A0A087X6D0_POEFO Loading...

U6 snRNA-associated Sm-like protein LSm5

Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA. Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.

AlphaFold DB (A0A3Q2DQ55), UniProt , Accession A0A087X6D0, Species POEFO (Poecilia formosa, Amazon molly), Gene LSM5, Length 91 aa.

						>A0A087X6D0_POEFO|A0A087X6D0|LSM5
MAATPATNPSQLLPLELVDKCIGSRIHIVMKTDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLIPGGEGPEV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.4	Very low	62.2	Low	243 Å²	243	121.5 Å²	121.5	100%	1.197	77%	0.772	S	S	*	*				0	92.3	0	-61.4	-57.4	-153	0	0	107.7
2	A	45.8	Very low	64	Low	107 Å²	107	118 Å²	118	88%	0.884	74%	0.743	S	S	*	*	P	Polyproline II helix	trans	-80.9	129.8	175.3	0	0	0	0	0	108.3	T4	A2-T4 PolarHBondContact O-N 2.92Å
3	A	52.9	Low	66	Low	96 Å²	96	115.8 Å²	115.8	79%	0.793	72%	0.721	S	S	*	*	P	Polyproline II helix	trans	-65.4	125.7	177.5	0	0	0	0	0	109.6	P5	A3-P5 WeakPolarHBondContact O-CD 3.29Å
4	T	59.6	Low	67.7	Low	133 Å²	133	114.8 Å²	114.8	82%	0.816	72%	0.717	S	S	*	*	P	Polyproline II helix	trans	-61.5	118.8	166	22.4	0	0	0	0	108.2	A2 A6	A2-T4 PolarHBondContact O-N 2.92Å; T4-A6 PolarHBondContact O-N 2.82Å
5	P	61.8	Low	69.3	Low	114 Å²	114	113 Å²	113	74%	0.74	70%	0.7	S	S	*	*	P	Polyproline II helix	trans	-61.4	132.4	175.9	25	-31.4	0	0	0	108.5	A3 T7	A3-P5 WeakPolarHBondContact O-CD 3.29Å; P5-T7 PolarHBondContact O-N 3.34Å
6	A	61	Low	70.7	Confident	103 Å²	103	110.6 Å²	110.6	85%	0.851	68%	0.678	S	S	*	*			trans	-60.9	110.7	173.8	0	0	0	0	0	108.5	T4 N8	T4-A6 PolarHBondContact O-N 2.82Å; A6-N8 PolarHBondContact O-N 3Å
7	T	61	Low	71.9	Confident	102 Å²	102	108.5 Å²	108.5	63%	0.626	66%	0.661	S	S	*	*			trans	-62.4	122.2	176	-2.8	0	0	0	0	108.2	P5	P5-T7 PolarHBondContact O-N 3.34Å
8	N	70.6	Confident	73.1	Confident	88 Å²	88	103.2 Å²	103.2	47%	0.471	63%	0.629	S	S	.	*			trans	-59.8	125.6	173.7	-172.4	-10.3	0	0	0	107.6	A6 S10 Q11	A6-N8 PolarHBondContact O-N 3Å; N8-S10 PolarHBondContact ND2-OG 2.67Å; N8-S10 PolarHBondContact O-N 3.4Å; N8-S10 PolarHBondContact OD1-N 3.07Å; N8-S10 PolarHBondContact OD1-OG 2.99Å; N8-Q11 HydrophobicContact CB-CB 4.12Å; N8-Q11 WeakPolarHBondContact O-CB 3.32Å; N8-Q11 PolarHBondContact O-N 3.04Å
9	P	66.2	Low	74.3	Confident	139 Å²	139	102.6 Å²	102.6	90%	0.903	62%	0.622	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.4	-11.7	-177.6	22.5	-34.4	0	0	0	114
10	S	77.6	Confident	75.3	Confident	97 Å²	97	103.6 Å²	103.6	68%	0.678	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.3	-2.1	171.9	55.2	0	0	0	0	114.7	N8	N8-S10 PolarHBondContact ND2-OG 2.67Å; N8-S10 PolarHBondContact O-N 3.4Å; N8-S10 PolarHBondContact OD1-N 3.07Å; N8-S10 PolarHBondContact OD1-OG 2.99Å
11	Q	78.4	Confident	76.2	Confident	114 Å²	114	99 Å²	99	53%	0.533	59%	0.59	S	S	.	*			trans	-96.4	103	178.6	-172.8	177.2	-9.6	0	0	109.8	N8	N8-Q11 HydrophobicContact CB-CB 4.12Å; N8-Q11 WeakPolarHBondContact O-CB 3.32Å; N8-Q11 PolarHBondContact O-N 3.04Å
12	L	83.2	Confident	78.5	Confident	80 Å²	80	90.8 Å²	90.8	42%	0.419	55%	0.55	S	S	.	*			trans	-91.8	124.6	174.5	-174.3	67	0	0	0	109.8	E16 L17 K20	L12-E16 HydrophobicContact CD1-CB 4.09Å; L12-E16 HydrophobicContact CD1-CG 3.98Å; L12-L17 HydrophobicContact CD2-CB 3.8Å; L12-L17 HydrophobicContact CD2-CD1 3.83Å; L12-L17 HydrophobicContact CD2-CG 4.24Å; L12-L17 HydrophobicContact CG-CB 4.19Å; L12-K20 HydrophobicContact CD1-CD 4.39Å; L12-K20 VanDerWaalsContact CD1-NZ 3.32Å
13	L	90.3	Very high	80.9	Confident	89 Å²	89	88.4 Å²	88.4	47%	0.466	54%	0.536	S	S	.	.			trans	-77.5	145.1	173.2	-64.5	177.4	0	0	0	110.3	L15 E16 L17	L13-L15 VanDerWaalsContact C-N 3.31Å; L13-L15 PolarHBondContact O-N 2.9Å; L13-E16 HydrophobicContact CB-CB 4.08Å; L13-E16 WeakPolarHBondContact O-CA 3.23Å; L13-E16 WeakPolarHBondContact O-CB 3.32Å; L13-E16 PolarHBondContact O-N 3.33Å; L13-L17 PolarHBondContact O-N 2.8Å
14	P	90.5	Very high	83	Confident	102 Å²	102	86.6 Å²	86.6	66%	0.662	52%	0.518	S	S	*	.	H	α-helix	trans	-55.1	-43.3	179.8	-28.7	35.8	0	0	0	113.7	E16 L17 V18	P14-E16 VanDerWaalsContact C-N 3.32Å; P14-E16 PolarHBondContact O-N 2.94Å; P14-L17 WeakPolarHBondContact O-CB 3.47Å; P14-L17 PolarHBondContact O-N 2.85Å; P14-V18 WeakPolarHBondContact O-CG2 3.48Å; P14-V18 PolarHBondContact O-N 2.76Å; P14-V18 VanDerWaalsContact O-N 3.13Å
15	L	91.7	Very high	84.8	Confident	88 Å²	88	86.5 Å²	86.5	46%	0.461	50%	0.503	S	S	.	.	H	α-helix	trans	-69.2	-30.2	177.5	-62.7	179.9	0	0	0	112.6	L13 L17 V18 D19 F43 V47	L13-L15 VanDerWaalsContact C-N 3.31Å; L13-L15 PolarHBondContact O-N 2.9Å; L15-L17 VanDerWaalsContact C-N 3.32Å; L15-V18 PolarHBondContact O-N 2.76Å; L15-D19 WeakPolarHBondContact O-CB 3.45Å; L15-D19 PolarHBondContact O-N 2.92Å; L15-F43 HydrophobicContact CD2-CE2 4.11Å; L15-V47 HydrophobicContact CD2-CG2 4.25Å
16	E	91.6	Very high	86.5	Confident	75 Å²	75	81.1 Å²	81.1	35%	0.35	47%	0.468	S	S	.	.	H	α-helix	trans	-68.7	-34	173.6	-167.8	-164.4	150.4	0	0	111.2	L12 L13 P14 K20	L12-E16 HydrophobicContact CD1-CB 4.09Å; L12-E16 HydrophobicContact CD1-CG 3.98Å; L13-E16 HydrophobicContact CB-CB 4.08Å; L13-E16 WeakPolarHBondContact O-CA 3.23Å; L13-E16 WeakPolarHBondContact O-CB 3.32Å; L13-E16 PolarHBondContact O-N 3.33Å; P14-E16 VanDerWaalsContact C-N 3.32Å; P14-E16 PolarHBondContact O-N 2.94Å; E16-K20 WeakPolarHBondContact O-CG 3.35Å; E16-K20 PolarHBondContact O-N 2.61Å; E16-K20 VanDerWaalsContact O-N 3.1Å; E16-K20 WeakPolarHBondContact OE1-CE 3.47Å; E16-K20 IonicContact OE1-NZ 2.93Å; E16-K20 PolarHBondContact OE1-NZ 3.4Å
17	L	91.2	Very high	88.2	Confident	74 Å²	74	76.8 Å²	76.8	39%	0.387	43%	0.429	S	S	.	.	H	α-helix	trans	-64.2	-44.8	171.5	178.1	62	0	0	0	111	L12 L13 P14 L15 D19 K20 C21 P84	L12-L17 HydrophobicContact CD2-CB 3.8Å; L12-L17 HydrophobicContact CD2-CD1 3.83Å; L12-L17 HydrophobicContact CD2-CG 4.24Å; L12-L17 HydrophobicContact CG-CB 4.19Å; L13-L17 PolarHBondContact O-N 2.8Å; P14-L17 WeakPolarHBondContact O-CB 3.47Å; P14-L17 PolarHBondContact O-N 2.85Å; L15-L17 VanDerWaalsContact C-N 3.32Å; L17-D19 VanDerWaalsContact C-N 3.35Å; L17-K20 PolarHBondContact O-N 2.9Å; L17-C21 PolarHBondContact O-N 3Å; L17-C21 PolarHBondContact O-SG 2.86Å; L17-P84 HydrophobicContact CD1-CG 4.49Å; L17-P84 HydrophobicContact CG-CG 4.49Å
