A0A087X4R3_POEFO Loading...

BLOC-1-related complex subunit 7

AlphaFold DB (A0A3B3UFY5), UniProt , Accession A0A087X4R3, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 103 aa.

						>A0A087X4R3_POEFO|A0A087X4R3
MASADSQPRFGQSVKGLLSDKVGSCSGDVIALTRQVLKGSRSQELLGQAARNMVIQEDAILHSEDSLRKMSIITTHLQYQQEAIQKNVEHSKNLQDQLTHLLK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.2	Very low	53	Low	245 Å²	245	138.2 Å²	138.2	100%	1.207	82%	0.82	S	S	*	*				0	129.9	0	-68.5	-160	81.8	0	0	107.5
2	A	38.1	Very low	55.1	Low	95 Å²	95	132.8 Å²	132.8	79%	0.785	78%	0.78	S	S	*	*			trans	6.1	106.3	-178.3	0	0	0	0	0	118.3	A4	A2-A4 PolarHBondContact O-N 3.24Å; A2-A4 VanDerWaalsContact O-N 3.14Å
3	S	48	Very low	57.6	Low	121 Å²	121	128.7 Å²	128.7	85%	0.846	76%	0.763	S	S	*	*			trans	-58.3	108	144.9	-62.6	0	0	0	0	106.9	D5	S3-D5 PolarHBondContact O-N 3.1Å
4	A	51.5	Low	59.7	Low	97 Å²	97	127 Å²	127	80%	0.802	75%	0.754	S	S	*	*			trans	-80.8	115.8	171.2	0	0	0	0	0	107.8	A2	A2-A4 PolarHBondContact O-N 3.24Å; A2-A4 VanDerWaalsContact O-N 3.14Å
5	D	44.8	Very low	61.6	Low	135 Å²	135	129.9 Å²	129.9	72%	0.722	75%	0.753	S	S	*	*			trans	-39.2	131.8	178.4	-68.7	-70.2	0	0	0	113.8	S3 Q7	S3-D5 PolarHBondContact O-N 3.1Å; D5-Q7 PolarHBondContact O-N 3.44Å
6	S	54.2	Low	63.4	Low	130 Å²	130	123.5 Å²	123.5	91%	0.909	72%	0.724	S	S	*	*			trans	-67.6	67	158	32.4	0	0	0	0	109.9
7	Q	56.6	Low	64.9	Low	153 Å²	153	119.6 Å²	119.6	72%	0.715	70%	0.699	S	S	*	*			trans	-78.4	139	166.8	-104.9	-172.8	-80.7	0	0	109.9	D5 R9	D5-Q7 PolarHBondContact O-N 3.44Å; Q7-R9 PolarHBondContact O-N 3.5Å
8	P	53.8	Low	66.4	Low	107 Å²	107	118.7 Å²	118.7	70%	0.695	69%	0.69	S	S	*	*			trans	-67.1	107.3	174.9	25.9	-30.7	0	0	0	110	F10	P8-F10 PolarHBondContact O-N 3.07Å
9	R	65.6	Low	67.8	Low	144 Å²	144	116.7 Å²	116.7	54%	0.543	68%	0.684	S	S	.	*			trans	-74.5	60.4	174.8	-82.9	163.7	152.3	-148.3	5.3	111	Q7 G11 Q12 L17 D20	Q7-R9 PolarHBondContact O-N 3.5Å; R9-G11 PolarHBondContact O-N 3.13Å; R9-Q12 HydrophobicContact CB-CB 4.26Å; R9-Q12 VanDerWaalsContact CG-OE1 3.31Å; R9-Q12 VanDerWaalsContact CZ-OE1 3.32Å; R9-Q12 VanDerWaalsContact NH1-OE1 3.12Å; R9-Q12 PolarHBondContact O-N 3.43Å; R9-L17 HydrophobicContact CB-CD2 4.36Å; R9-D20 IonicContact CZ-OD2 3.71Å; R9-D20 IonicContact NH1-OD2 2.84Å; R9-D20 PolarHBondContact NH1-OD2 3.38Å; R9-D20 IonicContact NH2-OD2 3.65Å
10	F	62.6	Low	69.1	Low	207 Å²	207	114.6 Å²	114.6	91%	0.908	67%	0.669	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.7	129.1	173.8	-116	-92	0	0	0	109.6	P8	P8-F10 PolarHBondContact O-N 3.07Å
11	G	70.6	Confident	70.3	Confident	86 Å²	86	116.8 Å²	116.8	89%	0.887	67%	0.671	S	S	*	*	T	Hydrogen-bonded Turn	trans	94.2	-4	-179.2	0	0	0	0	0	116	R9	R9-G11 PolarHBondContact O-N 3.13Å
12	Q	78.4	Confident	73.1	Confident	74 Å²	74	110 Å²	110	35%	0.346	64%	0.643	S	S	.	*			trans	-87.8	129.9	176.1	-148.7	167.8	12.9	0	0	111.1	R9 V14 L17	R9-Q12 HydrophobicContact CB-CB 4.26Å; R9-Q12 VanDerWaalsContact CG-OE1 3.31Å; R9-Q12 VanDerWaalsContact CZ-OE1 3.32Å; R9-Q12 VanDerWaalsContact NH1-OE1 3.12Å; R9-Q12 PolarHBondContact O-N 3.43Å; Q12-V14 PolarHBondContact O-N 2.77Å; Q12-L17 HydrophobicContact CB-CD2 4.2Å; Q12-L17 HydrophobicContact CB-CG 4.3Å; Q12-L17 HydrophobicContact CG-CD2 4.14Å; Q12-L17 HydrophobicContact CG-CG 4.35Å
13	S	87.3	Confident	75.9	Confident	79 Å²	79	107.6 Å²	107.6	55%	0.552	63%	0.627	S	S	*	*			trans	-61.9	136.9	176.8	179.1	0	0	0	0	110.6	K15 G16 L17	S13-K15 PolarHBondContact O-N 2.92Å; S13-K15 VanDerWaalsContact O-N 3.09Å; S13-K15 PolarHBondContact OG-N 3.32Å; S13-G16 WeakPolarHBondContact O-CA 3.46Å; S13-G16 PolarHBondContact O-N 3.47Å; S13-L17 PolarHBondContact O-N 3.42Å; S13-L17 VanDerWaalsContact O-N 3.12Å
14	V	87.4	Confident	78.1	Confident	105 Å²	105	105.2 Å²	105.2	64%	0.636	61%	0.611	S	S	*	*	H	α-helix	trans	-49.8	-37.2	174.5	177.6	0	0	0	0	111.4	Q12 G16 L17 L18	Q12-V14 PolarHBondContact O-N 2.77Å; V14-G16 PolarHBondContact O-N 3.38Å; V14-L17 PolarHBondContact O-N 2.99Å; V14-L18 HydrophobicContact CG1-CD1 4.02Å; V14-L18 HydrophobicContact CG1-CG 4.41Å; V14-L18 WeakPolarHBondContact O-CB 3.29Å; V14-L18 WeakPolarHBondContact O-CG 3.5Å; V14-L18 PolarHBondContact O-N 3.23Å
15	K	88.7	Confident	80.3	Confident	170 Å²	170	104 Å²	104	74%	0.739	60%	0.596	S	S	*	*	H	α-helix	trans	-61.6	-41.9	175.9	-175.9	-178.7	175.7	-176.8	0	112.5	S13 L18 S19	S13-K15 PolarHBondContact O-N 2.92Å; S13-K15 VanDerWaalsContact O-N 3.09Å; S13-K15 PolarHBondContact OG-N 3.32Å; K15-L18 PolarHBondContact O-N 3.44Å; K15-S19 WeakPolarHBondContact O-CB 3.38Å; K15-S19 PolarHBondContact O-N 2.95Å
16	G	89.6	Confident	82.8	Confident	28 Å²	28	100.8 Å²	100.8	29%	0.289	58%	0.584	S	S	.	*	H	α-helix	trans	-66	-44.2	177	0	0	0	0	0	111.7	S13 V14 L18 S19 D20	S13-G16 WeakPolarHBondContact O-CA 3.46Å; S13-G16 PolarHBondContact O-N 3.47Å; V14-G16 PolarHBondContact O-N 3.38Å; G16-L18 VanDerWaalsContact C-N 3.33Å; G16-L18 PolarHBondContact O-N 2.96Å; G16-S19 WeakPolarHBondContact O-CB 3.39Å; G16-S19 PolarHBondContact O-N 3.14Å; G16-D20 PolarHBondContact O-N 2.93Å
17	L	89.4	Confident	84.8	Confident	57 Å²	57	96.3 Å²	96.3	30%	0.298	56%	0.558	S	S	.	*	H	α-helix	trans	-60.6	-41	175.9	-65.3	176.1	0	0	0	112.7	R9 Q12 S13 V14 K21	R9-L17 HydrophobicContact CB-CD2 4.36Å; Q12-L17 HydrophobicContact CB-CD2 4.2Å; Q12-L17 HydrophobicContact CB-CG 4.3Å; Q12-L17 HydrophobicContact CG-CD2 4.14Å; Q12-L17 HydrophobicContact CG-CG 4.35Å; S13-L17 PolarHBondContact O-N 3.42Å; S13-L17 VanDerWaalsContact O-N 3.12Å; V14-L17 PolarHBondContact O-N 2.99Å; L17-K21 PolarHBondContact O-N 3.4Å; L17-K21 VanDerWaalsContact O-N 3.12Å
18	L	91.9	Very high	86.8	Confident	103 Å²	103	93.9 Å²	93.9	54%	0.539	55%	0.55	S	S	.	.	H	α-helix	trans	-66.1	-43.3	175.4	-73.9	170.8	0	0	0	111.5	V14 K15 G16 D20 K21 V22	V14-L18 HydrophobicContact CG1-CD1 4.02Å; V14-L18 HydrophobicContact CG1-CG 4.41Å; V14-L18 WeakPolarHBondContact O-CB 3.29Å; V14-L18 WeakPolarHBondContact O-CG 3.5Å; V14-L18 PolarHBondContact O-N 3.23Å; K15-L18 PolarHBondContact O-N 3.44Å; G16-L18 VanDerWaalsContact C-N 3.33Å; G16-L18 PolarHBondContact O-N 2.96Å; L18-D20 VanDerWaalsContact C-N 3.33Å; L18-D20 PolarHBondContact O-N 3.41Å; L18-K21 PolarHBondContact O-N 2.78Å; L18-V22 WeakPolarHBondContact O-CB 3.47Å; L18-V22 VanDerWaalsContact O-CG2 3.3Å; L18-V22 WeakPolarHBondContact O-CG2 3.5Å; L18-V22 PolarHBondContact O-N 3.21Å
