4	-147.1	66.4	0	0	0	113.7	R51 N52	N49-R51 PolarHBondContact O-N 2.88Å; N49-N52 PolarHBondContact O-N 3.47Å
50	P	46.7	Very low	48.3	Very low	136 Å²	136	107.1 Å²	107.1	88%	0.883	59%	0.592	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.7	41.2	-179	33.2	-36.3	0	0	0	113
51	R	48.7	Very low	48.2	Very low	225 Å²	225	105.8 Å²	105.8	85%	0.849	59%	0.585	S	S	*	*	T	Hydrogen-bonded Turn	trans	-141	9.3	176.7	-163.1	172.3	-93.9	-168.6	-5.7	112.9	N49	N49-R51 PolarHBondContact O-N 2.88Å
52	N	48.2	Very low	48.3	Very low	77 Å²	77	106 Å²	106	41%	0.412	59%	0.586	S	S	.	*			trans	-114.5	30.3	-175.1	-133	54.5	0	0	0	113.5	N49 W54 L55 S56	N49-N52 PolarHBondContact O-N 3.47Å; N52-W54 PolarHBondContact O-N 2.9Å; N52-L55 WeakPolarHBondContact ND2-CB 3.41Å; N52-L55 WeakPolarHBondContact ND2-CD1 3.28Å; N52-L55 PolarHBondContact O-N 2.8Å; N52-L55 VanDerWaalsContact O-N 3.08Å; N52-S56 PolarHBondContact O-N 2.84Å
53	V	52.7	Low	48.3	Very low	102 Å²	102	109.3 Å²	109.3	62%	0.618	59%	0.593	S	S	*	*	H	α-helix	trans	-56	-34.9	178.6	-171.7	0	0	0	0	111.1	L55 L57	V53-L55 PolarHBondContact O-N 2.89Å; V53-L57 WeakPolarHBondContact O-CB 3.24Å; V53-L57 PolarHBondContact O-N 3.26Å
54	W	49.1	Very low	48.5	Very low	232 Å²	232	107.8 Å²	107.8	88%	0.879	59%	0.591	S	S	*	*	H	α-helix	trans	-64.3	-36.6	177.6	-121.4	-105.9	0	0	0	113.8	N52 G58	N52-W54 PolarHBondContact O-N 2.9Å; W54-G58 PolarHBondContact O-N 2.86Å
55	L	47	Very low	48.9	Very low	104 Å²	104	103.9 Å²	103.9	55%	0.545	58%	0.584	S	S	.	*	H	α-helix	trans	-77.7	-43	-176.9	-133.7	131.2	0	0	0	109.7	N52 V53 L57 G58 T59	N52-L55 WeakPolarHBondContact ND2-CB 3.41Å; N52-L55 WeakPolarHBondContact ND2-CD1 3.28Å; N52-L55 PolarHBondContact O-N 2.8Å; N52-L55 VanDerWaalsContact O-N 3.08Å; V53-L55 PolarHBondContact O-N 2.89Å; L55-L57 VanDerWaalsContact C-N 3.35Å; L55-L57 PolarHBondContact O-N 3.38Å; L55-G58 WeakPolarHBondContact O-CA 3.44Å; L55-G58 PolarHBondContact O-N 3.44Å; L55-G58 VanDerWaalsContact O-N 3.16Å; L55-T59 PolarHBondContact O-N 3.5Å; L55-T59 PolarHBondContact O-OG1 3.4Å
56	S	42.3	Very low	49.4	Very low	55 Å²	55	102.7 Å²	102.7	39%	0.385	58%	0.582	S	S	.	*	H	α-helix	trans	-64.6	-34.5	173.6	-73.3	0	0	0	0	113.4	N52 A60	N52-S56 PolarHBondContact O-N 2.84Å; S56-A60 WeakPolarHBondContact O-CB 3.47Å; S56-A60 PolarHBondContact O-N 3.25Å
57	L	53.4	Low	49.7	Very low	126 Å²	126	103 Å²	103	66%	0.66	58%	0.578	S	S	*	*	H	α-helix	trans	-68.6	-38.6	172.6	-140.8	76.1	0	0	0	111.3	V53 L55 G61	V53-L57 WeakPolarHBondContact O-CB 3.24Å; V53-L57 PolarHBondContact O-N 3.26Å; L55-L57 VanDerWaalsContact C-N 3.35Å; L55-L57 PolarHBondContact O-N 3.38Å; L57-G61 WeakPolarHBondContact O-CA 3.19Å; L57-G61 PolarHBondContact O-N 3.3Å