18	V	93.6	Very high	89.9	Confident	13 Å²	13	71.9 Å²	71.9	8%	0.079	40%	0.4	C	S	.	.	H	α-helix	trans	-64.3	-40.7	178.6	-178.8	0	0	0	0	111.2	P14 L15 K20 C21 L40 F43 M49 L82	P14-V18 WeakPolarHBondContact O-CG2 3.48Å; P14-V18 PolarHBondContact O-N 2.76Å; P14-V18 VanDerWaalsContact O-N 3.13Å; L15-V18 PolarHBondContact O-N 2.76Å; V18-K20 VanDerWaalsContact C-N 3.32Å; V18-K20 PolarHBondContact O-N 2.85Å; V18-C21 WeakPolarHBondContact O-CA 3.46Å; V18-C21 VanDerWaalsContact O-CB 3.31Å; V18-C21 WeakPolarHBondContact O-CB 3.44Å; V18-C21 PolarHBondContact O-N 2.85Å; V18-L40 HydrophobicContact CG1-CD2 3.96Å; V18-F43 HydrophobicContact CB-CE1 4.2Å; V18-F43 HydrophobicContact CB-CZ 4.24Å; V18-F43 HydrophobicContact CG1-CD1 3.65Å; V18-F43 HydrophobicContact CG1-CD2 4.32Å; V18-F43 HydrophobicContact CG1-CE1 3.73Å; V18-F43 HydrophobicContact CG1-CE2 4.4Å; V18-F43 HydrophobicContact CG1-CG 3.98Å; V18-F43 HydrophobicContact CG1-CZ 4.11Å; V18-M49 HydrophobicContact CG1-CE 3.81Å; V18-L82 HydrophobicContact CG2-CD1 3.7Å
19	D	95.1	Very high	91.1	Very high	92 Å²	92	68.9 Å²	68.9	49%	0.492	38%	0.384	S	S	.	.	H	α-helix	trans	-57.6	-43.5	173.8	-174.1	73.5	0	0	0	112.1	L15 L17 C21 I22 F43	L15-D19 WeakPolarHBondContact O-CB 3.45Å; L15-D19 PolarHBondContact O-N 2.92Å; L17-D19 VanDerWaalsContact C-N 3.35Å; D19-C21 PolarHBondContact O-N 3.35Å; D19-C21 VanDerWaalsContact O-N 3.12Å; D19-I22 WeakPolarHBondContact O-CB 3.25Å; D19-I22 WeakPolarHBondContact O-CG1 2.96Å; D19-I22 PolarHBondContact O-N 2.82Å; D19-I22 VanDerWaalsContact O-N 3.11Å; D19-F43 HydrophobicContact CB-CE1 4.23Å; D19-F43 HydrophobicContact CB-CZ 4.38Å
20	K	93.9	Very high	92.4	Very high	122 Å²	122	63.1 Å²	63.1	53%	0.53	35%	0.346	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.6	-15.1	174	-72.2	173.5	-174.1	167.5	0	114.1	L12 E16 L17 V18	L12-K20 HydrophobicContact CD1-CD 4.39Å; L12-K20 VanDerWaalsContact CD1-NZ 3.32Å; E16-K20 WeakPolarHBondContact O-CG 3.35Å; E16-K20 PolarHBondContact O-N 2.61Å; E16-K20 VanDerWaalsContact O-N 3.1Å; E16-K20 WeakPolarHBondContact OE1-CE 3.47Å; E16-K20 IonicContact OE1-NZ 2.93Å; E16-K20 PolarHBondContact OE1-NZ 3.4Å; L17-K20 PolarHBondContact O-N 2.9Å; V18-K20 VanDerWaalsContact C-N 3.32Å; V18-K20 PolarHBondContact O-N 2.85Å
21	C	95	Very high	93.2	Very high	8 Å²	8	65.4 Å²	65.4	5%	0.054	34%	0.343	C	S	.	.	T	Hydrogen-bonded Turn	trans	-90.3	-5.2	177.4	-58.8	0	0	0	0	113.3	L17 V18 D19 G23 S24 L40 P84	L17-C21 PolarHBondContact O-N 3Å; L17-C21 PolarHBondContact O-SG 2.86Å; V18-C21 WeakPolarHBondContact O-CA 3.46Å; V18-C21 VanDerWaalsContact O-CB 3.31Å; V18-C21 WeakPolarHBondContact O-CB 3.44Å; V18-C21 PolarHBondContact O-N 2.85Å; D19-C21 PolarHBondContact O-N 3.35Å; D19-C21 VanDerWaalsContact O-N 3.12Å; C21-G23 PolarHBondContact O-N 3.02Å; C21-S24 WeakPolarHBondContact O-CA 3.48Å; C21-S24 VanDerWaalsContact O-CB 3.31Å; C21-S24 WeakPolarHBondContact O-CB 3.27Å; C21-S24 PolarHBondContact O-N 2.82Å; C21-L40 HydrophobicContact CB-CD2 4.11Å; C21-P84 WeakPolarHBondContact SG-CB 3.48Å; C21-P84 WeakPolarHBondContact SG-CG 3.49Å
22	I	96.8	Very high	93.8	Very high	70 Å²	70	64.2 Å²	64.2	36%	0.359	34%	0.344	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60.9	134.4	176	-63.3	171	0	0	0	109.5	D19 S24 L40 F43	D19-I22 WeakPolarHBondContact O-CB 3.25Å; D19-I22 WeakPolarHBondContact O-CG1 2.96Å; D19-I22 PolarHBondContact O-N 2.82Å; D19-I22 VanDerWaalsContact O-N 3.11Å; I22-S24 PolarHBondContact O-N 2.74Å; I22-L40 CarbonylContact C-O 3.59Å; I22-L40 WeakPolarHBondContact CA-O 3.33Å; I22-L40 HydrophobicContact CG1-CD2 4.06Å; I22-L40 HydrophobicContact CG1-CG 4.28Å; I22-F43 HydrophobicContact CD1-CD1 4.38Å; I22-F43 HydrophobicContact CD1-CE1 4.18Å
23	G	96.8	Very high	94	Very high	57 Å²	57	65.9 Å²	65.9	59%	0.588	35%	0.353	S	S	*	.	T	Hydrogen-bonded Turn	trans	76.3	-0.8	-172.9	0	0	0	0	0	114.4	C21 L40	C21-G23 PolarHBondContact O-N 3.02Å; G23-L40 PolarHBondContact N-O 2.94Å
24	S	97.1	Very high	94.2	Very high	58 Å²	58	63.9 Å²	63.9	41%	0.406	34%	0.341	S	S	.	.	S	Bend	trans	-107.4	158.1	177.3	-59.2	0	0	0	0	111.3	C21 I22 T39 L40	C21-S24 WeakPolarHBondContact O-CA 3.48Å; C21-S24 VanDerWaalsContact O-CB 3.31Å; C21-S24 WeakPolarHBondContact O-CB 3.27Å; C21-S24 PolarHBondContact O-N 2.82Å; I22-S24 PolarHBondContact O-N 2.74Å; S24-T39 WeakPolarHBondContact O-CA 3.4Å; S24-L40 PolarHBondContact O-N 3.36Å
25	R	96.8	Very high	94.4	Very high	132 Å²	132	61.1 Å²	61.1	50%	0.498	32%	0.319	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.2	134.6	172.3	-171.9	158.5	-80.9	154.4	-3.4	109.7	V37 G38 G85	R25-V37 HydrophobicContact CG-CG1 3.84Å; R25-G38 CarbonylContact C-O 3.6Å; R25-G38 WeakPolarHBondContact CA-O 3.46Å; R25-G85 VanDerWaalsContact O-CA 3.31Å; R25-G85 WeakPolarHBondContact O-CA 3.49Å; R25-G85 PolarHBondContact O-N 2.95Å
26	I	97.4	Very high	94.7	Very high	1 Å²	1	57 Å²	57	1%	0.005	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.4	142.7	178.2	-165.7	167.5	0	0	0	109.3	I28 V37 G38 L40 L51 L82	I26-I28 HydrophobicContact CG1-CG1 4.3Å; I26-I28 HydrophobicContact CG2-CD1 4.22Å; I26-I28 HydrophobicContact CG2-CG1 4.1Å; I26-V37 WeakPolarHBondContact O-CA 3.39Å; I26-G38 PolarHBondContact N-O 2.99Å; I26-G38 PolarHBondContact O-N 3.43Å; I26-L40 HydrophobicContact CD1-CD2 4.48Å; I26-L40 HydrophobicContact CG2-CB 4.03Å; I26-L51 HydrophobicContact CG2-CD2 3.87Å; I26-L82 HydrophobicContact CD1-CB 4.21Å; I26-L82 HydrophobicContact CD1-CD2 4.03Å
27	H	97.4	Very high	94.9	Very high	11 Å²	11	53.9 Å²	53.9	5%	0.051	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	124.1	170.8	175.2	-149.9	0	0	0	109.3	E35 I36 V37 I83	H27-E35 IonicContact CE1-OE2 3.86Å; H27-E35 PolarHBondContact CE1-OE2 2.8Å; H27-E35 IonicContact NE2-OE2 2.92Å; H27-E35 PolarHBondContact NE2-OE2 2.79Å; H27-I36 CarbonylContact C-O 3.52Å; H27-I36 WeakPolarHBondContact CA-O 3.33Å; H27-V37 HydrophobicContact CB-CG2 4.01Å; H27-I83 HydrophobicContact CB-CB 4.09Å; H27-I83 PolarHBondContact N-O 2.75Å; H27-I83 PolarHBondContact O-N 2.94Å