19	S	92.8	Very high	88.8	Confident	82 Å²	82	92.5 Å²	92.5	57%	0.573	54%	0.539	S	S	*	.	H	α-helix	trans	-59.3	-43.6	176.6	-166.2	0	0	0	0	111.9	K15 G16 V22 G23	K15-S19 WeakPolarHBondContact O-CB 3.38Å; K15-S19 PolarHBondContact O-N 2.95Å; G16-S19 WeakPolarHBondContact O-CB 3.39Å; G16-S19 PolarHBondContact O-N 3.14Å; S19-V22 PolarHBondContact O-N 3.15Å; S19-G23 PolarHBondContact O-N 2.94Å
20	D	93.1	Very high	90.3	Very high	74 Å²	74	89.6 Å²	89.6	40%	0.396	53%	0.534	S	S	.	.	H	α-helix	trans	-61.1	-47.2	176.5	-72.1	-5.7	0	0	0	111.4	R9 G16 L18 G23 S24	R9-D20 IonicContact CZ-OD2 3.71Å; R9-D20 IonicContact NH1-OD2 2.84Å; R9-D20 PolarHBondContact NH1-OD2 3.38Å; R9-D20 IonicContact NH2-OD2 3.65Å; G16-D20 PolarHBondContact O-N 2.93Å; L18-D20 VanDerWaalsContact C-N 3.33Å; L18-D20 PolarHBondContact O-N 3.41Å; D20-G23 PolarHBondContact O-N 3.05Å; D20-S24 PolarHBondContact O-N 3.45Å
21	K	94.7	Very high	91.8	Very high	161 Å²	161	81.9 Å²	81.9	70%	0.7	51%	0.508	S	S	*	.	H	α-helix	trans	-64.1	-42.3	179.1	-76.8	-170.3	177.7	-167.8	0	112.5	L17 L18 G23 S24 C25	L17-K21 PolarHBondContact O-N 3.4Å; L17-K21 VanDerWaalsContact O-N 3.12Å; L18-K21 PolarHBondContact O-N 2.78Å; K21-G23 VanDerWaalsContact C-N 3.33Å; K21-S24 PolarHBondContact O-N 3.39Å; K21-C25 VanDerWaalsContact O-CB 3.31Å; K21-C25 WeakPolarHBondContact O-CB 3.45Å; K21-C25 PolarHBondContact O-N 2.92Å
22	V	96.2	Very high	93	Very high	101 Å²	101	82.5 Å²	82.5	61%	0.612	49%	0.491	S	S	*	.	H	α-helix	trans	-63.4	-42	175.8	170	0	0	0	0	110.4	L18 S19 C25 S26	L18-V22 WeakPolarHBondContact O-CB 3.47Å; L18-V22 VanDerWaalsContact O-CG2 3.3Å; L18-V22 WeakPolarHBondContact O-CG2 3.5Å; L18-V22 PolarHBondContact O-N 3.21Å; S19-V22 PolarHBondContact O-N 3.15Å; V22-C25 PolarHBondContact O-N 3.36Å; V22-S26 WeakPolarHBondContact O-CB 3.36Å; V22-S26 PolarHBondContact O-N 3.39Å
23	G	96.1	Very high	93.7	Very high	45 Å²	45	82.4 Å²	82.4	46%	0.464	50%	0.495	S	S	.	.	H	α-helix	trans	-59.6	-48.3	175.3	0	0	0	0	0	112.7	S19 D20 K21 S26 G27	S19-G23 PolarHBondContact O-N 2.94Å; D20-G23 PolarHBondContact O-N 3.05Å; K21-G23 VanDerWaalsContact C-N 3.33Å; G23-S26 PolarHBondContact O-N 3.01Å; G23-G27 PolarHBondContact O-N 3.44Å
24	S	95.9	Very high	94	Very high	72 Å²	72	85 Å²	85	50%	0.503	49%	0.493	S	S	.	.	H	α-helix	trans	-60.3	-49.3	176.5	-169.8	0	0	0	0	111.7	D20 K21 S26 G27 D28	D20-S24 PolarHBondContact O-N 3.45Å; K21-S24 PolarHBondContact O-N 3.39Å; S24-S26 VanDerWaalsContact C-N 3.33Å; S24-S26 PolarHBondContact O-N 3.29Å; S24-G27 WeakPolarHBondContact O-CA 3.49Å; S24-G27 PolarHBondContact O-N 2.92Å; S24-G27 VanDerWaalsContact O-N 3.08Å; S24-D28 PolarHBondContact O-N 3.46Å
25	C	96.7	Very high	94.3	Very high	72 Å²	72	85.3 Å²	85.3	49%	0.486	49%	0.487	S	S	.	.	H	α-helix	trans	-58.8	-43.8	179.3	179.3	0	0	0	0	112	K21 V22 G27 D28 V29	K21-C25 VanDerWaalsContact O-CB 3.31Å; K21-C25 WeakPolarHBondContact O-CB 3.45Å; K21-C25 PolarHBondContact O-N 2.92Å; V22-C25 PolarHBondContact O-N 3.36Å; C25-G27 VanDerWaalsContact C-N 3.31Å; C25-G27 PolarHBondContact O-N 3.34Å; C25-D28 PolarHBondContact O-N 3.01Å; C25-V29 WeakPolarHBondContact O-CG2 3.44Å; C25-V29 PolarHBondContact O-N 3.27Å
26	S	97.1	Very high	94.4	Very high	67 Å²	67	82.3 Å²	82.3	47%	0.469	48%	0.483	S	S	.	.	H	α-helix	trans	-58.9	-43.9	174.9	-175.4	0	0	0	0	111.5	V22 G23 S24 D28 V29 I30	V22-S26 WeakPolarHBondContact O-CB 3.36Å; V22-S26 PolarHBondContact O-N 3.39Å; G23-S26 PolarHBondContact O-N 3.01Å; S24-S26 VanDerWaalsContact C-N 3.33Å; S24-S26 PolarHBondContact O-N 3.29Å; S26-D28 PolarHBondContact O-N 3.19Å; S26-V29 PolarHBondContact O-N 3.01Å; S26-I30 WeakPolarHBondContact O-CD1 3.49Å; S26-I30 WeakPolarHBondContact O-CG1 3.29Å; S26-I30 PolarHBondContact O-N 2.97Å
27	G	97.1	Very high	94.5	Very high	35 Å²	35	87.7 Å²	87.7	36%	0.361	50%	0.504	S	S	.	.	H	α-helix	trans	-59.1	-46	174.4	0	0	0	0	0	113.2	G23 S24 C25 I30 A31	G23-G27 PolarHBondContact O-N 3.44Å; S24-G27 WeakPolarHBondContact O-CA 3.49Å; S24-G27 PolarHBondContact O-N 2.92Å; S24-G27 VanDerWaalsContact O-N 3.08Å; C25-G27 VanDerWaalsContact C-N 3.31Å; C25-G27 PolarHBondContact O-N 3.34Å; G27-I30 PolarHBondContact O-N 3.22Å; G27-A31 PolarHBondContact O-N 3.01Å
28	D	96.9	Very high	94.5	Very high	102 Å²	102	93.6 Å²	93.6	55%	0.545	53%	0.528	S	S	.	.	H	α-helix	trans	-64.2	-43.2	179.7	-65.1	-30.7	0	0	0	111.7	S24 C25 S26 I30 A31 L32	S24-D28 PolarHBondContact O-N 3.46Å; C25-D28 PolarHBondContact O-N 3.01Å; S26-D28 PolarHBondContact O-N 3.19Å; D28-I30 VanDerWaalsContact C-N 3.34Å; D28-I30 PolarHBondContact O-N 3.5Å; D28-A31 PolarHBondContact O-N 3.34Å; D28-L32 WeakPolarHBondContact O-CB 3.26Å; D28-L32 PolarHBondContact O-N 3.47Å
29	V	97.4	Very high	94.4	Very high	79 Å²	79	89.7 Å²	89.7	48%	0.479	51%	0.512	S	S	.	.	H	α-helix	trans	-62.5	-40.8	176.6	170.2	0	0	0	0	111.3	C25 S26 L32 T33	C25-V29 WeakPolarHBondContact O-CG2 3.44Å; C25-V29 PolarHBondContact O-N 3.27Å; S26-V29 PolarHBondContact O-N 3.01Å; V29-L32 PolarHBondContact O-N 3.37Å; V29-T33 WeakPolarHBondContact O-CB 3.26Å; V29-T33 PolarHBondContact O-N 3.33Å; V29-T33 PolarHBondContact O-OG1 2.9Å
30	I	96	Very high	94.4	Very high	82 Å²	82	87.8 Å²	87.8	42%	0.421	50%	0.499	S	S	.	.	H	α-helix	trans	-66.3	-42.1	176.3	-65.2	166.1	0	0	0	110.4	S26 G27 D28 T33 R34	S26-I30 WeakPolarHBondContact O-CD1 3.49Å; S26-I30 WeakPolarHBondContact O-CG1 3.29Å; S26-I30 PolarHBondContact O-N 2.97Å; G27-I30 PolarHBondContact O-N 3.22Å; D28-I30 VanDerWaalsContact C-N 3.34Å; D28-I30 PolarHBondContact O-N 3.5Å; I30-T33 PolarHBondContact O-N 3.34Å; I30-R34 PolarHBondContact O-N 3.07Å
31	A	94.5	Very high	94.2	Very high	45 Å²	45	93.7 Å²	93.7	37%	0.372	52%	0.515	S	S	.	.	H	α-helix	trans	-61.8	-44.9	176.4	0	0	0	0	0	111.7	G27 D28 R34 Q35	G27-A31 PolarHBondContact O-N 3.01Å; D28-A31 PolarHBondContact O-N 3.34Å; A31-R34 PolarHBondContact O-N 3.33Å; A31-Q35 PolarHBondContact O-N 2.94Å