58	G	53	Low	49.9	Very low	37 Å²	37	99.8 Å²	99.8	38%	0.381	56%	0.56	S	S	.	*	H	α-helix	trans	-61.9	-53	173.8	0	0	0	0	0	111.9	W54 L55 G61 T62	W54-G58 PolarHBondContact O-N 2.86Å; L55-G58 WeakPolarHBondContact O-CA 3.44Å; L55-G58 PolarHBondContact O-N 3.44Å; L55-G58 VanDerWaalsContact O-N 3.16Å; G58-G61 PolarHBondContact O-N 3.33Å; G58-T62 WeakPolarHBondContact O-CB 3.44Å; G58-T62 PolarHBondContact O-N 2.85Å; G58-T62 PolarHBondContact O-OG1 3.34Å
59	T	48.5	Very low	49.9	Very low	85 Å²	85	98.3 Å²	98.3	52%	0.521	56%	0.556	S	S	.	*	H	α-helix	trans	-66.6	-41.2	179.1	-3.4	0	0	0	0	112.1	L55 T62 L63	L55-T59 PolarHBondContact O-N 3.5Å; L55-T59 PolarHBondContact O-OG1 3.4Å; T59-T62 PolarHBondContact O-N 3.49Å; T59-L63 VanDerWaalsContact O-CB 3.29Å; T59-L63 WeakPolarHBondContact O-CB 3.35Å; T59-L63 PolarHBondContact O-N 3.46Å
60	A	48.7	Very low	49.9	Very low	61 Å²	61	102.6 Å²	102.6	50%	0.504	57%	0.565	S	S	.	*	H	α-helix	trans	-65.6	-38.8	175.6	0	0	0	0	0	111.8	S56 A64	S56-A60 WeakPolarHBondContact O-CB 3.47Å; S56-A60 PolarHBondContact O-N 3.25Å; A60-A64 WeakPolarHBondContact O-CB 3.31Å; A60-A64 PolarHBondContact O-N 2.9Å
61	G	52.1	Low	49.9	Very low	34 Å²	34	104.7 Å²	104.7	35%	0.351	56%	0.56	S	S	.	*	H	α-helix	trans	-64.7	-44.2	173	0	0	0	0	0	112.2	L57 G58 A64 V65	L57-G61 WeakPolarHBondContact O-CA 3.19Å; L57-G61 PolarHBondContact O-N 3.3Å; G58-G61 PolarHBondContact O-N 3.33Å; G61-A64 PolarHBondContact O-N 3.13Å; G61-V65 VanDerWaalsContact O-CB 3.26Å; G61-V65 WeakPolarHBondContact O-CB 3.21Å; G61-V65 WeakPolarHBondContact O-CG2 3.34Å; G61-V65 PolarHBondContact O-N 2.96Å
62	T	54.4	Low	49.8	Very low	90 Å²	90	99.4 Å²	99.4	55%	0.552	55%	0.553	S	S	*	*	H	α-helix	trans	-66.2	-41.1	176	-54.4	0	0	0	0	111.4	G58 T59 V65 V66	G58-T62 WeakPolarHBondContact O-CB 3.44Å; G58-T62 PolarHBondContact O-N 2.85Å; G58-T62 PolarHBondContact O-OG1 3.34Å; T59-T62 PolarHBondContact O-N 3.49Å; T62-V65 PolarHBondContact O-N 2.83Å; T62-V66 HydrophobicContact CG2-CG2 4.43Å; T62-V66 WeakPolarHBondContact O-CB 3.49Å; T62-V66 WeakPolarHBondContact O-CG2 3.28Å; T62-V66 PolarHBondContact O-N 3.33Å
63	L	50	Low	49.4	Very low	111 Å²	111	102.4 Å²	102.4	58%	0.581	57%	0.569	S	S	*	*	H	α-helix	trans	-67.6	-38.5	176.8	-145.2	71.6	0	0	0	111.6	T59 M67	T59-L63 VanDerWaalsContact O-CB 3.29Å; T59-L63 WeakPolarHBondContact O-CB 3.35Å; T59-L63 PolarHBondContact O-N 3.46Å; L63-M67 VanDerWaalsContact O-CB 3.25Å; L63-M67 WeakPolarHBondContact O-CB 3.39Å; L63-M67 WeakPolarHBondContact O-CG 3.28Å; L63-M67 PolarHBondContact O-N 2.96Å