28	I	96.6	Very high	95.2	Very high	0 Å²	0	50.4 Å²	50.4	0%	0	27%	0.265	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.3	124.3	-175.1	-51.9	-171.6	0	0	0	109	I26 M30 E35 I36 M49 L51 L74 I79 M81 L82	I26-I28 HydrophobicContact CG1-CG1 4.3Å; I26-I28 HydrophobicContact CG2-CD1 4.22Å; I26-I28 HydrophobicContact CG2-CG1 4.1Å; I28-M30 HydrophobicContact CG2-SD 4.48Å; I28-E35 CarbonylContact O-C 3.59Å; I28-E35 WeakPolarHBondContact O-CA 3.36Å; I28-I36 HydrophobicContact CB-CB 4.4Å; I28-I36 PolarHBondContact N-O 2.77Å; I28-I36 PolarHBondContact O-N 2.9Å; I28-M49 HydrophobicContact CD1-SD 3.49Å; I28-M49 WeakPolarHBondContact CD1-SD 3.27Å; I28-L51 HydrophobicContact CD1-CD1 3.79Å; I28-L51 HydrophobicContact CD1-CD2 4.31Å; I28-L74 HydrophobicContact CB-CD2 4.39Å; I28-L74 HydrophobicContact CD1-CD2 3.7Å; I28-L74 HydrophobicContact CG2-CD2 3.85Å; I28-I79 HydrophobicContact CG2-CB 4.46Å; I28-I79 HydrophobicContact CG2-CD1 4.24Å; I28-I79 HydrophobicContact CG2-CG1 3.97Å; I28-I79 HydrophobicContact CG2-CG2 3.93Å; I28-M81 WeakPolarHBondContact CA-O 3.45Å; I28-L82 HydrophobicContact CB-CD2 4.3Å; I28-L82 HydrophobicContact CD1-CD2 3.89Å; I28-L82 HydrophobicContact CG1-CD2 3.73Å; I28-L82 HydrophobicContact CG2-CD2 3.96Å
29	V	95.5	Very high	95.4	Very high	24 Å²	24	50.6 Å²	50.6	15%	0.145	27%	0.267	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.8	124.7	175.4	-174.8	0	0	0	0	108.5	E35 T80 M81 I83	V29-E35 HydrophobicContact CB-CG 4.42Å; V29-E35 HydrophobicContact CG1-CG 4.13Å; V29-E35 HydrophobicContact CG2-CG 4.19Å; V29-T80 WeakPolarHBondContact O-CA 3.31Å; V29-T80 WeakPolarHBondContact O-CB 3.48Å; V29-T80 PolarHBondContact O-N 3.29Å; V29-M81 HydrophobicContact CB-CB 4.14Å; V29-M81 HydrophobicContact CB-CE 4.07Å; V29-M81 HydrophobicContact CG1-CE 4.02Å; V29-M81 HydrophobicContact CG2-CB 4.35Å; V29-M81 HydrophobicContact CG2-CE 4.12Å; V29-M81 PolarHBondContact N-O 3Å; V29-M81 PolarHBondContact O-N 2.86Å; V29-M81 VanDerWaalsContact O-N 3.15Å; V29-I83 HydrophobicContact CG2-CD1 4.23Å
30	M	95.3	Very high	95.6	Very high	19 Å²	19	46.2 Å²	46.2	9%	0.094	24%	0.243	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-85.5	172.9	180	-57.4	-74.3	-79.6	0	0	111	I28 T32 K34 I36 L74 N78 I79 T80	I28-M30 HydrophobicContact CG2-SD 4.48Å; M30-T32 VanDerWaalsContact C-N 3.26Å; M30-K34 HydrophobicContact CB-CB 4.26Å; M30-K34 WeakPolarHBondContact CB-O 3.31Å; M30-K34 HydrophobicContact CG-CB 4.23Å; M30-K34 HydrophobicContact CG-CG 4.32Å; M30-K34 VanDerWaalsContact CG-O 3.31Å; M30-K34 WeakPolarHBondContact CG-O 3.46Å; M30-K34 PolarHBondContact N-O 2.95Å; M30-I36 HydrophobicContact CG-CD1 4.28Å; M30-I36 HydrophobicContact SD-CD1 4.23Å; M30-L74 HydrophobicContact CE-CD1 3.7Å; M30-L74 HydrophobicContact SD-CD1 3.84Å; M30-L74 HydrophobicContact SD-CD2 4.02Å; M30-L74 HydrophobicContact SD-CG 4.26Å; M30-N78 CarbonylContact C-O 3.55Å; M30-N78 VanDerWaalsContact CA-O 3.24Å; M30-N78 WeakPolarHBondContact CA-O 3.35Å; M30-N78 HydrophobicContact CE-CB 3.46Å; M30-N78 VanDerWaalsContact CE-CB 3.46Å; M30-N78 HydrophobicContact SD-CB 4.4Å; M30-I79 HydrophobicContact SD-CG1 4.34Å; M30-T80 PolarHBondContact O-OG1 3.05Å; M30-T80 VanDerWaalsContact O-OG1 3.1Å
31	K	94.1	Very high	95.8	Very high	144 Å²	144	43.5 Å²	43.5	63%	0.626	23%	0.234	S	C	*	.	S	Bend	trans	-68.2	-26.8	171.6	-73.8	178.1	179.5	170.1	0	113.2	N77 N78 T80	K31-N77 VanDerWaalsContact CE-O 3.23Å; K31-N77 WeakPolarHBondContact CE-O 3.44Å; K31-N77 PolarHBondContact NZ-O 3.48Å; K31-N78 PolarHBondContact N-O 2.92Å; K31-T80 VanDerWaalsContact CA-OG1 3.26Å; K31-T80 WeakPolarHBondContact CA-OG1 3.36Å; K31-T80 WeakPolarHBondContact CG-OG1 3.35Å; K31-T80 PolarHBondContact N-OG1 2.86Å; K31-T80 VanDerWaalsContact N-OG1 3.13Å
32	T	89.3	Confident	95.9	Very high	89 Å²	89	43.9 Å²	43.9	55%	0.546	24%	0.239	S	C	.	.	S	Bend	trans	-91.1	178.2	176.3	56.8	0	0	0	0	110	M30 K34	M30-T32 VanDerWaalsContact C-N 3.26Å; T32-K34 PolarHBondContact O-N 2.74Å
33	D	88.8	Confident	95.9	Very high	115 Å²	115	43.2 Å²	43.2	62%	0.615	23%	0.234	S	C	*	.	S	Bend	trans	-73.8	49.1	174.3	-49.1	-56	0	0	0	112.4	E58 I59	D33-E58 WeakPolarHBondContact O-CA 3.45Å; D33-I59 HydrophobicContact CB-CB 3.83Å; D33-I59 HydrophobicContact CB-CD1 4.31Å; D33-I59 HydrophobicContact CB-CG1 4.23Å; D33-I59 PolarHBondContact O-N 2.82Å
34	K	93.6	Very high	95.9	Very high	48 Å²	48	43.5 Å²	43.5	21%	0.209	22%	0.222	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-129.5	132.4	-178.5	-175.5	174	-65.6	-160.7	0	110.3	M30 T32 I36 E56 F57 E58	M30-K34 HydrophobicContact CB-CB 4.26Å; M30-K34 WeakPolarHBondContact CB-O 3.31Å; M30-K34 HydrophobicContact CG-CB 4.23Å; M30-K34 HydrophobicContact CG-CG 4.32Å; M30-K34 VanDerWaalsContact CG-O 3.31Å; M30-K34 WeakPolarHBondContact CG-O 3.46Å; M30-K34 PolarHBondContact N-O 2.95Å; T32-K34 PolarHBondContact O-N 2.74Å; K34-I36 HydrophobicContact CG-CG1 4.36Å; K34-E56 HydrophobicContact CD-CG 3.9Å; K34-E56 WeakPolarHBondContact CD-OE1 3.49Å; K34-E56 WeakPolarHBondContact CE-OE1 3.31Å; K34-E56 HydrophobicContact CG-CG 3.97Å; K34-E56 IonicContact NZ-OE1 2.71Å; K34-E56 PolarHBondContact NZ-OE1 3.36Å; K34-F57 CarbonylContact C-O 3.4Å; K34-F57 VanDerWaalsContact CA-O 3.27Å; K34-F57 WeakPolarHBondContact CA-O 3.12Å; K34-E58 IonicContact NZ-OE1 2.61Å
35	E	95.8	Very high	95.6	Very high	43 Å²	43	47.9 Å²	47.9	20%	0.201	24%	0.241	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-129.4	142	178.9	-74	177.9	-114.3	0	0	108.9	H27 I28 V29 F57 P89	H27-E35 IonicContact CE1-OE2 3.86Å; H27-E35 PolarHBondContact CE1-OE2 2.8Å; H27-E35 IonicContact NE2-OE2 2.92Å; H27-E35 PolarHBondContact NE2-OE2 2.79Å; I28-E35 CarbonylContact O-C 3.59Å; I28-E35 WeakPolarHBondContact O-CA 3.36Å; V29-E35 HydrophobicContact CB-CG 4.42Å; V29-E35 HydrophobicContact CG1-CG 4.13Å; V29-E35 HydrophobicContact CG2-CG 4.19Å; E35-F57 HydrophobicContact CB-CB 4.26Å; E35-F57 PolarHBondContact N-O 2.93Å; E35-F57 PolarHBondContact O-N 3.29Å; E35-P89 HydrophobicContact CB-CG 4.46Å; E35-P89 WeakPolarHBondContact OE2-CD 3.42Å; E35-P89 WeakPolarHBondContact OE2-CG 3.39Å