32	L	94.8	Very high	94.1	Very high	100 Å²	100	89.4 Å²	89.4	52%	0.524	51%	0.506	S	S	.	.	H	α-helix	trans	-60	-47.1	174.9	178.6	61.7	0	0	0	111.6	D28 V29 R34 Q35 V36	D28-L32 WeakPolarHBondContact O-CB 3.26Å; D28-L32 PolarHBondContact O-N 3.47Å; V29-L32 PolarHBondContact O-N 3.37Å; L32-R34 VanDerWaalsContact C-N 3.26Å; L32-R34 PolarHBondContact O-N 2.86Å; L32-Q35 WeakPolarHBondContact O-CB 3.44Å; L32-Q35 PolarHBondContact O-N 3.39Å; L32-V36 HydrophobicContact CD1-CG2 4.38Å; L32-V36 WeakPolarHBondContact O-CG2 3.43Å; L32-V36 PolarHBondContact O-N 2.95Å
33	T	95.1	Very high	93.9	Very high	71 Å²	71	90.6 Å²	90.6	44%	0.436	51%	0.505	S	S	.	.	H	α-helix	trans	-57.1	-41.9	177.9	-57.6	0	0	0	0	110.9	V29 I30 V36 L37	V29-T33 WeakPolarHBondContact O-CB 3.26Å; V29-T33 PolarHBondContact O-N 3.33Å; V29-T33 PolarHBondContact O-OG1 2.9Å; I30-T33 PolarHBondContact O-N 3.34Å; T33-V36 PolarHBondContact O-N 3.46Å; T33-L37 HydrophobicContact CG2-CD1 4.15Å; T33-L37 WeakPolarHBondContact O-CG 3.41Å; T33-L37 PolarHBondContact O-N 3.28Å
34	R	93.3	Very high	93.8	Very high	134 Å²	134	95.1 Å²	95.1	51%	0.506	51%	0.514	S	S	.	.	H	α-helix	trans	-64.9	-39.7	174.7	-74.6	-172.2	-69.6	-105.4	-3.6	112.9	I30 A31 L32 V36 L37 K38	I30-R34 PolarHBondContact O-N 3.07Å; A31-R34 PolarHBondContact O-N 3.33Å; L32-R34 VanDerWaalsContact C-N 3.26Å; L32-R34 PolarHBondContact O-N 2.86Å; R34-V36 VanDerWaalsContact C-N 3.33Å; R34-L37 PolarHBondContact O-N 3.27Å; R34-K38 WeakPolarHBondContact O-CB 3.45Å; R34-K38 WeakPolarHBondContact O-CG 3.25Å; R34-K38 PolarHBondContact O-N 3.07Å
35	Q	92.9	Very high	93.8	Very high	111 Å²	111	96.8 Å²	96.8	52%	0.519	52%	0.517	S	S	.	.	H	α-helix	trans	-66.1	-36.9	177.4	-172.7	178.3	3.2	0	0	111.7	A31 L32 G39	A31-Q35 PolarHBondContact O-N 2.94Å; L32-Q35 WeakPolarHBondContact O-CB 3.44Å; L32-Q35 PolarHBondContact O-N 3.39Å; Q35-G39 CarbonylContact O-C 3.14Å; Q35-G39 WeakPolarHBondContact O-CA 3.49Å; Q35-G39 PolarHBondContact O-N 2.67Å
36	V	91.4	Very high	93.8	Very high	108 Å²	108	99 Å²	99	66%	0.655	52%	0.523	S	S	*	.	H	α-helix	trans	-65.9	-46.6	173.8	172.4	0	0	0	0	110.7	L32 T33 R34 G39	L32-V36 HydrophobicContact CD1-CG2 4.38Å; L32-V36 WeakPolarHBondContact O-CG2 3.43Å; L32-V36 PolarHBondContact O-N 2.95Å; T33-V36 PolarHBondContact O-N 3.46Å; R34-V36 VanDerWaalsContact C-N 3.33Å; V36-G39 PolarHBondContact O-N 3.05Å
37	L	90.5	Very high	93.7	Very high	140 Å²	140	97 Å²	97	73%	0.733	51%	0.513	S	S	*	.	H	α-helix	trans	-68.4	-42.4	-178.3	-71.2	173.4	0	0	0	113.6	T33 R34 G39	T33-L37 HydrophobicContact CG2-CD1 4.15Å; T33-L37 WeakPolarHBondContact O-CG 3.41Å; T33-L37 PolarHBondContact O-N 3.28Å; R34-L37 PolarHBondContact O-N 3.27Å; L37-G39 VanDerWaalsContact C-N 3.28Å
38	K	90.9	Very high	93.7	Very high	182 Å²	182	99.3 Å²	99.3	79%	0.791	52%	0.515	S	S	*	.	H	α-helix	trans	-81	-12.2	-180	-67.4	-175.3	177	-173.9	0	112.9	R34	R34-K38 WeakPolarHBondContact O-CB 3.45Å; R34-K38 WeakPolarHBondContact O-CG 3.25Å; R34-K38 PolarHBondContact O-N 3.07Å
39	G	89.8	Confident	93.7	Very high	20 Å²	20	96.5 Å²	96.5	21%	0.206	51%	0.505	C	S	.	.			trans	81.1	157.7	-168.3	0	0	0	0	0	112.2	Q35 V36 L37	Q35-G39 CarbonylContact O-C 3.14Å; Q35-G39 WeakPolarHBondContact O-CA 3.49Å; Q35-G39 PolarHBondContact O-N 2.67Å; V36-G39 PolarHBondContact O-N 3.05Å; L37-G39 VanDerWaalsContact C-N 3.28Å
40	S	91.3	Very high	93.6	Very high	43 Å²	43	95.3 Å²	95.3	30%	0.301	50%	0.504	S	S	.	.			trans	-86.7	156.1	177.1	74.1	0	0	0	0	111.1	S42 Q43 E44	S40-S42 PolarHBondContact O-N 3.06Å; S40-S42 VanDerWaalsContact O-N 3.14Å; S40-S42 WeakPolarHBondContact OG-CB 3.41Å; S40-S42 PolarHBondContact OG-N 3.29Å; S40-Q43 WeakPolarHBondContact O-CB 3.37Å; S40-Q43 PolarHBondContact O-N 3.26Å; S40-Q43 PolarHBondContact OG-N 3.18Å; S40-E44 PolarHBondContact O-N 3.09Å
41	R	90.5	Very high	93.6	Very high	197 Å²	197	97.6 Å²	97.6	74%	0.743	51%	0.507	S	S	*	.	H	α-helix	trans	-54.6	-30.7	168.5	-175	169	179.3	174.1	-0.9	112.6	Q43 E44 L45	R41-Q43 VanDerWaalsContact C-N 3.35Å; R41-E44 PolarHBondContact O-N 3.34Å; R41-L45 HydrophobicContact CG-CD1 4.43Å; R41-L45 WeakPolarHBondContact O-CG 3.39Å; R41-L45 PolarHBondContact O-N 3.32Å; R41-L45 VanDerWaalsContact O-N 3.09Å
42	S	92.4	Very high	93.7	Very high	72 Å²	72	99.3 Å²	99.3	50%	0.503	51%	0.51	S	S	.	.	H	α-helix	trans	-64.1	-40.1	175.5	-171.4	0	0	0	0	111.8	S40 E44 L45 L46	S40-S42 PolarHBondContact O-N 3.06Å; S40-S42 VanDerWaalsContact O-N 3.14Å; S40-S42 WeakPolarHBondContact OG-CB 3.41Å; S40-S42 PolarHBondContact OG-N 3.29Å; S42-E44 VanDerWaalsContact C-N 3.32Å; S42-E44 PolarHBondContact O-N 3.28Å; S42-L45 PolarHBondContact O-N 3.06Å; S42-L46 WeakPolarHBondContact O-CB 3.49Å; S42-L46 VanDerWaalsContact O-CG 3.29Å; S42-L46 WeakPolarHBondContact O-CG 3.46Å; S42-L46 PolarHBondContact O-N 2.86Å
43	Q	92.1	Very high	93.8	Very high	126 Å²	126	100.9 Å²	100.9	59%	0.589	52%	0.517	S	S	*	.	H	α-helix	trans	-62.6	-39.6	176.5	-178	-176.5	-20.3	0	0	112	S40 R41 G47	S40-Q43 WeakPolarHBondContact O-CB 3.37Å; S40-Q43 PolarHBondContact O-N 3.26Å; S40-Q43 PolarHBondContact OG-N 3.18Å; R41-Q43 VanDerWaalsContact C-N 3.35Å; Q43-G47 PolarHBondContact O-N 3.43Å
44	E	92.8	Very high	93.8	Very high	139 Å²	139	102.1 Å²	102.1	65%	0.65	52%	0.524	S	S	*	.	H	α-helix	trans	-63.9	-46.7	175.4	-175.1	-176.2	-178	0	0	111.6	S40 R41 S42 L46 G47 Q48	S40-E44 PolarHBondContact O-N 3.09Å; R41-E44 PolarHBondContact O-N 3.34Å; S42-E44 VanDerWaalsContact C-N 3.32Å; S42-E44 PolarHBondContact O-N 3.28Å; E44-L46 PolarHBondContact O-N 3.47Å; E44-G47 PolarHBondContact O-N 3.45Å; E44-Q48 PolarHBondContact O-N 3.4Å
45	L	95.8	Very high	93.8	Very high	108 Å²	108	101.9 Å²	101.9	57%	0.565	53%	0.531	S	S	*	.	H	α-helix	trans	-61.5	-43.6	177.3	-69.3	172.6	0	0	0	111.8	R41 S42 G47 Q48 A49	R41-L45 HydrophobicContact CG-CD1 4.43Å; R41-L45 WeakPolarHBondContact O-CG 3.39Å; R41-L45 PolarHBondContact O-N 3.32Å; R41-L45 VanDerWaalsContact O-N 3.09Å; S42-L45 PolarHBondContact O-N 3.06Å; L45-G47 VanDerWaalsContact C-N 3.35Å; L45-Q48 PolarHBondContact O-N 3.16Å; L45-A49 WeakPolarHBondContact O-CB 3.45Å; L45-A49 PolarHBondContact O-N 3.22Å