64	A	52.8	Low	49	Very low	62 Å²	62	101.4 Å²	101.4	51%	0.512	57%	0.566	S	S	.	*	H	α-helix	trans	-70	-36.5	175.1	0	0	0	0	0	112.3	A60 G61 G68	A60-A64 WeakPolarHBondContact O-CB 3.31Å; A60-A64 PolarHBondContact O-N 2.9Å; G61-A64 PolarHBondContact O-N 3.13Å; A64-G68 VanDerWaalsContact O-CA 3.32Å; A64-G68 WeakPolarHBondContact O-CA 3.33Å; A64-G68 PolarHBondContact O-N 3.29Å
65	V	54.3	Low	48.9	Very low	87 Å²	87	102 Å²	102	53%	0.527	57%	0.568	S	S	.	*	H	α-helix	trans	-71.1	-40.8	174.9	168.2	0	0	0	0	110.6	G61 T62 G68 L69	G61-V65 VanDerWaalsContact O-CB 3.26Å; G61-V65 WeakPolarHBondContact O-CB 3.21Å; G61-V65 WeakPolarHBondContact O-CG2 3.34Å; G61-V65 PolarHBondContact O-N 2.96Å; T62-V65 PolarHBondContact O-N 2.83Å; V65-G68 PolarHBondContact O-N 2.94Å; V65-L69 HydrophobicContact CG1-CD1 3.56Å; V65-L69 HydrophobicContact CG1-CG 4.32Å; V65-L69 WeakPolarHBondContact O-CB 3.4Å; V65-L69 WeakPolarHBondContact O-CD1 3.43Å; V65-L69 VanDerWaalsContact O-CG 3.31Å; V65-L69 WeakPolarHBondContact O-CG 3.38Å; V65-L69 PolarHBondContact O-N 2.96Å
66	V	57	Low	48.8	Very low	88 Å²	88	106.1 Å²	106.1	53%	0.533	58%	0.582	S	S	.	*	H	α-helix	trans	-66.9	-43.8	174.8	170.1	0	0	0	0	111.4	T62 R70	T62-V66 HydrophobicContact CG2-CG2 4.43Å; T62-V66 WeakPolarHBondContact O-CB 3.49Å; T62-V66 WeakPolarHBondContact O-CG2 3.28Å; T62-V66 PolarHBondContact O-N 3.33Å; V66-R70 WeakPolarHBondContact O-CB 3.37Å; V66-R70 PolarHBondContact O-N 2.91Å; V66-R70 VanDerWaalsContact O-N 3.09Å
67	M	48.8	Very low	49.3	Very low	105 Å²	105	112.7 Å²	112.7	52%	0.517	60%	0.604	S	S	.	*	H	α-helix	trans	-70.5	-33.9	175	-76.9	-82.2	-176.4	0	0	112.2	F35 L63 F71	F35-M67 HydrophobicContact CZ-CE 4.36Å; L63-M67 VanDerWaalsContact O-CB 3.25Å; L63-M67 WeakPolarHBondContact O-CB 3.39Å; L63-M67 WeakPolarHBondContact O-CG 3.28Å; L63-M67 PolarHBondContact O-N 2.96Å; M67-F71 WeakPolarHBondContact O-CB 3.28Å; M67-F71 PolarHBondContact O-N 2.9Å
68	G	47.8	Very low	48.9	Very low	32 Å²	32	114.6 Å²	114.6	33%	0.33	61%	0.611	S	S	.	*	H	α-helix	trans	-74.3	-43.2	178.8	0	0	0	0	0	113.2	A64 V65 R70 F71 V72	A64-G68 VanDerWaalsContact O-CA 3.32Å; A64-G68 WeakPolarHBondContact O-CA 3.33Å; A64-G68 PolarHBondContact O-N 3.29Å; V65-G68 PolarHBondContact O-N 2.94Å; G68-R70 VanDerWaalsContact C-N 3.29Å; G68-R70 PolarHBondContact O-N 3.45Å; G68-F71 PolarHBondContact O-N 3.43Å; G68-V72 WeakPolarHBondContact O-CG2 3.35Å; G68-V72 PolarHBondContact O-N 3.36Å
69	L	44.8	Very low	48.6	Very low	114 Å²	114	117.6 Å²	117.6	60%	0.597	62%	0.624	S	S	*	*	H	α-helix	trans	-65.4	-34.6	172	-76.9	163.5	0	0	0	111.3	V65 N73	V65-L69 HydrophobicContact CG1-CD1 3.56Å; V65-L69 HydrophobicContact CG1-CG 4.32Å; V65-L69 WeakPolarHBondContact O-CB 3.4Å; V65-L69 WeakPolarHBondContact O-CD1 3.43Å; V65-L69 VanDerWaalsContact O-CG 3.31Å; V65-L69 WeakPolarHBondContact O-CG 3.38Å; V65-L69 PolarHBondContact O-N 2.96Å; L69-N73 PolarHBondContact O-N 3.46Å