36	I	96.8	Very high	95.5	Very high	3 Å²	3	49.1 Å²	49.1	2%	0.015	25%	0.25	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.4	125.5	-171.6	-61.7	173.7	0	0	0	108.5	H27 I28 M30 K34 L51 V54 E56 I72 L74	H27-I36 CarbonylContact C-O 3.52Å; H27-I36 WeakPolarHBondContact CA-O 3.33Å; I28-I36 HydrophobicContact CB-CB 4.4Å; I28-I36 PolarHBondContact N-O 2.77Å; I28-I36 PolarHBondContact O-N 2.9Å; M30-I36 HydrophobicContact CG-CD1 4.28Å; M30-I36 HydrophobicContact SD-CD1 4.23Å; K34-I36 HydrophobicContact CG-CG1 4.36Å; I36-L51 HydrophobicContact CG2-CD1 3.72Å; I36-V54 HydrophobicContact CG2-CG1 3.45Å; I36-V54 VanDerWaalsContact CG2-CG1 3.45Å; I36-E56 HydrophobicContact CG1-CG 4.29Å; I36-I72 HydrophobicContact CD1-CD1 4.29Å; I36-I72 HydrophobicContact CG2-CD1 4.12Å; I36-L74 HydrophobicContact CD1-CD1 3.44Å; I36-L74 VanDerWaalsContact CD1-CD1 3.44Å; I36-L74 HydrophobicContact CD1-CD2 3.99Å; I36-L74 HydrophobicContact CD1-CG 4.36Å
37	V	97.4	Very high	95.4	Very high	9 Å²	9	50.8 Å²	50.8	6%	0.055	26%	0.26	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.5	129.9	173.6	179.6	0	0	0	0	108.6	R25 I26 H27 V54 T55 F57 G88	R25-V37 HydrophobicContact CG-CG1 3.84Å; I26-V37 WeakPolarHBondContact O-CA 3.39Å; H27-V37 HydrophobicContact CB-CG2 4.01Å; V37-V54 CarbonylContact O-C 3.54Å; V37-V54 WeakPolarHBondContact O-CA 3.39Å; V37-T55 PolarHBondContact N-O 2.85Å; V37-T55 PolarHBondContact O-N 3.12Å; V37-F57 HydrophobicContact CB-CE2 4.26Å; V37-F57 HydrophobicContact CG2-CD2 4.39Å; V37-F57 HydrophobicContact CG2-CE2 3.74Å; V37-G88 VanDerWaalsContact CG2-CA 3.43Å
38	G	97.5	Very high	95.3	Very high	0 Å²	0	52.1 Å²	52.1	0%	0	27%	0.268	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-166.6	176.3	178.6	0	0	0	0	0	111.7	R25 I26 E52	R25-G38 CarbonylContact C-O 3.6Å; R25-G38 WeakPolarHBondContact CA-O 3.46Å; I26-G38 PolarHBondContact N-O 2.99Å; I26-G38 PolarHBondContact O-N 3.43Å; G38-E52 WeakPolarHBondContact CA-O 3.5Å
39	T	97.8	Very high	95.3	Very high	18 Å²	18	52.1 Å²	52.1	11%	0.11	27%	0.268	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.6	125.6	172.1	-57.9	0	0	0	0	109.1	S24 L41 L51 E52	S24-T39 WeakPolarHBondContact O-CA 3.4Å; T39-L41 PolarHBondContact O-N 2.99Å; T39-L51 VanDerWaalsContact O-CA 3.27Å; T39-L51 WeakPolarHBondContact O-CA 3.24Å; T39-E52 HydrophobicContact CG2-CG 4.22Å; T39-E52 PolarHBondContact N-O 2.76Å; T39-E52 PolarHBondContact O-N 3.44Å
40	L	98.1	Very high	95.5	Very high	0 Å²	0	53.3 Å²	53.3	0%	0	28%	0.275	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.9	115.9	179.3	178.8	63	0	0	0	110.8	V18 C21 I22 G23 S24 I26 G42 M49 L51	V18-L40 HydrophobicContact CG1-CD2 3.96Å; C21-L40 HydrophobicContact CB-CD2 4.11Å; I22-L40 CarbonylContact C-O 3.59Å; I22-L40 WeakPolarHBondContact CA-O 3.33Å; I22-L40 HydrophobicContact CG1-CD2 4.06Å; I22-L40 HydrophobicContact CG1-CG 4.28Å; G23-L40 PolarHBondContact N-O 2.94Å; S24-L40 PolarHBondContact O-N 3.36Å; I26-L40 HydrophobicContact CD1-CD2 4.48Å; I26-L40 HydrophobicContact CG2-CB 4.03Å; L40-G42 WeakPolarHBondContact CD1-O 3.49Å; L40-M49 HydrophobicContact CD1-CB 4.05Å; L40-M49 HydrophobicContact CD1-CG 4.23Å; L40-M49 HydrophobicContact CD1-SD 3.96Å; L40-L51 HydrophobicContact CB-CD2 4.13Å; L40-L51 HydrophobicContact CD1-CD2 3.76Å
41	L	98.1	Very high	95.6	Very high	65 Å²	65	52.4 Å²	52.4	34%	0.34	27%	0.271	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.9	-30.1	175.2	-68.6	-175.9	0	0	0	112.7	T39 V50 E52 Q71	T39-L41 PolarHBondContact O-N 2.99Å; L41-V50 HydrophobicContact CB-CB 4.18Å; L41-V50 HydrophobicContact CB-CG1 4.08Å; L41-V50 WeakPolarHBondContact CB-O 3.46Å; L41-V50 HydrophobicContact CD1-CG1 4Å; L41-V50 PolarHBondContact N-O 3.15Å; L41-E52 HydrophobicContact CD1-CB 3.93Å; L41-E52 HydrophobicContact CD1-CG 4.12Å; L41-E52 VanDerWaalsContact CD2-CD 3.46Å; L41-E52 HydrophobicContact CD2-CG 3.94Å; L41-E52 HydrophobicContact CG-CB 4.24Å; L41-E52 HydrophobicContact CG-CG 3.96Å; L41-Q71 VanDerWaalsContact CD1-NE2 3.32Å
42	G	97.1	Very high	95.8	Very high	16 Å²	16	48.9 Å²	48.9	17%	0.165	26%	0.256	C	S	.	.	E	Extended strand (participates in β ladder)	trans	169.5	170.8	178.7	0	0	0	0	0	111.9	L40 M49 V50	L40-G42 WeakPolarHBondContact CD1-O 3.49Å; G42-M49 WeakPolarHBondContact O-CA 3.47Å; G42-V50 PolarHBondContact O-N 3.07Å
43	F	97.5	Very high	96.2	Very high	56 Å²	56	49.4 Å²	49.4	25%	0.246	26%	0.256	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.8	165.1	177.4	69.7	-76.7	0	0	0	110.7	L15 V18 D19 I22 N48 M49	L15-F43 HydrophobicContact CD2-CE2 4.11Å; V18-F43 HydrophobicContact CB-CE1 4.2Å; V18-F43 HydrophobicContact CB-CZ 4.24Å; V18-F43 HydrophobicContact CG1-CD1 3.65Å; V18-F43 HydrophobicContact CG1-CD2 4.32Å; V18-F43 HydrophobicContact CG1-CE1 3.73Å; V18-F43 HydrophobicContact CG1-CE2 4.4Å; V18-F43 HydrophobicContact CG1-CG 3.98Å; V18-F43 HydrophobicContact CG1-CZ 4.11Å; D19-F43 HydrophobicContact CB-CE1 4.23Å; D19-F43 HydrophobicContact CB-CZ 4.38Å; I22-F43 HydrophobicContact CD1-CD1 4.38Å; I22-F43 HydrophobicContact CD1-CE1 4.18Å; F43-N48 CarbonylContact C-O 3.57Å; F43-N48 WeakPolarHBondContact CA-O 3.5Å; F43-N48 WeakPolarHBondContact CB-O 3.31Å; F43-M49 HydrophobicContact CB-CG 3.99Å
44	D	95.3	Very high	96.6	Very high	62 Å²	62	44 Å²	44	33%	0.332	23%	0.227	S	C	.	.			trans	-110.3	179.9	174.8	71	7.6	0	0	0	112.6	F46 V47 N48	D44-F46 PolarHBondContact O-N 3.1Å; D44-F46 VanDerWaalsContact O-N 3.1Å; D44-F46 VanDerWaalsContact OD1-C 3.3Å; D44-F46 WeakPolarHBondContact OD1-CA 3.16Å; D44-F46 WeakPolarHBondContact OD1-CB 3.24Å; D44-F46 PolarHBondContact OD1-N 3.13Å; D44-V47 WeakPolarHBondContact O-CA 3.47Å; D44-V47 PolarHBondContact O-N 3.24Å; D44-V47 PolarHBondContact OD1-N 3.27Å; D44-N48 PolarHBondContact N-O 2.83Å; D44-N48 VanDerWaalsContact N-O 3.12Å; D44-N48 WeakPolarHBondContact OD1-CB 3.23Å; D44-N48 PolarHBondContact OD1-N 3.39Å; D44-N48 PolarHBondContact OD1-ND2 3.11Å; D44-N48 PolarHBondContact OD2-ND2 2.81Å