46	L	96.3	Very high	93.9	Very high	117 Å²	117	102.1 Å²	102.1	61%	0.613	53%	0.533	S	S	*	.	H	α-helix	trans	-62.8	-42	175.1	-73	172.2	0	0	0	111.4	S42 E44 Q48 A49 A50	S42-L46 WeakPolarHBondContact O-CB 3.49Å; S42-L46 VanDerWaalsContact O-CG 3.29Å; S42-L46 WeakPolarHBondContact O-CG 3.46Å; S42-L46 PolarHBondContact O-N 2.86Å; E44-L46 PolarHBondContact O-N 3.47Å; L46-Q48 VanDerWaalsContact C-N 3.33Å; L46-Q48 PolarHBondContact O-N 2.88Å; L46-A49 PolarHBondContact O-N 3.03Å; L46-A50 WeakPolarHBondContact O-CB 3.36Å; L46-A50 PolarHBondContact O-N 3.31Å
47	G	95.5	Very high	94.2	Very high	26 Å²	26	102.7 Å²	102.7	27%	0.268	53%	0.528	S	S	.	.	H	α-helix	trans	-61.9	-40.2	175	0	0	0	0	0	112.6	Q43 E44 L45 R51	Q43-G47 PolarHBondContact O-N 3.43Å; E44-G47 PolarHBondContact O-N 3.45Å; L45-G47 VanDerWaalsContact C-N 3.35Å; G47-R51 WeakPolarHBondContact O-CG 3.45Å; G47-R51 PolarHBondContact O-N 3.2Å; G47-R51 VanDerWaalsContact O-N 3.16Å; G47-R51 PolarHBondContact O-NH1 2.96Å
48	Q	96.8	Very high	94.3	Very high	83 Å²	83	100.6 Å²	100.6	39%	0.388	52%	0.517	S	S	.	.	H	α-helix	trans	-68	-42.2	174.3	-173	61.3	40.3	0	0	111.9	E44 L45 L46 A50 R51 N52	E44-Q48 PolarHBondContact O-N 3.4Å; L45-Q48 PolarHBondContact O-N 3.16Å; L46-Q48 VanDerWaalsContact C-N 3.33Å; L46-Q48 PolarHBondContact O-N 2.88Å; Q48-A50 VanDerWaalsContact C-N 3.34Å; Q48-A50 PolarHBondContact O-N 3.5Å; Q48-R51 PolarHBondContact O-N 3.12Å; Q48-N52 PolarHBondContact NE2-OD1 3.3Å; Q48-N52 VanDerWaalsContact O-CG 3.26Å; Q48-N52 PolarHBondContact O-N 3.16Å; Q48-N52 PolarHBondContact O-OD1 3.43Å
49	A	96.9	Very high	94.5	Very high	43 Å²	43	94.4 Å²	94.4	36%	0.355	50%	0.5	S	S	.	.	H	α-helix	trans	-60.1	-44.7	176.8	0	0	0	0	0	111.2	L45 L46 R51 N52 M53	L45-A49 WeakPolarHBondContact O-CB 3.45Å; L45-A49 PolarHBondContact O-N 3.22Å; L46-A49 PolarHBondContact O-N 3.03Å; A49-R51 PolarHBondContact O-N 2.96Å; A49-N52 PolarHBondContact O-N 2.95Å; A49-M53 WeakPolarHBondContact O-CG 3.46Å; A49-M53 PolarHBondContact O-N 2.92Å
50	A	96.7	Very high	94.9	Very high	55 Å²	55	98.1 Å²	98.1	46%	0.455	52%	0.515	S	S	.	.	H	α-helix	trans	-59.2	-46.1	175.6	0	0	0	0	0	112	L46 Q48 N52 M53 V54	L46-A50 WeakPolarHBondContact O-CB 3.36Å; L46-A50 PolarHBondContact O-N 3.31Å; Q48-A50 VanDerWaalsContact C-N 3.34Å; Q48-A50 PolarHBondContact O-N 3.5Å; A50-N52 PolarHBondContact O-N 3.23Å; A50-M53 PolarHBondContact O-N 2.74Å; A50-V54 WeakPolarHBondContact O-CG2 3.36Å; A50-V54 PolarHBondContact O-N 3.49Å; A50-V54 VanDerWaalsContact O-N 3.09Å
51	R	96.4	Very high	95.1	Very high	129 Å²	129	100.8 Å²	100.8	49%	0.487	53%	0.525	S	S	.	.	H	α-helix	trans	-60	-45	175.3	-73.8	-172.5	-66.5	-88.9	6.1	112.2	G47 Q48 A49 M53 V54 I55	G47-R51 WeakPolarHBondContact O-CG 3.45Å; G47-R51 PolarHBondContact O-N 3.2Å; G47-R51 VanDerWaalsContact O-N 3.16Å; G47-R51 PolarHBondContact O-NH1 2.96Å; Q48-R51 PolarHBondContact O-N 3.12Å; A49-R51 PolarHBondContact O-N 2.96Å; R51-M53 VanDerWaalsContact C-N 3.33Å; R51-M53 PolarHBondContact O-N 3.48Å; R51-V54 PolarHBondContact O-N 3.11Å; R51-I55 WeakPolarHBondContact O-CG1 3.39Å; R51-I55 PolarHBondContact O-N 3.26Å; R51-I55 VanDerWaalsContact O-N 3.11Å
52	N	96.6	Very high	95.4	Very high	81 Å²	81	96.6 Å²	96.6	43%	0.433	51%	0.514	S	S	.	.	H	α-helix	trans	-62.1	-42.1	178.6	-70.6	-2.5	0	0	0	111.4	Q48 A49 A50 I55 Q56	Q48-N52 PolarHBondContact NE2-OD1 3.3Å; Q48-N52 VanDerWaalsContact O-CG 3.26Å; Q48-N52 PolarHBondContact O-N 3.16Å; Q48-N52 PolarHBondContact O-OD1 3.43Å; A49-N52 PolarHBondContact O-N 2.95Å; A50-N52 PolarHBondContact O-N 3.23Å; N52-I55 PolarHBondContact O-N 2.85Å; N52-Q56 VanDerWaalsContact O-CB 3.31Å; N52-Q56 WeakPolarHBondContact O-CB 3.36Å; N52-Q56 PolarHBondContact O-N 3.48Å
53	M	95.9	Very high	95.7	Very high	134 Å²	134	96.5 Å²	96.5	66%	0.66	51%	0.513	S	S	*	.	H	α-helix	trans	-63.7	-41.6	178.9	-74.7	-177.4	66.8	0	0	112.4	A49 A50 R51 Q56 E57	A49-M53 WeakPolarHBondContact O-CG 3.46Å; A49-M53 PolarHBondContact O-N 2.92Å; A50-M53 PolarHBondContact O-N 2.74Å; R51-M53 VanDerWaalsContact C-N 3.33Å; R51-M53 PolarHBondContact O-N 3.48Å; M53-Q56 PolarHBondContact O-N 2.92Å; M53-E57 PolarHBondContact O-N 3.29Å
54	V	94.3	Very high	95.9	Very high	96 Å²	96	95 Å²	95	58%	0.582	51%	0.506	S	S	*	.	H	α-helix	trans	-63.6	-44.5	176.4	172.7	0	0	0	0	111.1	A50 R51 Q56 E57	A50-V54 WeakPolarHBondContact O-CG2 3.36Å; A50-V54 PolarHBondContact O-N 3.49Å; A50-V54 VanDerWaalsContact O-N 3.09Å; R51-V54 PolarHBondContact O-N 3.11Å; V54-Q56 PolarHBondContact O-N 2.94Å; V54-E57 WeakPolarHBondContact O-CB 3.33Å; V54-E57 PolarHBondContact O-N 3.49Å
55	I	93.3	Very high	96.2	Very high	129 Å²	129	91.2 Å²	91.2	66%	0.662	49%	0.49	S	S	*	.	H	α-helix	trans	-63.2	-36	176.5	-66.9	167	0	0	0	110.8	R51 N52 E57	R51-I55 WeakPolarHBondContact O-CG1 3.39Å; R51-I55 PolarHBondContact O-N 3.26Å; R51-I55 VanDerWaalsContact O-N 3.11Å; N52-I55 PolarHBondContact O-N 2.85Å; I55-E57 VanDerWaalsContact C-N 3.32Å; I55-E57 PolarHBondContact O-N 3.26Å
56	Q	96.8	Very high	96.3	Very high	117 Å²	117	89 Å²	89	55%	0.547	48%	0.483	S	S	.	.	H	α-helix	trans	-71.7	-26	-179.9	-168.5	171.7	2.1	0	0	113	N52 M53 V54 D58 A59 I60	N52-Q56 VanDerWaalsContact O-CB 3.31Å; N52-Q56 WeakPolarHBondContact O-CB 3.36Å; N52-Q56 PolarHBondContact O-N 3.48Å; M53-Q56 PolarHBondContact O-N 2.92Å; V54-Q56 PolarHBondContact O-N 2.94Å; Q56-D58 PolarHBondContact O-N 3.4Å; Q56-A59 PolarHBondContact O-N 3.26Å; Q56-I60 HydrophobicContact CG-CD1 4.13Å; Q56-I60 HydrophobicContact CG-CG1 4.39Å; Q56-I60 WeakPolarHBondContact O-CG1 3.33Å; Q56-I60 PolarHBondContact O-N 2.98Å
57	E	96.1	Very high	96.4	Very high	120 Å²	120	88.8 Å²	88.8	56%	0.561	48%	0.482	S	S	*	.	H	α-helix	trans	-57.5	-45.5	178.6	-173.3	172.5	-156.3	0	0	112.1	M53 V54 I55 A59 I60 L61	M53-E57 PolarHBondContact O-N 3.29Å; V54-E57 WeakPolarHBondContact O-CB 3.33Å; V54-E57 PolarHBondContact O-N 3.49Å; I55-E57 VanDerWaalsContact C-N 3.32Å; I55-E57 PolarHBondContact O-N 3.26Å; E57-A59 PolarHBondContact O-N 3.35Å; E57-I60 WeakPolarHBondContact O-CB 3.4Å; E57-I60 PolarHBondContact O-N 3.43Å; E57-I60 VanDerWaalsContact O-N 3.16Å; E57-L61 WeakPolarHBondContact O-CG 3.31Å; E57-L61 PolarHBondContact O-N 3.43Å