70	R	47.7	Very low	48.7	Very low	192 Å²	192	116.6 Å²	116.6	73%	0.725	63%	0.625	S	S	*	*	H	α-helix	trans	-73.4	-25.7	173.6	-164.8	175.2	-176.3	174.2	2	112.9	V66 G68 S74	V66-R70 WeakPolarHBondContact O-CB 3.37Å; V66-R70 PolarHBondContact O-N 2.91Å; V66-R70 VanDerWaalsContact O-N 3.09Å; G68-R70 VanDerWaalsContact C-N 3.29Å; G68-R70 PolarHBondContact O-N 3.45Å; R70-S74 WeakPolarHBondContact O-CB 3.37Å; R70-S74 PolarHBondContact O-N 2.9Å
71	F	45.7	Very low	48.8	Very low	180 Å²	180	115.9 Å²	115.9	79%	0.789	62%	0.623	S	S	*	*	H	α-helix	trans	-81.5	-33.7	176.9	-166.5	-100.7	0	0	0	112.7	M67 G68	M67-F71 WeakPolarHBondContact O-CB 3.28Å; M67-F71 PolarHBondContact O-N 2.9Å; G68-F71 PolarHBondContact O-N 3.43Å
72	V	48	Very low	49	Very low	113 Å²	113	120.9 Å²	120.9	69%	0.685	64%	0.641	S	S	*	*	H	α-helix	trans	-75.8	-33.1	176.8	173	0	0	0	0	112.3	G68	G68-V72 WeakPolarHBondContact O-CG2 3.35Å; G68-V72 PolarHBondContact O-N 3.36Å
73	N	40.1	Very low	48.9	Very low	141 Å²	141	123.8 Å²	123.8	75%	0.754	65%	0.65	S	S	*	*	S	Bend	trans	-86.8	-10.6	-179.8	-96	-26.8	0	0	0	115.1	L69 W75	L69-N73 PolarHBondContact O-N 3.46Å; N73-W75 PolarHBondContact O-N 2.95Å
74	S	43	Very low	49	Very low	80 Å²	80	122.7 Å²	122.7	56%	0.559	65%	0.649	S	S	*	*			trans	-94.1	74.9	178.4	-164	0	0	0	0	110.6	R70 K76	R70-S74 WeakPolarHBondContact O-CB 3.37Å; R70-S74 PolarHBondContact O-N 2.9Å; S74-K76 PolarHBondContact O-N 3.4Å
75	W	46.5	Very low	49.6	Very low	245 Å²	245	125.7 Å²	125.7	93%	0.928	66%	0.655	S	S	*	*			trans	-66.6	48.8	174.1	-133.7	81.7	0	0	0	112.7	N73	N73-W75 PolarHBondContact O-N 2.95Å
76	K	45.8	Very low	49.8	Very low	191 Å²	191	124.4 Å²	124.4	83%	0.83	65%	0.653	S	S	*	*			trans	-150.1	109.6	-177.4	-142.8	96.6	157.4	-171.2	0	113	S74	S74-K76 PolarHBondContact O-N 3.4Å
77	F	52.2	Low	49.5	Very low	193 Å²	193	123.4 Å²	123.4	85%	0.846	65%	0.65	S	S	*	*			trans	-37.4	152.6	176.2	-106.1	-110	0	0	0	119.7
78	M	45.3	Very low	50.3	Low	165 Å²	165	122.8 Å²	122.8	81%	0.813	65%	0.652	S	S	*	*			trans	92.5	99.7	163.1	-63.3	-175.7	173.4	0	0	117.3
79	P	47.5	Very low	51	Low	100 Å²	100	126.9 Å²	126.9	65%	0.649	67%	0.666	S	S	*	*	S	Bend		-139.2	33.1	90.9	40.4	-26.5	0	0	0	112.6	G81 L82 M83	P79-G81 PolarHBondContact O-N 2.92Å; P79-L82 PolarHBondContact O-N 2.83Å; P79-M83 PolarHBondContact O-N 3.46Å
80	A	50.4	Low	51.7	Low	65 Å²	65	127.9 Å²	127.9	54%	0.537	67%	0.669	S	S	.	*	H	α-helix	trans	-61.6	-26.1	178.3	0	0	0	0	0	113	T84	A80-T84 WeakPolarHBondContact O-CB 3.42Å; A80-T84 PolarHBondContact O-N 3.45Å; A80-T84 PolarHBondContact O-OG1 3.22Å