45	D	92.4	Very high	96.7	Very high	151 Å²	151	43.2 Å²	43.2	81%	0.807	23%	0.226	S	C	*	.	T	Hydrogen-bonded Turn	trans	-61.3	-19.5	179.1	-66.6	-27.9	0	0	0	113.7	V47	D45-V47 VanDerWaalsContact C-N 3.34Å
46	F	93.3	Very high	96.7	Very high	158 Å²	158	42.4 Å²	42.4	69%	0.693	22%	0.222	S	C	*	.	T	Hydrogen-bonded Turn	trans	-94.1	4.7	175.8	-58.3	-73.9	0	0	0	112.6	D44 N48	D44-F46 PolarHBondContact O-N 3.1Å; D44-F46 VanDerWaalsContact O-N 3.1Å; D44-F46 VanDerWaalsContact OD1-C 3.3Å; D44-F46 WeakPolarHBondContact OD1-CA 3.16Å; D44-F46 WeakPolarHBondContact OD1-CB 3.24Å; D44-F46 PolarHBondContact OD1-N 3.13Å; F46-N48 PolarHBondContact O-N 3.24Å
47	V	95	Very high	96.6	Very high	35 Å²	35	43.4 Å²	43.4	21%	0.212	23%	0.227	C	C	.	.			trans	61.8	26.9	-178.4	-161.8	0	0	0	0	111.6	L15 D44 D45 M49 G76 I79 L82	L15-V47 HydrophobicContact CD2-CG2 4.25Å; D44-V47 WeakPolarHBondContact O-CA 3.47Å; D44-V47 PolarHBondContact O-N 3.24Å; D44-V47 PolarHBondContact OD1-N 3.27Å; D45-V47 VanDerWaalsContact C-N 3.34Å; V47-M49 HydrophobicContact CG1-CE 3.42Å; V47-M49 VanDerWaalsContact CG1-CE 3.42Å; V47-G76 WeakPolarHBondContact O-CA 3.41Å; V47-I79 HydrophobicContact CG1-CD1 4.34Å; V47-I79 WeakPolarHBondContact O-CD1 3.45Å; V47-L82 HydrophobicContact CG1-CD1 4.34Å
48	N	96.2	Very high	96.4	Very high	39 Å²	39	45.8 Å²	45.8	21%	0.209	24%	0.237	C	C	.	.			trans	-68.9	133.3	161.4	-57.9	-57.3	0	0	0	107.8	F43 D44 F46 L73 L74 N75 G76	F43-N48 CarbonylContact C-O 3.57Å; F43-N48 WeakPolarHBondContact CA-O 3.5Å; F43-N48 WeakPolarHBondContact CB-O 3.31Å; D44-N48 PolarHBondContact N-O 2.83Å; D44-N48 VanDerWaalsContact N-O 3.12Å; D44-N48 WeakPolarHBondContact OD1-CB 3.23Å; D44-N48 PolarHBondContact OD1-N 3.39Å; D44-N48 PolarHBondContact OD1-ND2 3.11Å; D44-N48 PolarHBondContact OD2-ND2 2.81Å; F46-N48 PolarHBondContact O-N 3.24Å; N48-L73 HydrophobicContact CB-CD1 4.42Å; N48-L74 CarbonylContact C-O 3.57Å; N48-L74 VanDerWaalsContact CA-O 3.23Å; N48-L74 WeakPolarHBondContact CA-O 3.32Å; N48-N75 WeakPolarHBondContact OD1-CA 3.42Å; N48-G76 PolarHBondContact OD1-N 3.12Å
49	M	97.4	Very high	96	Very high	0 Å²	0	50.7 Å²	50.7	0%	0	26%	0.262	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.4	136.5	-170.9	-60.7	-165.3	169.8	0	0	111.7	V18 I28 L40 G42 F43 V47 L51 L73 L74 I79 L82	V18-M49 HydrophobicContact CG1-CE 3.81Å; I28-M49 HydrophobicContact CD1-SD 3.49Å; I28-M49 WeakPolarHBondContact CD1-SD 3.27Å; L40-M49 HydrophobicContact CD1-CB 4.05Å; L40-M49 HydrophobicContact CD1-CG 4.23Å; L40-M49 HydrophobicContact CD1-SD 3.96Å; G42-M49 WeakPolarHBondContact O-CA 3.47Å; F43-M49 HydrophobicContact CB-CG 3.99Å; V47-M49 HydrophobicContact CG1-CE 3.42Å; V47-M49 VanDerWaalsContact CG1-CE 3.42Å; M49-L51 HydrophobicContact CB-CD2 4.4Å; M49-L73 CarbonylContact O-C 3.51Å; M49-L73 WeakPolarHBondContact O-CA 3.45Å; M49-L74 HydrophobicContact CB-CB 4.38Å; M49-L74 PolarHBondContact N-O 3.29Å; M49-L74 PolarHBondContact O-N 2.94Å; M49-I79 HydrophobicContact CE-CD1 4.38Å; M49-I79 HydrophobicContact CG-CD1 4.16Å; M49-I79 HydrophobicContact SD-CD1 4.18Å; M49-L82 HydrophobicContact CE-CD1 3.43Å; M49-L82 VanDerWaalsContact CE-CD1 3.43Å; M49-L82 HydrophobicContact CE-CD2 3.44Å; M49-L82 VanDerWaalsContact CE-CD2 3.44Å; M49-L82 HydrophobicContact CE-CG 4.08Å; M49-L82 HydrophobicContact SD-CD2 3.81Å
50	V	98	Very high	95.5	Very high	50 Å²	50	51.7 Å²	51.7	30%	0.303	27%	0.269	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.7	123.7	167.5	-174.2	0	0	0	0	107.6	L41 G42 Q71 I72 L73	L41-V50 HydrophobicContact CB-CB 4.18Å; L41-V50 HydrophobicContact CB-CG1 4.08Å; L41-V50 WeakPolarHBondContact CB-O 3.46Å; L41-V50 HydrophobicContact CD1-CG1 4Å; L41-V50 PolarHBondContact N-O 3.15Å; G42-V50 PolarHBondContact O-N 3.07Å; V50-Q71 HydrophobicContact CG1-CG 4.26Å; V50-I72 WeakPolarHBondContact CA-O 3.34Å; V50-L73 HydrophobicContact CG2-CD1 3.89Å
51	L	98	Very high	94.9	Very high	0 Å²	0	58.5 Å²	58.5	0%	0	31%	0.312	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.9	147.6	178.9	-56.1	178.6	0	0	0	110.7	I26 I28 I36 T39 L40 M49 V54 Q71 I72	I26-L51 HydrophobicContact CG2-CD2 3.87Å; I28-L51 HydrophobicContact CD1-CD1 3.79Å; I28-L51 HydrophobicContact CD1-CD2 4.31Å; I36-L51 HydrophobicContact CG2-CD1 3.72Å; T39-L51 VanDerWaalsContact O-CA 3.27Å; T39-L51 WeakPolarHBondContact O-CA 3.24Å; L40-L51 HydrophobicContact CB-CD2 4.13Å; L40-L51 HydrophobicContact CD1-CD2 3.76Å; M49-L51 HydrophobicContact CB-CD2 4.4Å; L51-V54 HydrophobicContact CB-CG2 3.54Å; L51-Q71 CarbonylContact O-C 3.56Å; L51-Q71 VanDerWaalsContact O-CA 3.25Å; L51-Q71 WeakPolarHBondContact O-CA 3.36Å; L51-Q71 WeakPolarHBondContact O-CG 3.23Å; L51-I72 HydrophobicContact CB-CG1 4.12Å; L51-I72 HydrophobicContact CD1-CD1 4.34Å; L51-I72 PolarHBondContact N-O 2.71Å; L51-I72 PolarHBondContact O-N 3.1Å
52	E	98.2	Very high	94.3	Very high	70 Å²	70	64.7 Å²	64.7	33%	0.327	34%	0.34	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.8	166.1	169.6	68.5	-179.1	-174.1	0	0	112.2	G38 T39 L41 V54 D70	G38-E52 WeakPolarHBondContact CA-O 3.5Å; T39-E52 HydrophobicContact CG2-CG 4.22Å; T39-E52 PolarHBondContact N-O 2.76Å; T39-E52 PolarHBondContact O-N 3.44Å; L41-E52 HydrophobicContact CD1-CB 3.93Å; L41-E52 HydrophobicContact CD1-CG 4.12Å; L41-E52 VanDerWaalsContact CD2-CD 3.46Å; L41-E52 HydrophobicContact CD2-CG 3.94Å; L41-E52 HydrophobicContact CG-CB 4.24Å; L41-E52 HydrophobicContact CG-CG 3.96Å; E52-V54 VanDerWaalsContact C-N 3.29Å; E52-V54 PolarHBondContact O-N 2.82Å; E52-D70 CarbonylContact C-O 3.57Å; E52-D70 VanDerWaalsContact CA-O 3.23Å; E52-D70 WeakPolarHBondContact CA-O 3.48Å
53	D	96.9	Very high	93.8	Very high	100 Å²	100	65.6 Å²	65.6	54%	0.535	35%	0.349	S	S	.	.	E	Extended strand (participates in β ladder)	trans	50.1	49.4	-178.5	-70.1	-37.7	0	0	0	112.2	D70	D53-D70 PolarHBondContact N-O 3.46Å