58	D	92.6	Very high	96.5	Very high	95 Å²	95	93.6 Å²	93.6	51%	0.508	49%	0.492	S	S	.	.	H	α-helix	trans	-62.6	-43.3	178.7	-174.5	67.4	0	0	0	112.2	Q56 I60 L61 H62	Q56-D58 PolarHBondContact O-N 3.4Å; D58-I60 VanDerWaalsContact C-N 3.28Å; D58-I60 PolarHBondContact O-N 3.29Å; D58-L61 PolarHBondContact O-N 3.3Å; D58-H62 PolarHBondContact O-CD2 2.99Å; D58-H62 VanDerWaalsContact O-CD2 3.29Å; D58-H62 PolarHBondContact O-N 3.47Å; D58-H62 IonicContact OD1-CD2 3.73Å; D58-H62 IonicContact OD1-NE2 2.74Å; D58-H62 IonicContact OD2-CD2 3.71Å; D58-H62 PolarHBondContact OD2-CD2 3.37Å; D58-H62 IonicContact OD2-NE2 3.97Å
59	A	95.8	Very high	96.6	Very high	52 Å²	52	95.2 Å²	95.2	43%	0.43	50%	0.498	S	S	.	.	H	α-helix	trans	-63	-34.7	175.8	0	0	0	0	0	112.4	Q56 E57 S63	Q56-A59 PolarHBondContact O-N 3.26Å; E57-A59 PolarHBondContact O-N 3.35Å; A59-S63 WeakPolarHBondContact O-CB 3.46Å; A59-S63 PolarHBondContact O-N 2.92Å; A59-S63 PolarHBondContact O-OG 3.11Å
60	I	97.1	Very high	96.7	Very high	99 Å²	99	98.5 Å²	98.5	51%	0.508	51%	0.507	S	S	.	.	H	α-helix	trans	-66.7	-48	175.4	-69.2	167.3	0	0	0	110.2	Q56 E57 D58 H62 S63 E64	Q56-I60 HydrophobicContact CG-CD1 4.13Å; Q56-I60 HydrophobicContact CG-CG1 4.39Å; Q56-I60 WeakPolarHBondContact O-CG1 3.33Å; Q56-I60 PolarHBondContact O-N 2.98Å; E57-I60 WeakPolarHBondContact O-CB 3.4Å; E57-I60 PolarHBondContact O-N 3.43Å; E57-I60 VanDerWaalsContact O-N 3.16Å; D58-I60 VanDerWaalsContact C-N 3.28Å; D58-I60 PolarHBondContact O-N 3.29Å; I60-H62 VanDerWaalsContact C-N 3.34Å; I60-H62 PolarHBondContact O-N 3.16Å; I60-S63 WeakPolarHBondContact O-CB 3.46Å; I60-S63 PolarHBondContact O-N 3.23Å; I60-S63 VanDerWaalsContact O-N 3.15Å; I60-E64 PolarHBondContact O-N 3.37Å
61	L	96.4	Very high	96.8	Very high	98 Å²	98	99.5 Å²	99.5	51%	0.513	51%	0.511	S	S	.	.	H	α-helix	trans	-60.3	-43.4	178.9	-68.5	172.6	0	0	0	111.8	E57 D58 S63 E64 D65	E57-L61 WeakPolarHBondContact O-CG 3.31Å; E57-L61 PolarHBondContact O-N 3.43Å; D58-L61 PolarHBondContact O-N 3.3Å; L61-S63 VanDerWaalsContact C-N 3.35Å; L61-S63 PolarHBondContact O-N 3.02Å; L61-E64 WeakPolarHBondContact O-CB 3.39Å; L61-E64 PolarHBondContact O-N 3.27Å; L61-D65 PolarHBondContact O-N 3.24Å; L61-D65 VanDerWaalsContact O-N 3.16Å
62	H	97	Very high	96.9	Very high	110 Å²	110	97.8 Å²	97.8	51%	0.509	51%	0.511	S	S	.	.	H	α-helix	trans	-64.6	-37.2	174.9	-82	-59.2	0	0	0	113.4	D58 I60 E64 D65 S66	D58-H62 PolarHBondContact O-CD2 2.99Å; D58-H62 VanDerWaalsContact O-CD2 3.29Å; D58-H62 PolarHBondContact O-N 3.47Å; D58-H62 IonicContact OD1-CD2 3.73Å; D58-H62 IonicContact OD1-NE2 2.74Å; D58-H62 IonicContact OD2-CD2 3.71Å; D58-H62 PolarHBondContact OD2-CD2 3.37Å; D58-H62 IonicContact OD2-NE2 3.97Å; I60-H62 VanDerWaalsContact C-N 3.34Å; I60-H62 PolarHBondContact O-N 3.16Å; H62-E64 VanDerWaalsContact C-N 3.34Å; H62-D65 PolarHBondContact O-N 3.03Å; H62-S66 PolarHBondContact O-N 2.72Å; H62-S66 VanDerWaalsContact O-N 3.11Å; H62-S66 PolarHBondContact O-OG 3.15Å
63	S	97.9	Very high	97	Very high	69 Å²	69	98.6 Å²	98.6	48%	0.483	51%	0.514	S	S	.	.	H	α-helix	trans	-65.8	-39	175.4	-61.5	0	0	0	0	111.3	A59 I60 L61 S66 L67	A59-S63 WeakPolarHBondContact O-CB 3.46Å; A59-S63 PolarHBondContact O-N 2.92Å; A59-S63 PolarHBondContact O-OG 3.11Å; I60-S63 WeakPolarHBondContact O-CB 3.46Å; I60-S63 PolarHBondContact O-N 3.23Å; I60-S63 VanDerWaalsContact O-N 3.15Å; L61-S63 VanDerWaalsContact C-N 3.35Å; L61-S63 PolarHBondContact O-N 3.02Å; S63-S66 WeakPolarHBondContact O-CB 3.42Å; S63-S66 PolarHBondContact O-N 3.47Å; S63-L67 WeakPolarHBondContact O-CG 3.33Å; S63-L67 PolarHBondContact O-N 3.4Å
64	E	97.9	Very high	97.1	Very high	95 Å²	95	96.1 Å²	96.1	44%	0.444	51%	0.507	S	S	.	.	H	α-helix	trans	-61.6	-45.7	176.1	-166.6	-160.3	140.5	0	0	112	I60 L61 H62 S66 L67 R68	I60-E64 PolarHBondContact O-N 3.37Å; L61-E64 WeakPolarHBondContact O-CB 3.39Å; L61-E64 PolarHBondContact O-N 3.27Å; H62-E64 VanDerWaalsContact C-N 3.34Å; E64-S66 VanDerWaalsContact C-N 3.31Å; E64-S66 PolarHBondContact O-N 3.5Å; E64-L67 PolarHBondContact O-N 3.05Å; E64-R68 PolarHBondContact O-N 3.09Å; E64-R68 IonicContact OE1-CZ 2.67Å; E64-R68 IonicContact OE1-NH1 3.92Å; E64-R68 IonicContact OE1-NH2 3.76Å; E64-R68 PolarHBondContact OE1-NH2 3.4Å
65	D	97.8	Very high	97.3	Very high	59 Å²	59	94.8 Å²	94.8	32%	0.316	50%	0.498	S	S	.	.	H	α-helix	trans	-61.3	-41	175.8	-177.4	58.2	0	0	0	112.1	L61 H62 L67 R68 K69	L61-D65 PolarHBondContact O-N 3.24Å; L61-D65 VanDerWaalsContact O-N 3.16Å; H62-D65 PolarHBondContact O-N 3.03Å; D65-L67 PolarHBondContact O-N 3.27Å; D65-R68 WeakPolarHBondContact O-CB 3.32Å; D65-R68 PolarHBondContact O-N 3.31Å; D65-R68 IonicContact OD1-NH1 3.74Å; D65-K69 PolarHBondContact O-N 2.82Å; D65-K69 VanDerWaalsContact OD2-CE 3.25Å; D65-K69 WeakPolarHBondContact OD2-CE 3.29Å; D65-K69 IonicContact OD2-NZ 3.4Å; D65-K69 PolarHBondContact OD2-NZ 2.91Å
66	S	98.2	Very high	97.6	Very high	62 Å²	62	93.7 Å²	93.7	43%	0.434	49%	0.49	S	S	.	.	H	α-helix	trans	-62.2	-42.6	175.6	-59	0	0	0	0	111.7	H62 S63 E64 R68 K69 M70	H62-S66 PolarHBondContact O-N 2.72Å; H62-S66 VanDerWaalsContact O-N 3.11Å; H62-S66 PolarHBondContact O-OG 3.15Å; S63-S66 WeakPolarHBondContact O-CB 3.42Å; S63-S66 PolarHBondContact O-N 3.47Å; E64-S66 VanDerWaalsContact C-N 3.31Å; E64-S66 PolarHBondContact O-N 3.5Å; S66-R68 PolarHBondContact O-N 3.47Å; S66-K69 PolarHBondContact O-N 3.36Å; S66-M70 WeakPolarHBondContact O-CG 3.33Å; S66-M70 PolarHBondContact O-N 3.48Å
67	L	98.4	Very high	97.7	Very high	112 Å²	112	92.8 Å²	92.8	59%	0.586	49%	0.489	S	S	*	.	H	α-helix	trans	-64	-38.4	175.6	-73.6	172.8	0	0	0	112.3	S63 E64 D65 M70 S71	S63-L67 WeakPolarHBondContact O-CG 3.33Å; S63-L67 PolarHBondContact O-N 3.4Å; E64-L67 PolarHBondContact O-N 3.05Å; D65-L67 PolarHBondContact O-N 3.27Å; L67-M70 HydrophobicContact CD2-SD 4.4Å; L67-M70 PolarHBondContact O-N 3.16Å; L67-S71 PolarHBondContact O-N 3.46Å