81	G	50.5	Low	52.3	Low	46 Å²	46	123.2 Å²	123.2	47%	0.474	66%	0.658	S	S	.	*	H	α-helix	trans	-69.3	-41.3	178.1	0	0	0	0	0	114.4	P79 T84 L85	P79-G81 PolarHBondContact O-N 2.92Å; G81-T84 WeakPolarHBondContact CA-OG1 3.22Å; G81-T84 PolarHBondContact O-OG1 3.08Å; G81-T84 VanDerWaalsContact O-OG1 3.07Å; G81-L85 WeakPolarHBondContact O-CB 3.19Å; G81-L85 PolarHBondContact O-N 3.31Å
82	L	55.3	Low	53.2	Low	138 Å²	138	118.4 Å²	118.4	72%	0.723	64%	0.644	S	S	*	*	H	α-helix	trans	-68.7	-37.3	174	-90.4	160.8	0	0	0	111.3	P79 L85 A86	P79-L82 PolarHBondContact O-N 2.83Å; L82-L85 PolarHBondContact O-N 2.84Å; L82-A86 VanDerWaalsContact O-CB 3.28Å; L82-A86 WeakPolarHBondContact O-CB 3.43Å; L82-A86 PolarHBondContact O-N 2.91Å
83	M	53.6	Low	53.7	Low	151 Å²	151	119.3 Å²	119.3	74%	0.744	64%	0.638	S	S	*	*	H	α-helix	trans	-72.4	-37.6	-179.9	-140.7	-178.2	-169.2	0	0	112.1	P79 A86 S87	P79-M83 PolarHBondContact O-N 3.46Å; M83-A86 PolarHBondContact O-N 3.46Å; M83-S87 WeakPolarHBondContact O-CB 3.41Å; M83-S87 PolarHBondContact O-N 3.49Å
84	T	52.5	Low	54.8	Low	89 Å²	89	117 Å²	117	55%	0.546	63%	0.625	S	S	.	*	H	α-helix	trans	-66.3	-41.7	170.9	35	0	0	0	0	111.4	A80 G81 A86 S87 V88	A80-T84 WeakPolarHBondContact O-CB 3.42Å; A80-T84 PolarHBondContact O-N 3.45Å; A80-T84 PolarHBondContact O-OG1 3.22Å; G81-T84 WeakPolarHBondContact CA-OG1 3.22Å; G81-T84 PolarHBondContact O-OG1 3.08Å; G81-T84 VanDerWaalsContact O-OG1 3.07Å; T84-A86 PolarHBondContact O-N 3.34Å; T84-S87 PolarHBondContact O-N 2.96Å; T84-V88 WeakPolarHBondContact O-CB 3.49Å; T84-V88 VanDerWaalsContact O-CG2 3.28Å; T84-V88 WeakPolarHBondContact O-CG2 3.25Å; T84-V88 PolarHBondContact O-N 3.24Å
85	L	64.4	Low	55.9	Low	125 Å²	125	118.4 Å²	118.4	65%	0.654	63%	0.625	S	S	*	*	H	α-helix	trans	-60.8	-45.7	173.8	-134	95.5	0	0	0	111.8	G81 L82 S87 V88 L89	G81-L85 WeakPolarHBondContact O-CB 3.19Å; G81-L85 PolarHBondContact O-N 3.31Å; L82-L85 PolarHBondContact O-N 2.84Å; L85-S87 VanDerWaalsContact C-N 3.35Å; L85-S87 PolarHBondContact O-N 3.45Å; L85-V88 PolarHBondContact O-N 2.71Å; L85-L89 WeakPolarHBondContact O-CB 3.28Å; L85-L89 PolarHBondContact O-N 2.83Å
86	A	58.2	Low	56.4	Low	59 Å²	59	113.8 Å²	113.8	49%	0.488	61%	0.612	S	S	.	*	H	α-helix	trans	-64.3	-38.8	177.9	0	0	0	0	0	112.1	L82 M83 T84 L89 M90	L82-A86 VanDerWaalsContact O-CB 3.28Å; L82-A86 WeakPolarHBondContact O-CB 3.43Å; L82-A86 PolarHBondContact O-N 2.91Å; M83-A86 PolarHBondContact O-N 3.46Å; T84-A86 PolarHBondContact O-N 3.34Å; A86-L89 PolarHBondContact O-N 3.18Å; A86-M90 PolarHBondContact O-N 3.41Å