54	V	97.3	Very high	93.3	Very high	1 Å²	1	67.1 Å²	67.1	1%	0.006	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.6	136.1	-165.6	-177	0	0	0	0	111.5	I36 V37 L51 E52 K68 L69 I72	I36-V54 HydrophobicContact CG2-CG1 3.45Å; I36-V54 VanDerWaalsContact CG2-CG1 3.45Å; V37-V54 CarbonylContact O-C 3.54Å; V37-V54 WeakPolarHBondContact O-CA 3.39Å; L51-V54 HydrophobicContact CB-CG2 3.54Å; E52-V54 VanDerWaalsContact C-N 3.29Å; E52-V54 PolarHBondContact O-N 2.82Å; V54-K68 CarbonylContact O-C 3.56Å; V54-K68 VanDerWaalsContact O-CA 3.29Å; V54-K68 WeakPolarHBondContact O-CA 3.49Å; V54-L69 HydrophobicContact CB-CB 4.33Å; V54-L69 PolarHBondContact N-O 3.22Å; V54-L69 PolarHBondContact O-N 3.13Å; V54-I72 HydrophobicContact CG1-CD1 3.99Å; V54-I72 HydrophobicContact CG2-CD1 4.43Å; V54-I72 HydrophobicContact CG2-CG1 4.13Å
55	T	96.7	Very high	93.2	Very high	31 Å²	31	71.3 Å²	71.3	19%	0.19	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.3	116.4	166.1	-55.1	0	0	0	0	108.9	V37 F57 I66 T67	V37-T55 PolarHBondContact N-O 2.85Å; V37-T55 PolarHBondContact O-N 3.12Å; T55-F57 HydrophobicContact CG2-CD1 4.45Å; T55-F57 HydrophobicContact CG2-CD2 4.5Å; T55-F57 HydrophobicContact CG2-CE1 3.8Å; T55-F57 HydrophobicContact CG2-CE2 3.81Å; T55-F57 HydrophobicContact CG2-CZ 3.44Å; T55-F57 VanDerWaalsContact CG2-CZ 3.44Å; T55-I66 HydrophobicContact CG2-CG2 3.58Å; T55-T67 WeakPolarHBondContact CA-O 3.18Å
56	E	95.6	Very high	93.3	Very high	27 Å²	27	68.6 Å²	68.6	13%	0.126	35%	0.349	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.2	131.8	175.6	-175.9	-176.7	141.1	0	0	109.8	K34 I36 I66 T67	K34-E56 HydrophobicContact CD-CG 3.9Å; K34-E56 WeakPolarHBondContact CD-OE1 3.49Å; K34-E56 WeakPolarHBondContact CE-OE1 3.31Å; K34-E56 HydrophobicContact CG-CG 3.97Å; K34-E56 IonicContact NZ-OE1 2.71Å; K34-E56 PolarHBondContact NZ-OE1 3.36Å; I36-E56 HydrophobicContact CG1-CG 4.29Å; E56-I66 CarbonylContact O-C 3.53Å; E56-I66 WeakPolarHBondContact O-CA 3.45Å; E56-T67 PolarHBondContact N-O 3.31Å; E56-T67 PolarHBondContact O-N 2.91Å
57	F	94.9	Very high	93.4	Very high	23 Å²	23	63 Å²	63	10%	0.101	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.7	122.6	175.1	-55.9	-78.6	0	0	0	108.6	K34 E35 V37 T55 R64 R65 I66	K34-F57 CarbonylContact C-O 3.4Å; K34-F57 VanDerWaalsContact CA-O 3.27Å; K34-F57 WeakPolarHBondContact CA-O 3.12Å; E35-F57 HydrophobicContact CB-CB 4.26Å; E35-F57 PolarHBondContact N-O 2.93Å; E35-F57 PolarHBondContact O-N 3.29Å; V37-F57 HydrophobicContact CB-CE2 4.26Å; V37-F57 HydrophobicContact CG2-CD2 4.39Å; V37-F57 HydrophobicContact CG2-CE2 3.74Å; T55-F57 HydrophobicContact CG2-CD1 4.45Å; T55-F57 HydrophobicContact CG2-CD2 4.5Å; T55-F57 HydrophobicContact CG2-CE1 3.8Å; T55-F57 HydrophobicContact CG2-CE2 3.81Å; T55-F57 HydrophobicContact CG2-CZ 3.44Å; T55-F57 VanDerWaalsContact CG2-CZ 3.44Å; F57-R64 VanDerWaalsContact CD1-NE 3.27Å; F57-R65 WeakPolarHBondContact CA-O 3.46Å; F57-I66 HydrophobicContact CD1-CD1 4.15Å; F57-I66 HydrophobicContact CD1-CG1 3.9Å; F57-I66 HydrophobicContact CD1-CG2 4.17Å; F57-I66 HydrophobicContact CE1-CD1 3.99Å; F57-I66 HydrophobicContact CE1-CG1 4.18Å; F57-I66 HydrophobicContact CE1-CG2 4.01Å
58	E	93.6	Very high	93.4	Very high	60 Å²	60	69.5 Å²	69.5	28%	0.28	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.8	129.3	177.9	-176.6	174.8	-137.6	0	0	109	D33 K34 T60 R64 R65	D33-E58 WeakPolarHBondContact O-CA 3.45Å; K34-E58 IonicContact NZ-OE1 2.61Å; E58-T60 HydrophobicContact CG-CG2 4.14Å; E58-R64 WeakPolarHBondContact O-CA 3.26Å; E58-R65 HydrophobicContact CB-CB 4.39Å; E58-R65 PolarHBondContact N-O 3.27Å; E58-R65 PolarHBondContact O-N 3.42Å
59	I	88.4	Confident	93.5	Very high	103 Å²	103	70.7 Å²	70.7	53%	0.528	36%	0.359	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.2	117.2	173.4	-51.2	178.4	0	0	0	107.3	D33	D33-I59 HydrophobicContact CB-CB 3.83Å; D33-I59 HydrophobicContact CB-CD1 4.31Å; D33-I59 HydrophobicContact CB-CG1 4.23Å; D33-I59 PolarHBondContact O-N 2.82Å
60	T	87.5	Confident	93.5	Very high	39 Å²	39	77.6 Å²	77.6	24%	0.239	40%	0.396	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.1	161	175.3	73.8	0	0	0	0	109.6	E58 E62 G63 R65	E58-T60 HydrophobicContact CG-CG2 4.14Å; T60-E62 PolarHBondContact O-N 2.89Å; T60-E62 VanDerWaalsContact O-N 3.07Å; T60-E62 PolarHBondContact OG1-N 2.96Å; T60-G63 WeakPolarHBondContact CA-O 3.43Å; T60-G63 WeakPolarHBondContact CB-O 3.32Å; T60-G63 PolarHBondContact N-O 3.15Å; T60-G63 PolarHBondContact O-N 2.93Å; T60-G63 VanDerWaalsContact O-O 3.12Å; T60-G63 PolarHBondContact OG1-N 3.19Å; T60-G63 PolarHBondContact OG1-O 2.99Å; T60-R65 HydrophobicContact CG2-CB 4.24Å
61	P	86.5	Confident	93.4	Very high	142 Å²	142	81.2 Å²	81.2	92%	0.922	41%	0.41	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.1	-22.6	173.5	-24.6	34.9	0	0	0	113.8
62	E	85.3	Confident	93.4	Very high	195 Å²	195	82.7 Å²	82.7	91%	0.911	42%	0.418	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.5	-5.4	-178.7	-66	156.5	-162.3	0	0	112.6	T60	T60-E62 PolarHBondContact O-N 2.89Å; T60-E62 VanDerWaalsContact O-N 3.07Å; T60-E62 PolarHBondContact OG1-N 2.96Å
63	G	85.6	Confident	93.3	Very high	36 Å²	36	85.7 Å²	85.7	37%	0.371	44%	0.435	S	S	.	.	E	Extended strand (participates in β ladder)	trans	128.3	-166.2	-178.6	0	0	0	0	0	113.1	T60	T60-G63 WeakPolarHBondContact CA-O 3.43Å; T60-G63 WeakPolarHBondContact CB-O 3.32Å; T60-G63 PolarHBondContact N-O 3.15Å; T60-G63 PolarHBondContact O-N 2.93Å; T60-G63 VanDerWaalsContact O-O 3.12Å; T60-G63 PolarHBondContact OG1-N 3.19Å; T60-G63 PolarHBondContact OG1-O 2.99Å
64	R	87.8	Confident	93.3	Very high	87 Å²	87	81.6 Å²	81.6	33%	0.328	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.9	121.7	179.7	-173.3	170.9	173.9	-175.8	-7.9	110.2	F57 E58 I66 P89	F57-R64 VanDerWaalsContact CD1-NE 3.27Å; E58-R64 WeakPolarHBondContact O-CA 3.26Å; R64-I66 HydrophobicContact CG-CG1 4.4Å; R64-P89 PolarHBondContact NH1-O 2.72Å; R64-P89 VanDerWaalsContact NH2-CD 3.35Å; R64-P89 PolarHBondContact NH2-O 3.1Å
65	R	92.1	Very high	93.2	Very high	150 Å²	150	85 Å²	85	57%	0.566	43%	0.432	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94	130.9	171.8	-176.2	178.4	-179.6	174.1	2	109.3	F57 E58 T60	F57-R65 WeakPolarHBondContact CA-O 3.46Å; E58-R65 HydrophobicContact CB-CB 4.39Å; E58-R65 PolarHBondContact N-O 3.27Å; E58-R65 PolarHBondContact O-N 3.42Å; T60-R65 HydrophobicContact CG2-CB 4.24Å