68	R	98.4	Very high	97.8	Very high	128 Å²	128	92.2 Å²	92.2	48%	0.483	49%	0.486	S	S	.	.	H	α-helix	trans	-61.2	-45.4	175.1	-174.2	-178.3	-69.6	101.2	5.1	111.4	E64 D65 S66 S71 I72	E64-R68 PolarHBondContact O-N 3.09Å; E64-R68 IonicContact OE1-CZ 2.67Å; E64-R68 IonicContact OE1-NH1 3.92Å; E64-R68 IonicContact OE1-NH2 3.76Å; E64-R68 PolarHBondContact OE1-NH2 3.4Å; D65-R68 WeakPolarHBondContact O-CB 3.32Å; D65-R68 PolarHBondContact O-N 3.31Å; D65-R68 IonicContact OD1-NH1 3.74Å; S66-R68 PolarHBondContact O-N 3.47Å; R68-S71 PolarHBondContact O-N 2.89Å; R68-I72 PolarHBondContact O-N 2.88Å
69	K	98.4	Very high	98.1	Very high	117 Å²	117	95.2 Å²	95.2	51%	0.509	49%	0.492	S	S	.	.	H	α-helix	trans	-61	-43.6	174.3	-71.1	166	177.1	159.5	0	111.6	D65 S66 S71 I72 I73	D65-K69 PolarHBondContact O-N 2.82Å; D65-K69 VanDerWaalsContact OD2-CE 3.25Å; D65-K69 WeakPolarHBondContact OD2-CE 3.29Å; D65-K69 IonicContact OD2-NZ 3.4Å; D65-K69 PolarHBondContact OD2-NZ 2.91Å; S66-K69 PolarHBondContact O-N 3.36Å; K69-S71 VanDerWaalsContact C-N 3.35Å; K69-S71 PolarHBondContact O-N 2.91Å; K69-I72 PolarHBondContact O-N 3.29Å; K69-I73 WeakPolarHBondContact O-CG1 3.35Å; K69-I73 PolarHBondContact O-N 3.47Å; K69-I73 VanDerWaalsContact O-N 3.09Å
70	M	98.6	Very high	98.2	Very high	111 Å²	111	98.1 Å²	98.1	55%	0.547	50%	0.496	S	S	.	.	H	α-helix	trans	-61.8	-41	176.1	-73.2	176.9	65.3	0	0	112.2	S66 L67 I72 I73 T74	S66-M70 WeakPolarHBondContact O-CG 3.33Å; S66-M70 PolarHBondContact O-N 3.48Å; L67-M70 HydrophobicContact CD2-SD 4.4Å; L67-M70 PolarHBondContact O-N 3.16Å; M70-I72 VanDerWaalsContact C-N 3.28Å; M70-I72 PolarHBondContact O-N 2.89Å; M70-I73 PolarHBondContact O-N 3.06Å; M70-T74 PolarHBondContact O-N 3.22Å; M70-T74 PolarHBondContact O-OG1 3.28Å; M70-T74 VanDerWaalsContact O-OG1 3.06Å
71	S	98.5	Very high	98.3	Very high	76 Å²	76	100 Å²	100	53%	0.531	50%	0.503	S	S	.	.	H	α-helix	trans	-59.2	-40.4	177.5	-174	0	0	0	0	111.9	L67 R68 K69 T74 T75	L67-S71 PolarHBondContact O-N 3.46Å; R68-S71 PolarHBondContact O-N 2.89Å; K69-S71 VanDerWaalsContact C-N 3.35Å; K69-S71 PolarHBondContact O-N 2.91Å; S71-T74 PolarHBondContact O-N 2.98Å; S71-T75 PolarHBondContact O-N 2.84Å; S71-T75 VanDerWaalsContact O-N 3.12Å; S71-T75 PolarHBondContact O-OG1 3.46Å
72	I	98.4	Very high	98.4	Very high	94 Å²	94	100.5 Å²	100.5	48%	0.482	50%	0.503	S	S	.	.	H	α-helix	trans	-65.3	-45.5	176.4	-65.5	166.9	0	0	0	110.6	R68 K69 M70 T74 T75 H76	R68-I72 PolarHBondContact O-N 2.88Å; K69-I72 PolarHBondContact O-N 3.29Å; M70-I72 VanDerWaalsContact C-N 3.28Å; M70-I72 PolarHBondContact O-N 2.89Å; I72-T74 VanDerWaalsContact C-N 3.32Å; I72-T74 PolarHBondContact O-N 3.2Å; I72-T75 PolarHBondContact O-N 3.49Å; I72-H76 PolarHBondContact O-CD2 3.38Å; I72-H76 PolarHBondContact O-N 2.86Å
73	I	98.6	Very high	98.4	Very high	98 Å²	98	97.8 Å²	97.8	50%	0.503	50%	0.499	S	S	.	.	H	α-helix	trans	-59.1	-45.3	177.1	-68.2	167.6	0	0	0	110.6	K69 M70 T75 H76 L77	K69-I73 WeakPolarHBondContact O-CG1 3.35Å; K69-I73 PolarHBondContact O-N 3.47Å; K69-I73 VanDerWaalsContact O-N 3.09Å; M70-I73 PolarHBondContact O-N 3.06Å; I73-T75 VanDerWaalsContact C-N 3.32Å; I73-T75 PolarHBondContact O-N 3.36Å; I73-H76 PolarHBondContact O-N 3.35Å; I73-H76 VanDerWaalsContact O-N 3.16Å; I73-L77 HydrophobicContact CG2-CD1 3.93Å; I73-L77 HydrophobicContact CG2-CG 4.26Å; I73-L77 WeakPolarHBondContact O-CG 3.48Å; I73-L77 PolarHBondContact O-N 3.43Å
74	T	98.7	Very high	98.5	Very high	82 Å²	82	99.7 Å²	99.7	50%	0.503	50%	0.502	S	S	.	.	H	α-helix	trans	-57.1	-45.4	176.9	-61.9	0	0	0	0	111.5	M70 S71 I72 H76 L77 Q78	M70-T74 PolarHBondContact O-N 3.22Å; M70-T74 PolarHBondContact O-OG1 3.28Å; M70-T74 VanDerWaalsContact O-OG1 3.06Å; S71-T74 PolarHBondContact O-N 2.98Å; I72-T74 VanDerWaalsContact C-N 3.32Å; I72-T74 PolarHBondContact O-N 3.2Å; T74-H76 PolarHBondContact O-N 3.29Å; T74-L77 PolarHBondContact O-N 2.89Å; T74-Q78 PolarHBondContact O-N 3.14Å
75	T	98.6	Very high	98.5	Very high	67 Å²	67	100.9 Å²	100.9	41%	0.411	51%	0.508	S	S	.	.	H	α-helix	trans	-60	-45	175.9	-61	0	0	0	0	111.8	S71 I72 I73 L77 Q78 Y79	S71-T75 PolarHBondContact O-N 2.84Å; S71-T75 VanDerWaalsContact O-N 3.12Å; S71-T75 PolarHBondContact O-OG1 3.46Å; I72-T75 PolarHBondContact O-N 3.49Å; I73-T75 VanDerWaalsContact C-N 3.32Å; I73-T75 PolarHBondContact O-N 3.36Å; T75-L77 PolarHBondContact O-N 3.02Å; T75-Q78 PolarHBondContact O-N 3.36Å; T75-Y79 HydrophobicContact CG2-CD2 3.79Å; T75-Y79 HydrophobicContact CG2-CE2 3.62Å; T75-Y79 VanDerWaalsContact O-CD2 3.26Å; T75-Y79 WeakPolarHBondContact O-CD2 3.45Å; T75-Y79 PolarHBondContact O-N 3.09Å
76	H	98.8	Very high	98.5	Very high	106 Å²	106	105.3 Å²	105.3	49%	0.491	53%	0.525	S	S	.	.	H	α-helix	trans	-63.8	-41.4	177.2	-76.4	-64.8	0	0	0	112.9	I72 I73 T74 Q78 Y79 Q80	I72-H76 PolarHBondContact O-CD2 3.38Å; I72-H76 PolarHBondContact O-N 2.86Å; I73-H76 PolarHBondContact O-N 3.35Å; I73-H76 VanDerWaalsContact O-N 3.16Å; T74-H76 PolarHBondContact O-N 3.29Å; H76-Q78 VanDerWaalsContact C-N 3.28Å; H76-Q78 PolarHBondContact O-N 2.9Å; H76-Y79 PolarHBondContact O-N 3.4Å; H76-Q80 WeakPolarHBondContact O-CB 3.46Å; H76-Q80 VanDerWaalsContact O-CG 3.29Å; H76-Q80 WeakPolarHBondContact O-CG 3.44Å; H76-Q80 PolarHBondContact O-N 2.99Å
77	L	98.8	Very high	98.5	Very high	99 Å²	99	107.1 Å²	107.1	52%	0.518	53%	0.53	S	S	.	.	H	α-helix	trans	-61.8	-39	176	-72.2	174.4	0	0	0	111.3	I73 T74 T75 Q80 Q81	I73-L77 HydrophobicContact CG2-CD1 3.93Å; I73-L77 HydrophobicContact CG2-CG 4.26Å; I73-L77 WeakPolarHBondContact O-CG 3.48Å; I73-L77 PolarHBondContact O-N 3.43Å; T74-L77 PolarHBondContact O-N 2.89Å; T75-L77 PolarHBondContact O-N 3.02Å; L77-Q80 PolarHBondContact O-N 3.05Å; L77-Q81 WeakPolarHBondContact O-CB 3.36Å; L77-Q81 PolarHBondContact O-N 3.23Å
78	Q	98.6	Very high	98.5	Very high	108 Å²	108	105.9 Å²	105.9	51%	0.505	53%	0.526	S	S	.	.	H	α-helix	trans	-65.3	-46.1	176.2	-172.1	167.5	-17.2	0	0	111.9	T74 T75 H76 Q80 Q81 E82	T74-Q78 PolarHBondContact O-N 3.14Å; T75-Q78 PolarHBondContact O-N 3.36Å; H76-Q78 VanDerWaalsContact C-N 3.28Å; H76-Q78 PolarHBondContact O-N 2.9Å; Q78-Q80 VanDerWaalsContact C-N 3.3Å; Q78-Q80 PolarHBondContact O-N 3.26Å; Q78-Q81 PolarHBondContact O-N 3.03Å; Q78-E82 WeakPolarHBondContact O-CG 3.32Å; Q78-E82 PolarHBondContact O-N 3.39Å