87	S	51.3	Low	57	Low	67 Å²	67	106.3 Å²	106.3	47%	0.469	59%	0.589	S	S	.	*	H	α-helix	trans	-68.1	-43.3	177.8	-164.5	0	0	0	0	111.8	M83 T84 L85 L89 M90 L91	M83-S87 WeakPolarHBondContact O-CB 3.41Å; M83-S87 PolarHBondContact O-N 3.49Å; T84-S87 PolarHBondContact O-N 2.96Å; L85-S87 VanDerWaalsContact C-N 3.35Å; L85-S87 PolarHBondContact O-N 3.45Å; S87-L89 VanDerWaalsContact C-N 3.31Å; S87-L89 PolarHBondContact O-N 2.85Å; S87-M90 PolarHBondContact O-N 3.02Å; S87-L91 WeakPolarHBondContact O-CB 3.41Å; S87-L91 WeakPolarHBondContact O-CG 3.22Å; S87-L91 PolarHBondContact O-N 2.88Å
88	V	65.2	Low	56.9	Low	92 Å²	92	103.4 Å²	103.4	56%	0.558	58%	0.58	S	S	*	*	H	α-helix	trans	-60	-43.4	172.6	171.4	0	0	0	0	110.4	T84 L85 M90 L91 T92	T84-V88 WeakPolarHBondContact O-CB 3.49Å; T84-V88 VanDerWaalsContact O-CG2 3.28Å; T84-V88 WeakPolarHBondContact O-CG2 3.25Å; T84-V88 PolarHBondContact O-N 3.24Å; L85-V88 PolarHBondContact O-N 2.71Å; V88-M90 PolarHBondContact O-N 2.85Å; V88-L91 PolarHBondContact O-N 3.41Å; V88-T92 PolarHBondContact O-N 2.86Å; V88-T92 PolarHBondContact O-OG1 3.44Å
89	L	63.8	Low	57.4	Low	118 Å²	118	101.5 Å²	101.5	62%	0.618	57%	0.572	S	S	*	*	H	α-helix	trans	-63.2	-40.4	178.6	-153.8	113.9	0	0	0	112.6	L85 A86 S87 K93	L85-L89 WeakPolarHBondContact O-CB 3.28Å; L85-L89 PolarHBondContact O-N 2.83Å; A86-L89 PolarHBondContact O-N 3.18Å; S87-L89 VanDerWaalsContact C-N 3.31Å; S87-L89 PolarHBondContact O-N 2.85Å; L89-K93 PolarHBondContact O-N 2.92Å; L89-K93 VanDerWaalsContact O-N 3.08Å
90	M	59.4	Low	57.4	Low	135 Å²	135	104.3 Å²	104.3	67%	0.665	57%	0.574	S	S	*	*	H	α-helix	trans	-68.7	-43.2	176.6	-124.8	-174.4	-178.8	0	0	111.6	A86 S87 V88 T92 K93 I94	A86-M90 PolarHBondContact O-N 3.41Å; S87-M90 PolarHBondContact O-N 3.02Å; V88-M90 PolarHBondContact O-N 2.85Å; M90-T92 PolarHBondContact O-N 2.79Å; M90-K93 PolarHBondContact O-N 3.33Å; M90-I94 WeakPolarHBondContact O-CD1 3.43Å; M90-I94 VanDerWaalsContact O-CG1 3.25Å; M90-I94 WeakPolarHBondContact O-CG1 3.31Å; M90-I94 PolarHBondContact O-N 3.07Å
91	L	59.5	Low	57	Low	95 Å²	95	105.9 Å²	105.9	50%	0.497	58%	0.581	S	S	.	*	H	α-helix	trans	-61.5	-43.5	175.8	-76.4	169.8	0	0	0	111.5	S87 V88 K93 I94 I95	S87-L91 WeakPolarHBondContact O-CB 3.41Å; S87-L91 WeakPolarHBondContact O-CG 3.22Å; S87-L91 PolarHBondContact O-N 2.88Å; V88-L91 PolarHBondContact O-N 3.41Å; L91-K93 PolarHBondContact O-N 2.89Å; L91-I94 PolarHBondContact O-N 3.15Å; L91-I95 WeakPolarHBondContact O-CB 3.33Å; L91-I95 WeakPolarHBondContact O-CD1 3.23Å; L91-I95 WeakPolarHBondContact O-CG1 3.45Å; L91-I95 PolarHBondContact O-N 3.3Å