66	I	94.2	Very high	93	Very high	95 Å²	95	84.1 Å²	84.1	49%	0.487	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	124.5	177.3	-50.5	-176.5	0	0	0	108.5	T55 E56 F57 R64	T55-I66 HydrophobicContact CG2-CG2 3.58Å; E56-I66 CarbonylContact O-C 3.53Å; E56-I66 WeakPolarHBondContact O-CA 3.45Å; F57-I66 HydrophobicContact CD1-CD1 4.15Å; F57-I66 HydrophobicContact CD1-CG1 3.9Å; F57-I66 HydrophobicContact CD1-CG2 4.17Å; F57-I66 HydrophobicContact CE1-CD1 3.99Å; F57-I66 HydrophobicContact CE1-CG1 4.18Å; F57-I66 HydrophobicContact CE1-CG2 4.01Å; R64-I66 HydrophobicContact CG-CG1 4.4Å
67	T	95.4	Very high	93	Very high	40 Å²	40	88.3 Å²	88.3	25%	0.245	45%	0.451	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125	133.3	178.3	-51.9	0	0	0	0	109.4	T55 E56 L69	T55-T67 WeakPolarHBondContact CA-O 3.18Å; E56-T67 PolarHBondContact N-O 3.31Å; E56-T67 PolarHBondContact O-N 2.91Å; T67-L69 HydrophobicContact CG2-CD2 4.13Å; T67-L69 HydrophobicContact CG2-CG 4.22Å
68	K	96.5	Very high	92.9	Very high	171 Å²	171	90.7 Å²	90.7	74%	0.743	47%	0.465	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.4	136.3	173	-67.9	-170.6	175.7	-172.4	0	110.2	V54	V54-K68 CarbonylContact O-C 3.56Å; V54-K68 VanDerWaalsContact O-CA 3.29Å; V54-K68 WeakPolarHBondContact O-CA 3.49Å
69	L	97.1	Very high	93	Very high	64 Å²	64	89 Å²	89	34%	0.335	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.3	139.1	-177.5	-60.3	170	0	0	0	108.8	V54 T67 I72	V54-L69 HydrophobicContact CB-CB 4.33Å; V54-L69 PolarHBondContact N-O 3.22Å; V54-L69 PolarHBondContact O-N 3.13Å; T67-L69 HydrophobicContact CG2-CD2 4.13Å; T67-L69 HydrophobicContact CG2-CG 4.22Å; L69-I72 HydrophobicContact CB-CG2 3.92Å; L69-I72 HydrophobicContact CD1-CG2 3.61Å; L69-I72 HydrophobicContact CG-CG2 4.39Å
70	D	97	Very high	93.4	Very high	145 Å²	145	87.9 Å²	87.9	78%	0.775	46%	0.456	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-70	-46.2	-176.8	-61.8	-28.2	0	0	0	111.6	E52 D53	E52-D70 CarbonylContact C-O 3.57Å; E52-D70 VanDerWaalsContact CA-O 3.23Å; E52-D70 WeakPolarHBondContact CA-O 3.48Å; D53-D70 PolarHBondContact N-O 3.46Å
71	Q	96.6	Very high	93.8	Very high	126 Å²	126	91 Å²	91	59%	0.589	47%	0.469	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-151.1	142	178.8	-171	176.9	69.5	0	0	110.8	L41 V50 L51	L41-Q71 VanDerWaalsContact CD1-NE2 3.32Å; V50-Q71 HydrophobicContact CG1-CG 4.26Å; L51-Q71 CarbonylContact O-C 3.56Å; L51-Q71 VanDerWaalsContact O-CA 3.25Å; L51-Q71 WeakPolarHBondContact O-CA 3.36Å; L51-Q71 WeakPolarHBondContact O-CG 3.23Å
72	I	97.6	Very high	94.2	Very high	32 Å²	32	86.7 Å²	86.7	16%	0.164	44%	0.438	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.3	155.7	174.6	71.7	174.5	0	0	0	111.7	I36 V50 L51 V54 L69 L74	I36-I72 HydrophobicContact CD1-CD1 4.29Å; I36-I72 HydrophobicContact CG2-CD1 4.12Å; V50-I72 WeakPolarHBondContact CA-O 3.34Å; L51-I72 HydrophobicContact CB-CG1 4.12Å; L51-I72 HydrophobicContact CD1-CD1 4.34Å; L51-I72 PolarHBondContact N-O 2.71Å; L51-I72 PolarHBondContact O-N 3.1Å; V54-I72 HydrophobicContact CG1-CD1 3.99Å; V54-I72 HydrophobicContact CG2-CD1 4.43Å; V54-I72 HydrophobicContact CG2-CG1 4.13Å; L69-I72 HydrophobicContact CB-CG2 3.92Å; L69-I72 HydrophobicContact CD1-CG2 3.61Å; L69-I72 HydrophobicContact CG-CG2 4.39Å; I72-L74 HydrophobicContact CD1-CB 4.48Å
73	L	97.3	Very high	94.7	Very high	133 Å²	133	80.7 Å²	80.7	70%	0.696	41%	0.412	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104	117	159.6	177.7	66.2	0	0	0	108.4	N48 M49 V50	N48-L73 HydrophobicContact CB-CD1 4.42Å; M49-L73 CarbonylContact O-C 3.51Å; M49-L73 WeakPolarHBondContact O-CA 3.45Å; V50-L73 HydrophobicContact CG2-CD1 3.89Å
74	L	96.2	Very high	95.2	Very high	13 Å²	13	82 Å²	82	7%	0.068	41%	0.413	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.3	133.4	-179.6	-170.3	63.3	0	0	0	110.9	I28 M30 I36 N48 M49 I72 I79	I28-L74 HydrophobicContact CB-CD2 4.39Å; I28-L74 HydrophobicContact CD1-CD2 3.7Å; I28-L74 HydrophobicContact CG2-CD2 3.85Å; M30-L74 HydrophobicContact CE-CD1 3.7Å; M30-L74 HydrophobicContact SD-CD1 3.84Å; M30-L74 HydrophobicContact SD-CD2 4.02Å; M30-L74 HydrophobicContact SD-CG 4.26Å; I36-L74 HydrophobicContact CD1-CD1 3.44Å; I36-L74 VanDerWaalsContact CD1-CD1 3.44Å; I36-L74 HydrophobicContact CD1-CD2 3.99Å; I36-L74 HydrophobicContact CD1-CG 4.36Å; N48-L74 CarbonylContact C-O 3.57Å; N48-L74 VanDerWaalsContact CA-O 3.23Å; N48-L74 WeakPolarHBondContact CA-O 3.32Å; M49-L74 HydrophobicContact CB-CB 4.38Å; M49-L74 PolarHBondContact N-O 3.29Å; M49-L74 PolarHBondContact O-N 2.94Å; I72-L74 HydrophobicContact CD1-CB 4.48Å; L74-I79 HydrophobicContact CD2-CD1 3.96Å; L74-I79 HydrophobicContact CD2-CG1 4.07Å; L74-I79 HydrophobicContact CG-CD1 4.42Å; L74-I79 HydrophobicContact CG-CG1 4.48Å
75	N	94.9	Very high	95.4	Very high	74 Å²	74	80.5 Å²	80.5	40%	0.396	43%	0.425	S	S	.	.	P	Polyproline II helix	trans	-79.1	119.8	178.3	-172.8	-42.2	0	0	0	111.2	N48 N77 N78	N48-N75 WeakPolarHBondContact OD1-CA 3.42Å; N75-N77 PolarHBondContact O-N 2.99Å; N75-N77 VanDerWaalsContact OD1-CB 3.24Å; N75-N77 WeakPolarHBondContact OD1-CB 3.4Å; N75-N77 PolarHBondContact OD1-N 3.3Å; N75-N77 PolarHBondContact OD1-ND2 3.28Å; N75-N78 PolarHBondContact O-N 3Å
76	G	93.6	Very high	95.2	Very high	12 Å²	12	73.9 Å²	73.9	12%	0.124	40%	0.404	C	S	.	.	G	3₁₀ helix	trans	-62.3	-25.8	-177.3	0	0	0	0	0	114.5	V47 N48 N78 I79	V47-G76 WeakPolarHBondContact O-CA 3.41Å; N48-G76 PolarHBondContact OD1-N 3.12Å; G76-N78 PolarHBondContact O-N 2.81Å; G76-N78 VanDerWaalsContact O-N 3.15Å; G76-I79 PolarHBondContact O-N 2.91Å
77	N	95.1	Very high	94.9	Very high	114 Å²	114	77.8 Å²	77.8	61%	0.61	42%	0.42	S	S	*	.	G	3₁₀ helix	trans	-63.8	-23.2	179.6	-70	-40.7	0	0	0	113.4	K31 N75	K31-N77 VanDerWaalsContact CE-O 3.23Å; K31-N77 WeakPolarHBondContact CE-O 3.44Å; K31-N77 PolarHBondContact NZ-O 3.48Å; N75-N77 PolarHBondContact O-N 2.99Å; N75-N77 VanDerWaalsContact OD1-CB 3.24Å; N75-N77 WeakPolarHBondContact OD1-CB 3.4Å; N75-N77 PolarHBondContact OD1-N 3.3Å; N75-N77 PolarHBondContact OD1-ND2 3.28Å