79	Y	98.6	Very high	98.4	Very high	158 Å²	158	105.4 Å²	105.4	62%	0.62	53%	0.53	S	S	*	.	H	α-helix	trans	-57.5	-42.8	173	-86.2	-68.2	0	0	0	112.4	T75 H76 E82 A83	T75-Y79 HydrophobicContact CG2-CD2 3.79Å; T75-Y79 HydrophobicContact CG2-CE2 3.62Å; T75-Y79 VanDerWaalsContact O-CD2 3.26Å; T75-Y79 WeakPolarHBondContact O-CD2 3.45Å; T75-Y79 PolarHBondContact O-N 3.09Å; H76-Y79 PolarHBondContact O-N 3.4Å; Y79-E82 PolarHBondContact O-N 2.88Å; Y79-A83 PolarHBondContact O-N 3.06Å
80	Q	98.6	Very high	98.4	Very high	113 Å²	113	105 Å²	105	53%	0.528	53%	0.529	S	S	.	.	H	α-helix	trans	-65.5	-41.9	177.9	-72.7	175.1	17.5	0	0	111.7	H76 L77 Q78 A83 I84	H76-Q80 WeakPolarHBondContact O-CB 3.46Å; H76-Q80 VanDerWaalsContact O-CG 3.29Å; H76-Q80 WeakPolarHBondContact O-CG 3.44Å; H76-Q80 PolarHBondContact O-N 2.99Å; L77-Q80 PolarHBondContact O-N 3.05Å; Q78-Q80 VanDerWaalsContact C-N 3.3Å; Q78-Q80 PolarHBondContact O-N 3.26Å; Q80-A83 PolarHBondContact O-N 3.44Å; Q80-I84 VanDerWaalsContact O-CG1 3.26Å; Q80-I84 WeakPolarHBondContact O-CG1 3.47Å; Q80-I84 PolarHBondContact O-N 3.3Å
81	Q	98.4	Very high	98.3	Very high	139 Å²	139	103 Å²	103	65%	0.65	53%	0.527	S	S	*	.	H	α-helix	trans	-60.9	-45.2	176.7	-179.4	-179.9	-7.5	0	0	111.6	L77 Q78 A83 I84 Q85	L77-Q81 WeakPolarHBondContact O-CB 3.36Å; L77-Q81 PolarHBondContact O-N 3.23Å; Q78-Q81 PolarHBondContact O-N 3.03Å; Q81-A83 PolarHBondContact O-N 3.33Å; Q81-I84 PolarHBondContact O-N 2.95Å; Q81-Q85 WeakPolarHBondContact O-CB 3.4Å; Q81-Q85 PolarHBondContact O-N 2.76Å
82	E	98.5	Very high	98.2	Very high	108 Å²	108	105.7 Å²	105.7	51%	0.505	53%	0.529	S	S	.	.	H	α-helix	trans	-61.9	-43.3	177	-72.6	174.7	-166.6	0	0	111.8	Q78 Y79 Q85 K86	Q78-E82 WeakPolarHBondContact O-CG 3.32Å; Q78-E82 PolarHBondContact O-N 3.39Å; Y79-E82 PolarHBondContact O-N 2.88Å; E82-Q85 PolarHBondContact O-N 3.46Å; E82-K86 PolarHBondContact O-N 2.85Å
83	A	98.4	Very high	98.1	Very high	52 Å²	52	104.8 Å²	104.8	43%	0.43	53%	0.525	S	S	.	.	H	α-helix	trans	-62.4	-43.5	176.3	0	0	0	0	0	112.1	Y79 Q80 Q81 K86 N87	Y79-A83 PolarHBondContact O-N 3.06Å; Q80-A83 PolarHBondContact O-N 3.44Å; Q81-A83 PolarHBondContact O-N 3.33Å; A83-K86 PolarHBondContact O-N 3.44Å; A83-N87 VanDerWaalsContact O-CG 3.25Å; A83-N87 PolarHBondContact O-N 3.49Å; A83-N87 VanDerWaalsContact O-N 3.07Å; A83-N87 PolarHBondContact O-ND2 3.23Å
84	I	98.4	Very high	98.1	Very high	109 Å²	109	104.2 Å²	104.2	56%	0.559	52%	0.522	S	S	*	.	H	α-helix	trans	-61.9	-46.8	176	-69.9	165.1	0	0	0	110.4	Q80 Q81 K86 N87 V88	Q80-I84 VanDerWaalsContact O-CG1 3.26Å; Q80-I84 WeakPolarHBondContact O-CG1 3.47Å; Q80-I84 PolarHBondContact O-N 3.3Å; Q81-I84 PolarHBondContact O-N 2.95Å; I84-K86 VanDerWaalsContact C-N 3.33Å; I84-K86 PolarHBondContact O-N 2.92Å; I84-N87 PolarHBondContact O-N 3.38Å; I84-N87 VanDerWaalsContact O-N 3.13Å; I84-V88 HydrophobicContact CG2-CG2 4.42Å; I84-V88 WeakPolarHBondContact O-CG2 3.38Å; I84-V88 PolarHBondContact O-N 3.42Å
85	Q	98.4	Very high	98	Very high	120 Å²	120	106.4 Å²	106.4	56%	0.561	53%	0.527	S	S	*	.	H	α-helix	trans	-58.6	-45.4	-180	-175.6	61.9	38.8	0	0	111.7	Q81 E82 N87 V88 E89	Q81-Q85 WeakPolarHBondContact O-CB 3.4Å; Q81-Q85 PolarHBondContact O-N 2.76Å; E82-Q85 PolarHBondContact O-N 3.46Å; Q85-N87 VanDerWaalsContact C-N 3.32Å; Q85-N87 PolarHBondContact O-N 3.41Å; Q85-V88 PolarHBondContact O-N 2.92Å; Q85-E89 PolarHBondContact O-N 3.08Å; Q85-E89 VanDerWaalsContact O-N 3.07Å
86	K	98.2	Very high	97.8	Very high	152 Å²	152	107.5 Å²	107.5	66%	0.661	53%	0.53	S	S	*	.	H	α-helix	trans	-61.3	-40.7	176.6	-173.2	179.3	179.5	-179.6	0	112	E82 A83 I84 E89 H90	E82-K86 PolarHBondContact O-N 2.85Å; A83-K86 PolarHBondContact O-N 3.44Å; I84-K86 VanDerWaalsContact C-N 3.33Å; I84-K86 PolarHBondContact O-N 2.92Å; K86-E89 PolarHBondContact O-N 3.06Å; K86-H90 WeakPolarHBondContact O-CB 3.33Å; K86-H90 PolarHBondContact O-N 2.93Å
87	N	97.9	Very high	97.7	Very high	101 Å²	101	108.2 Å²	108.2	54%	0.54	53%	0.534	S	S	.	.	H	α-helix	trans	-67.3	-37.4	178.4	-72.2	-11.6	0	0	0	112.4	A83 I84 Q85 H90 S91	A83-N87 VanDerWaalsContact O-CG 3.25Å; A83-N87 PolarHBondContact O-N 3.49Å; A83-N87 VanDerWaalsContact O-N 3.07Å; A83-N87 PolarHBondContact O-ND2 3.23Å; I84-N87 PolarHBondContact O-N 3.38Å; I84-N87 VanDerWaalsContact O-N 3.13Å; Q85-N87 VanDerWaalsContact C-N 3.32Å; Q85-N87 PolarHBondContact O-N 3.41Å; N87-H90 PolarHBondContact O-N 2.93Å; N87-S91 WeakPolarHBondContact O-CB 3.21Å; N87-S91 PolarHBondContact O-N 3.46Å; N87-S91 PolarHBondContact O-OG 3.44Å
88	V	98	Very high	97.6	Very high	86 Å²	86	108.3 Å²	108.3	52%	0.521	53%	0.534	S	S	.	.	H	α-helix	trans	-63.3	-46.9	175.2	169.8	0	0	0	0	110.7	I84 Q85 S91 K92	I84-V88 HydrophobicContact CG2-CG2 4.42Å; I84-V88 WeakPolarHBondContact O-CG2 3.38Å; I84-V88 PolarHBondContact O-N 3.42Å; Q85-V88 PolarHBondContact O-N 2.92Å; V88-S91 PolarHBondContact O-N 2.9Å; V88-K92 PolarHBondContact O-N 2.91Å
89	E	97.3	Very high	97.5	Very high	117 Å²	117	106.4 Å²	106.4	55%	0.547	53%	0.53	S	S	.	.	H	α-helix	trans	-62.4	-44	177	-174.1	176.2	-173.8	0	0	111.8	Q85 K86 S91 K92 N93	Q85-E89 PolarHBondContact O-N 3.08Å; Q85-E89 VanDerWaalsContact O-N 3.07Å; K86-E89 PolarHBondContact O-N 3.06Å; E89-S91 VanDerWaalsContact C-N 3.34Å; E89-S91 PolarHBondContact O-N 3.2Å; E89-K92 WeakPolarHBondContact O-CB 3.46Å; E89-K92 PolarHBondContact O-N 3.12Å; E89-N93 PolarHBondContact O-N 3.29Å; E89-N93 PolarHBondContact O-ND2 3.14Å
90	H	97.4	Very high	97.3	Very high	108 Å²	108	106 Å²	106	50%	0.5	53%	0.533	S	S	.	.	H	α-helix	trans	-60.9	-43.2	176.2	-174.6	66.6	0	0	0	112.3	K86 N87 K92 N93 L94	K86-H90 WeakPolarHBondContact O-CB 3.33Å; K86-H90 PolarHBondContact O-N 2.93Å; N87-H90 PolarHBondContact O-N 2.93Å; H90-K92 VanDerWaalsContact C-N 3.31Å; H90-K92 PolarHBondContact O-N 3.43Å; H90-N93 WeakPolarHBondContact O-CB 3.37Å; H90-N93 PolarHBondContact O-N 3.44Å; H90-L94 WeakPolarHBondContact O-CG 3.31Å; H90-L94 PolarHBondContact O-N 2.95Å