92	T	64.1	Low	56.4	Low	79 Å²	79	113.6 Å²	113.6	49%	0.485	60%	0.596	S	S	.	*	H	α-helix	trans	-61	-43.4	174.6	-52.5	0	0	0	0	111.4	V88 M90 I94 I95 F96	V88-T92 PolarHBondContact O-N 2.86Å; V88-T92 PolarHBondContact O-OG1 3.44Å; M90-T92 PolarHBondContact O-N 2.79Å; T92-I94 PolarHBondContact O-N 3.01Å; T92-I95 PolarHBondContact O-N 3.5Å; T92-F96 WeakPolarHBondContact O-CB 3.25Å; T92-F96 PolarHBondContact O-N 2.87Å
93	K	58.7	Low	56.1	Low	131 Å²	131	115 Å²	115	57%	0.57	60%	0.599	S	S	*	*	H	α-helix	trans	-62.1	-40.6	175.1	-83.7	-155.2	78.8	168.1	0	112.7	Y8 L89 M90 L91 G97	Y8-K93 PolarHBondContact OH-NZ 3.39Å; L89-K93 PolarHBondContact O-N 2.92Å; L89-K93 VanDerWaalsContact O-N 3.08Å; M90-K93 PolarHBondContact O-N 3.33Å; L91-K93 PolarHBondContact O-N 2.89Å; K93-G97 PolarHBondContact O-N 3.46Å
94	I	63.6	Low	55.4	Low	94 Å²	94	116.6 Å²	116.6	48%	0.482	60%	0.604	S	S	.	*	H	α-helix	trans	-68.6	-43.8	-179.8	-67.5	162.6	0	0	0	110.4	M90 L91 T92 G97 M98	M90-I94 WeakPolarHBondContact O-CD1 3.43Å; M90-I94 VanDerWaalsContact O-CG1 3.25Å; M90-I94 WeakPolarHBondContact O-CG1 3.31Å; M90-I94 PolarHBondContact O-N 3.07Å; L91-I94 PolarHBondContact O-N 3.15Å; T92-I94 PolarHBondContact O-N 3.01Å; I94-G97 PolarHBondContact O-N 3.47Å; I94-M98 WeakPolarHBondContact O-CB 3.43Å; I94-M98 PolarHBondContact O-N 3.49Å
95	I	66.8	Low	54.7	Low	108 Å²	108	121.8 Å²	121.8	55%	0.554	62%	0.619	S	S	*	*	H	α-helix	trans	-63.8	-46	178.3	-67.7	162.1	0	0	0	110.6	L91 T92 G97 M98 L99	L91-I95 WeakPolarHBondContact O-CB 3.33Å; L91-I95 WeakPolarHBondContact O-CD1 3.23Å; L91-I95 WeakPolarHBondContact O-CG1 3.45Å; L91-I95 PolarHBondContact O-N 3.3Å; T92-I95 PolarHBondContact O-N 3.5Å; I95-G97 VanDerWaalsContact C-N 3.35Å; I95-G97 PolarHBondContact O-N 3.3Å; I95-M98 PolarHBondContact O-N 3.41Å; I95-L99 WeakPolarHBondContact O-CB 3.36Å; I95-L99 PolarHBondContact O-N 3.33Å
96	F	57.2	Low	53.1	Low	148 Å²	148	124.8 Å²	124.8	65%	0.649	65%	0.651	S	S	*	*	H	α-helix	trans	-65.5	-38.4	175.8	-120.2	-96.1	0	0	0	112.2	T92 L99 K100	T92-F96 WeakPolarHBondContact O-CB 3.25Å; T92-F96 PolarHBondContact O-N 2.87Å; F96-L99 PolarHBondContact O-N 2.92Å; F96-K100 VanDerWaalsContact O-CB 3.22Å; F96-K100 WeakPolarHBondContact O-CB 3.3Å; F96-K100 PolarHBondContact O-N 3.42Å
97	G	58.2	Low	52.9	Low	34 Å²	34	128.1 Å²	128.1	35%	0.351	66%	0.659	S	S	.	*	H	α-helix	trans	-64.3	-43.6	175.5	0	0	0	0	0	112.3	K93 I94 I95 K100 S101	K93-G97 PolarHBondContact O-N 3.46Å; I94-G97 PolarHBondContact O-N 3.47Å; I95-G97 VanDerWaalsContact C-N 3.35Å; I95-G97 PolarHBondContact O-N 3.3Å; G97-K100 PolarHBondContact O-N 2.84Å; G97-S101 WeakPolarHBondContact O-CB 3.22Å; G97-S101 PolarHBondContact O-N 3.48Å; G97-S101 PolarHBondContact O-OG 2.89Å