78	N	93.9	Very high	94.5	Very high	73 Å²	73	76.7 Å²	76.7	39%	0.39	42%	0.417	S	S	.	.	G	3₁₀ helix	trans	-100.6	-0.8	-177.8	-67.9	-34.8	0	0	0	113.3	M30 K31 N75 G76	M30-N78 CarbonylContact C-O 3.55Å; M30-N78 VanDerWaalsContact CA-O 3.24Å; M30-N78 WeakPolarHBondContact CA-O 3.35Å; M30-N78 HydrophobicContact CE-CB 3.46Å; M30-N78 VanDerWaalsContact CE-CB 3.46Å; M30-N78 HydrophobicContact SD-CB 4.4Å; K31-N78 PolarHBondContact N-O 2.92Å; N75-N78 PolarHBondContact O-N 3Å; G76-N78 PolarHBondContact O-N 2.81Å; G76-N78 VanDerWaalsContact O-N 3.15Å
79	I	95.5	Very high	93.9	Very high	26 Å²	26	70.3 Å²	70.3	13%	0.133	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77	132.4	177.9	-62.7	179.7	0	0	0	109.4	I28 M30 V47 M49 L74 G76 L82	I28-I79 HydrophobicContact CG2-CB 4.46Å; I28-I79 HydrophobicContact CG2-CD1 4.24Å; I28-I79 HydrophobicContact CG2-CG1 3.97Å; I28-I79 HydrophobicContact CG2-CG2 3.93Å; M30-I79 HydrophobicContact SD-CG1 4.34Å; V47-I79 HydrophobicContact CG1-CD1 4.34Å; V47-I79 WeakPolarHBondContact O-CD1 3.45Å; M49-I79 HydrophobicContact CE-CD1 4.38Å; M49-I79 HydrophobicContact CG-CD1 4.16Å; M49-I79 HydrophobicContact SD-CD1 4.18Å; L74-I79 HydrophobicContact CD2-CD1 3.96Å; L74-I79 HydrophobicContact CD2-CG1 4.07Å; L74-I79 HydrophobicContact CG-CD1 4.42Å; L74-I79 HydrophobicContact CG-CG1 4.48Å; G76-I79 PolarHBondContact O-N 2.91Å; I79-L82 HydrophobicContact CG2-CD2 3.86Å; I79-L82 HydrophobicContact CG2-CG 4.03Å
80	T	95.9	Very high	92.8	Very high	78 Å²	78	76.4 Å²	76.4	48%	0.479	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.9	-46	175.6	-54.5	0	0	0	0	111.3	V29 M30 K31	V29-T80 WeakPolarHBondContact O-CA 3.31Å; V29-T80 WeakPolarHBondContact O-CB 3.48Å; V29-T80 PolarHBondContact O-N 3.29Å; M30-T80 PolarHBondContact O-OG1 3.05Å; M30-T80 VanDerWaalsContact O-OG1 3.1Å; K31-T80 VanDerWaalsContact CA-OG1 3.26Å; K31-T80 WeakPolarHBondContact CA-OG1 3.36Å; K31-T80 WeakPolarHBondContact CG-OG1 3.35Å; K31-T80 PolarHBondContact N-OG1 2.86Å; K31-T80 VanDerWaalsContact N-OG1 3.13Å
81	M	95.3	Very high	90.9	Very high	104 Å²	104	78.9 Å²	78.9	51%	0.512	44%	0.44	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.9	151.5	-179.8	-66.9	179.9	-70.6	0	0	111.9	I28 V29	I28-M81 WeakPolarHBondContact CA-O 3.45Å; V29-M81 HydrophobicContact CB-CB 4.14Å; V29-M81 HydrophobicContact CB-CE 4.07Å; V29-M81 HydrophobicContact CG1-CE 4.02Å; V29-M81 HydrophobicContact CG2-CB 4.35Å; V29-M81 HydrophobicContact CG2-CE 4.12Å; V29-M81 PolarHBondContact N-O 3Å; V29-M81 PolarHBondContact O-N 2.86Å; V29-M81 VanDerWaalsContact O-N 3.15Å
82	L	95.8	Very high	90.7	Very high	53 Å²	53	76.6 Å²	76.6	28%	0.277	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.7	122.8	176.7	-64.1	169.9	0	0	0	108.3	V18 I26 I28 V47 M49 I79	V18-L82 HydrophobicContact CG2-CD1 3.7Å; I26-L82 HydrophobicContact CD1-CB 4.21Å; I26-L82 HydrophobicContact CD1-CD2 4.03Å; I28-L82 HydrophobicContact CB-CD2 4.3Å; I28-L82 HydrophobicContact CD1-CD2 3.89Å; I28-L82 HydrophobicContact CG1-CD2 3.73Å; I28-L82 HydrophobicContact CG2-CD2 3.96Å; V47-L82 HydrophobicContact CG1-CD1 4.34Å; M49-L82 HydrophobicContact CE-CD1 3.43Å; M49-L82 VanDerWaalsContact CE-CD1 3.43Å; M49-L82 HydrophobicContact CE-CD2 3.44Å; M49-L82 VanDerWaalsContact CE-CD2 3.44Å; M49-L82 HydrophobicContact CE-CG 4.08Å; M49-L82 HydrophobicContact SD-CD2 3.81Å; I79-L82 HydrophobicContact CG2-CD2 3.86Å; I79-L82 HydrophobicContact CG2-CG 4.03Å
83	I	96.2	Very high	90.3	Very high	69 Å²	69	78.9 Å²	78.9	35%	0.354	45%	0.446	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122	98.8	-175.5	-57.4	165.2	0	0	0	108	H27 V29 G85 G86	H27-I83 HydrophobicContact CB-CB 4.09Å; H27-I83 PolarHBondContact N-O 2.75Å; H27-I83 PolarHBondContact O-N 2.94Å; V29-I83 HydrophobicContact CG2-CD1 4.23Å; I83-G85 PolarHBondContact O-N 3.29Å; I83-G86 PolarHBondContact O-N 3.35Å
84	P	95	Very high	89.9	Confident	63 Å²	63	75.9 Å²	75.9	41%	0.409	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-58.9	132.2	174.8	-25.1	36.4	0	0	0	111.6	L17 C21 G86	L17-P84 HydrophobicContact CD1-CG 4.49Å; L17-P84 HydrophobicContact CG-CG 4.49Å; C21-P84 WeakPolarHBondContact SG-CB 3.48Å; C21-P84 WeakPolarHBondContact SG-CG 3.49Å; P84-G86 PolarHBondContact O-N 3.03Å
85	G	91.6	Very high	89.5	Confident	55 Å²	55	79.6 Å²	79.6	57%	0.567	45%	0.454	S	S	*	.	T	Hydrogen-bonded Turn	trans	71.4	5.1	179	0	0	0	0	0	115.4	R25 I83	R25-G85 VanDerWaalsContact O-CA 3.31Å; R25-G85 WeakPolarHBondContact O-CA 3.49Å; R25-G85 PolarHBondContact O-N 2.95Å; I83-G85 PolarHBondContact O-N 3.29Å
86	G	89.4	Confident	89.2	Confident	12 Å²	12	79.9 Å²	79.9	12%	0.124	46%	0.457	C	S	.	.			trans	-67.1	141.1	179.3	0	0	0	0	0	112.6	I83 P84	I83-G86 PolarHBondContact O-N 3.35Å; P84-G86 PolarHBondContact O-N 3.03Å
87	E	87.6	Confident	88.9	Confident	176 Å²	176	84.5 Å²	84.5	82%	0.822	48%	0.48	S	S	*	.			trans	-95.2	0.6	179.9	-58.9	-167.8	153	0	0	113.2
88	G	86.4	Confident	88.5	Confident	18 Å²	18	82.4 Å²	82.4	19%	0.186	47%	0.47	C	S	.	.			trans	96	-177.5	-173.7	0	0	0	0	0	112.3	V37 E90	V37-G88 VanDerWaalsContact CG2-CA 3.43Å; G88-E90 PolarHBondContact O-N 3.38Å
89	P	84.9	Confident	88.1	Confident	37 Å²	37	83.1 Å²	83.1	24%	0.24	48%	0.477	C	S	.	.	S	Bend	trans	-68.5	128.1	179.2	8.2	-6.5	0	0	0	110.8	E35 R64	E35-P89 HydrophobicContact CB-CG 4.46Å; E35-P89 WeakPolarHBondContact OE2-CD 3.42Å; E35-P89 WeakPolarHBondContact OE2-CG 3.39Å; R64-P89 PolarHBondContact NH1-O 2.72Å; R64-P89 VanDerWaalsContact NH2-CD 3.35Å; R64-P89 PolarHBondContact NH2-O 3.1Å
90	E	72.6	Confident	87.4	Confident	191 Å²	191	87.8 Å²	87.8	89%	0.893	51%	0.505	S	S	*	.			trans	-54	137.3	169.3	-66.4	-172.5	162.6	0	0	109.3	G88	G88-E90 PolarHBondContact O-N 3.38Å
91	V	58.7	Low	86.7	Confident	198 Å²	198	88.7 Å²	88.7	100%	1.2	51%	0.508	S	S	*	.			trans	-71.7	0	-178.3	-113.7	0	0	0	0	111.8

Retrieved 91 of 91 residues in 93.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).