91	S	97.6	Very high	97.1	Very high	71 Å²	71	107.2 Å²	107.2	50%	0.497	54%	0.543	S	S	.	.	H	α-helix	trans	-62.3	-39.2	178	-59.1	0	0	0	0	112	N87 V88 E89 L94 Q95	N87-S91 WeakPolarHBondContact O-CB 3.21Å; N87-S91 PolarHBondContact O-N 3.46Å; N87-S91 PolarHBondContact O-OG 3.44Å; V88-S91 PolarHBondContact O-N 2.9Å; E89-S91 VanDerWaalsContact C-N 3.34Å; E89-S91 PolarHBondContact O-N 3.2Å; S91-L94 PolarHBondContact O-N 2.96Å; S91-Q95 WeakPolarHBondContact O-CB 3.3Å; S91-Q95 PolarHBondContact O-N 3.29Å
92	K	96.6	Very high	96.8	Very high	131 Å²	131	107.1 Å²	107.1	57%	0.57	55%	0.546	S	S	*	.	H	α-helix	trans	-62.2	-46.5	174.3	-173.6	-178	176.6	-175.2	0	111.6	V88 E89 H90 L94 Q95 D96	V88-K92 PolarHBondContact O-N 2.91Å; E89-K92 WeakPolarHBondContact O-CB 3.46Å; E89-K92 PolarHBondContact O-N 3.12Å; H90-K92 VanDerWaalsContact C-N 3.31Å; H90-K92 PolarHBondContact O-N 3.43Å; K92-L94 VanDerWaalsContact C-N 3.32Å; K92-L94 PolarHBondContact O-N 3.44Å; K92-Q95 WeakPolarHBondContact O-CB 3.47Å; K92-Q95 PolarHBondContact O-N 3.12Å; K92-Q95 VanDerWaalsContact O-N 3.14Å; K92-D96 PolarHBondContact O-N 2.94Å
93	N	96.8	Very high	95.3	Very high	75 Å²	75	112.9 Å²	112.9	40%	0.401	57%	0.569	S	S	.	*	H	α-helix	trans	-59.3	-42.8	177	-69.8	-29.6	0	0	0	111.9	E89 H90 Q95 D96 Q97	E89-N93 PolarHBondContact O-N 3.29Å; E89-N93 PolarHBondContact O-ND2 3.14Å; H90-N93 WeakPolarHBondContact O-CB 3.37Å; H90-N93 PolarHBondContact O-N 3.44Å; N93-Q95 VanDerWaalsContact C-N 3.35Å; N93-D96 PolarHBondContact O-N 3.48Å; N93-Q97 VanDerWaalsContact O-CG 3.29Å; N93-Q97 WeakPolarHBondContact O-CG 3.33Å; N93-Q97 PolarHBondContact O-N 2.84Å
94	L	96.9	Very high	95.2	Very high	86 Å²	86	115.9 Å²	115.9	45%	0.45	58%	0.576	S	S	.	*	H	α-helix	trans	-62.9	-41.1	175.5	-71.5	177.8	0	0	0	112	H90 S91 K92 Q97 L98	H90-L94 WeakPolarHBondContact O-CG 3.31Å; H90-L94 PolarHBondContact O-N 2.95Å; S91-L94 PolarHBondContact O-N 2.96Å; K92-L94 VanDerWaalsContact C-N 3.32Å; K92-L94 PolarHBondContact O-N 3.44Å; L94-Q97 PolarHBondContact O-N 2.95Å; L94-L98 WeakPolarHBondContact O-CB 3.47Å; L94-L98 PolarHBondContact O-N 3.36Å
95	Q	96.9	Very high	95	Very high	129 Å²	129	116.3 Å²	116.3	60%	0.603	58%	0.577	S	S	*	*	H	α-helix	trans	-64	-41.2	177.2	-172.1	176.5	17.4	0	0	111.9	S91 K92 N93 L98 T99	S91-Q95 WeakPolarHBondContact O-CB 3.3Å; S91-Q95 PolarHBondContact O-N 3.29Å; K92-Q95 WeakPolarHBondContact O-CB 3.47Å; K92-Q95 PolarHBondContact O-N 3.12Å; K92-Q95 VanDerWaalsContact O-N 3.14Å; N93-Q95 VanDerWaalsContact C-N 3.35Å; Q95-L98 PolarHBondContact O-N 3.4Å; Q95-T99 WeakPolarHBondContact O-CB 3.43Å; Q95-T99 PolarHBondContact O-N 3.48Å; Q95-T99 PolarHBondContact O-OG1 2.86Å
96	D	95.9	Very high	94.8	Very high	90 Å²	90	116.1 Å²	116.1	48%	0.481	58%	0.578	S	S	.	*	H	α-helix	trans	-64.1	-43.7	176.3	-70.9	-22.3	0	0	0	111.1	K92 N93 T99 H100	K92-D96 PolarHBondContact O-N 2.94Å; N93-D96 PolarHBondContact O-N 3.48Å; D96-T99 PolarHBondContact O-N 3.41Å; D96-H100 PolarHBondContact O-N 3.42Å
97	Q	95.6	Very high	94.6	Very high	120 Å²	120	113.9 Å²	113.9	56%	0.561	57%	0.573	S	S	*	*	H	α-helix	trans	-60.7	-45.8	175.1	-73.1	174.3	14.6	0	0	112.1	N93 L94 T99 H100 L101	N93-Q97 VanDerWaalsContact O-CG 3.29Å; N93-Q97 WeakPolarHBondContact O-CG 3.33Å; N93-Q97 PolarHBondContact O-N 2.84Å; L94-Q97 PolarHBondContact O-N 2.95Å; Q97-T99 VanDerWaalsContact C-N 3.31Å; Q97-T99 PolarHBondContact O-N 3.09Å; Q97-H100 PolarHBondContact O-N 3.44Å; Q97-L101 WeakPolarHBondContact O-CG 3.45Å; Q97-L101 PolarHBondContact O-N 2.88Å; Q97-L101 VanDerWaalsContact O-N 3.1Å
98	L	96.7	Very high	94.4	Very high	102 Å²	102	114.8 Å²	114.8	53%	0.534	58%	0.575	S	S	.	*	H	α-helix	trans	-61	-42.8	177.2	-176.6	65.8	0	0	0	111.2	L94 Q95 H100 L101 L102	L94-L98 WeakPolarHBondContact O-CB 3.47Å; L94-L98 PolarHBondContact O-N 3.36Å; Q95-L98 PolarHBondContact O-N 3.4Å; L98-H100 VanDerWaalsContact C-N 3.29Å; L98-H100 PolarHBondContact O-N 3.46Å; L98-L101 PolarHBondContact O-N 3.03Å; L98-L102 HydrophobicContact CD1-CD1 4.09Å; L98-L102 HydrophobicContact CD1-CG 4.43Å; L98-L102 HydrophobicContact CG-CD1 3.91Å; L98-L102 WeakPolarHBondContact O-CG 3.49Å; L98-L102 PolarHBondContact O-N 2.82Å; L98-L102 VanDerWaalsContact O-N 3.15Å
99	T	96.4	Very high	94.2	Very high	67 Å²	67	116.7 Å²	116.7	41%	0.411	58%	0.579	S	S	.	*	H	α-helix	trans	-63.3	-36.3	178.4	-56	0	0	0	0	111.9	Q95 D96 Q97	Q95-T99 WeakPolarHBondContact O-CB 3.43Å; Q95-T99 PolarHBondContact O-N 3.48Å; Q95-T99 PolarHBondContact O-OG1 2.86Å; D96-T99 PolarHBondContact O-N 3.41Å; Q97-T99 VanDerWaalsContact C-N 3.31Å; Q97-T99 PolarHBondContact O-N 3.09Å
100	H	95.4	Very high	93.9	Very high	150 Å²	150	116.6 Å²	116.6	69%	0.694	58%	0.581	S	S	*	*	H	α-helix	trans	-68.8	-36.5	175.8	-172.5	-69.8	0	0	0	112.4	D96 Q97 L98 L102	D96-H100 PolarHBondContact O-N 3.42Å; Q97-H100 PolarHBondContact O-N 3.44Å; L98-H100 VanDerWaalsContact C-N 3.29Å; L98-H100 PolarHBondContact O-N 3.46Å; H100-L102 VanDerWaalsContact C-N 3.33Å
101	L	94.5	Very high	93.7	Very high	138 Å²	138	117.3 Å²	117.3	72%	0.723	59%	0.588	S	S	*	*	H	α-helix	trans	-73	-24.3	179	-72.4	171.5	0	0	0	113.7	Q97 L98	Q97-L101 WeakPolarHBondContact O-CG 3.45Å; Q97-L101 PolarHBondContact O-N 2.88Å; Q97-L101 VanDerWaalsContact O-N 3.1Å; L98-L101 PolarHBondContact O-N 3.03Å
102	L	91.9	Very high	93.4	Very high	138 Å²	138	121.2 Å²	121.2	72%	0.723	60%	0.595	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.8	5	-178.4	-67.1	173.5	0	0	0	113.8	L98 H100	L98-L102 HydrophobicContact CD1-CD1 4.09Å; L98-L102 HydrophobicContact CD1-CG 4.43Å; L98-L102 HydrophobicContact CG-CD1 3.91Å; L98-L102 WeakPolarHBondContact O-CG 3.49Å; L98-L102 PolarHBondContact O-N 2.82Å; L98-L102 VanDerWaalsContact O-N 3.15Å; H100-L102 VanDerWaalsContact C-N 3.33Å
103	K	66.7	Low	93.1	Very high	228 Å²	228	120.3 Å²	120.3	99%	0.991	60%	0.597	S	S	*	*			trans	-102.3	0	171.6	-76.3	179.2	178.6	177.2	0	110.4

Retrieved 103 of 103 residues in 30.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).