98	M	48.9	Very low	53	Low	132 Å²	132	131.3 Å²	131.3	65%	0.65	67%	0.669	S	S	*	*	H	α-helix	trans	-66.8	-42.6	174.4	-93.3	-164.3	179.8	0	0	112.2	I94 I95 K100 S101 R102	I94-M98 WeakPolarHBondContact O-CB 3.43Å; I94-M98 PolarHBondContact O-N 3.49Å; I95-M98 PolarHBondContact O-N 3.41Å; M98-K100 VanDerWaalsContact C-N 3.26Å; M98-K100 PolarHBondContact O-N 3.42Å; M98-S101 PolarHBondContact O-N 3.49Å; M98-R102 VanDerWaalsContact O-CG 3.3Å; M98-R102 WeakPolarHBondContact O-CG 3.35Å; M98-R102 PolarHBondContact O-N 3.09Å
99	L	55.5	Low	52.3	Low	125 Å²	125	133.4 Å²	133.4	65%	0.654	68%	0.675	S	S	*	*	H	α-helix	trans	-63.5	-36.7	177.5	-159.7	76.8	0	0	0	110.9	I95 F96	I95-L99 WeakPolarHBondContact O-CB 3.36Å; I95-L99 PolarHBondContact O-N 3.33Å; F96-L99 PolarHBondContact O-N 2.92Å
100	K	49	Very low	51.6	Low	159 Å²	159	134.4 Å²	134.4	69%	0.691	68%	0.678	S	S	*	*	H	α-helix	trans	-73.5	-37.1	175.2	-167.8	170.6	-175	-175.9	0	112.9	F96 G97 M98 R102	F96-K100 VanDerWaalsContact O-CB 3.22Å; F96-K100 WeakPolarHBondContact O-CB 3.3Å; F96-K100 PolarHBondContact O-N 3.42Å; G97-K100 PolarHBondContact O-N 2.84Å; M98-K100 VanDerWaalsContact C-N 3.26Å; M98-K100 PolarHBondContact O-N 3.42Å; K100-R102 VanDerWaalsContact C-N 3.31Å; K100-R102 PolarHBondContact O-N 2.92Å
101	S	41.2	Very low	51.1	Low	98 Å²	98	134.3 Å²	134.3	69%	0.685	68%	0.679	S	S	*	*	H	α-helix	trans	-75.2	-14.2	176.2	-77.2	0	0	0	0	114.2	G97 M98 Q103	G97-S101 WeakPolarHBondContact O-CB 3.22Å; G97-S101 PolarHBondContact O-N 3.48Å; G97-S101 PolarHBondContact O-OG 2.89Å; M98-S101 PolarHBondContact O-N 3.49Å; S101-Q103 VanDerWaalsContact C-N 3.34Å
102	R	39	Very low	50.6	Low	209 Å²	209	136.9 Å²	136.9	79%	0.789	69%	0.691	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.9	-6.3	175.3	-78	-73.2	-170.9	178.3	2.1	114.6	M98 K100	M98-R102 VanDerWaalsContact O-CG 3.3Å; M98-R102 WeakPolarHBondContact O-CG 3.35Å; M98-R102 PolarHBondContact O-N 3.09Å; K100-R102 VanDerWaalsContact C-N 3.31Å; K100-R102 PolarHBondContact O-N 2.92Å
103	Q	48.8	Very low	49.6	Very low	166 Å²	166	141.1 Å²	141.1	78%	0.776	71%	0.706	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.4	7.2	179.3	-87.9	-78.1	-65.2	0	0	114.6	S101	S101-Q103 VanDerWaalsContact C-N 3.34Å
104	H	39.1	Very low	48.9	Very low	185 Å²	185	141.8 Å²	141.8	86%	0.856	72%	0.716	S	S	*	*	S	Bend	trans	-128.8	39.7	174.9	-148.3	-102.4	0	0	0	113.1
105	K	36	Very low	47.7	Very low	198 Å²	198	145.8 Å²	145.8	86%	0.861	74%	0.736	S	S	*	*			trans	-154.7	72.1	153.6	-165.4	166	-171.5	-77.1	0	110.1
106	S	32.4	Very low	45.9	Very low	188 Å²	188	149.3 Å²	149.3	100%	1.315	75%	0.752	S	S	*	*				-169.2	0	128.9	-165.2	0	0	0	0	109.8

Retrieved 106 of 106 residues in 77.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).