A0A087X7B8_POEFO Loading...

Beta-synuclein

AlphaFold DB (A0A3B3VSL1), UniProt , Accession A0A087X7B8, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 117 aa.

						>A0A087X7B8_POEFO|A0A087X7B8
MDVFMKGLSKAKEGMAVAAEKTKEGVAVAAEKTKEGVMFVGTKAKDSVGTVAEKTTGAMGNIVAATGLVKKDEFPTDMNPEEYGQEAMEGQGEAMLEPEGEAYDESQQESQDYEPEA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.9	Low	69.3	Low	207 Å²	207	124.2 Å²	124.2	100%	1.02	66%	0.662	S	S	*	*				0	-33.5	0	-138	164.1	-177.9	0	111.8	V3 F4	M1-V3 PolarHBondContact O-N 3.4Å; M1-F4 PolarHBondContact O-N 3.36Å
2	D	71.9	Confident	68.8	Low	134 Å²	134	127.6 Å²	127.6	72%	0.717	67%	0.667	S	S	*	*	H	α-helix	trans	-58.9	-41.7	-179	-76.8	-73.4	0	0	117.5	F4 M5 K6	D2-F4 PolarHBondContact O-N 3.2Å; D2-M5 PolarHBondContact O-N 3.08Å; D2-K6 WeakPolarHBondContact O-CB 3.35Å; D2-K6 PolarHBondContact O-N 3.2Å
3	V	68.3	Low	68.4	Low	127 Å²	127	128.4 Å²	128.4	77%	0.77	67%	0.665	S	S	*	*	H	α-helix	trans	-64.7	-28.4	-177.4	-72.4	0	0	0	112.8	M1 G7	M1-V3 PolarHBondContact O-N 3.4Å; V3-G7 PolarHBondContact O-N 3.45Å
4	F	65.9	Low	67.8	Low	168 Å²	168	122.1 Å²	122.1	74%	0.737	65%	0.648	S	S	*	*	H	α-helix	trans	-76.6	-43.5	178.5	-163.8	-93.5	0	0	111.5	M1 D2 K6 G7 L8	M1-F4 PolarHBondContact O-N 3.36Å; D2-F4 PolarHBondContact O-N 3.2Å; F4-K6 VanDerWaalsContact C-N 3.32Å; F4-K6 PolarHBondContact O-N 3.39Å; F4-G7 PolarHBondContact O-N 3.01Å; F4-L8 WeakPolarHBondContact O-CB 3.26Å; F4-L8 PolarHBondContact O-N 2.95Å
5	M	75.2	Confident	67	Low	135 Å²	135	123.6 Å²	123.6	67%	0.665	65%	0.652	S	S	*	*	H	α-helix	trans	-62.3	-39.6	171.6	-97.2	176.1	164.5	0	111.8	D2 L8 S9	D2-M5 PolarHBondContact O-N 3.08Å; M5-L8 PolarHBondContact O-N 2.84Å; M5-S9 PolarHBondContact O-N 3.41Å; M5-S9 PolarHBondContact O-OG 2.74Å
6	K	75.4	Confident	66.6	Low	154 Å²	154	119.4 Å²	119.4	67%	0.67	64%	0.641	S	S	*	*	H	α-helix	trans	-67.2	-36.7	176.8	-159.6	166.3	-174.1	162.8	112.3	D2 F4 K10	D2-K6 WeakPolarHBondContact O-CB 3.35Å; D2-K6 PolarHBondContact O-N 3.2Å; F4-K6 VanDerWaalsContact C-N 3.32Å; F4-K6 PolarHBondContact O-N 3.39Å; K6-K10 PolarHBondContact O-N 3.15Å
7	G	73.3	Confident	66.2	Low	42 Å²	42	117.8 Å²	117.8	43%	0.433	64%	0.636	S	S	.	*	H	α-helix	trans	-65.8	-43.9	171.9	0	0	0	0	112.7	V3 F4 K10 A11	V3-G7 PolarHBondContact O-N 3.45Å; F4-G7 PolarHBondContact O-N 3.01Å; G7-K10 PolarHBondContact O-N 3.12Å; G7-A11 WeakPolarHBondContact O-CB 3.4Å; G7-A11 PolarHBondContact O-N 3.22Å
8	L	70.3	Confident	65.7	Low	112 Å²	112	114.1 Å²	114.1	59%	0.586	62%	0.624	S	S	*	*	H	α-helix	trans	-64.5	-41.2	178.2	-168.9	72.4	0	0	112	F4 M5 A11 K12	F4-L8 WeakPolarHBondContact O-CB 3.26Å; F4-L8 PolarHBondContact O-N 2.95Å; M5-L8 PolarHBondContact O-N 2.84Å; L8-A11 PolarHBondContact O-N 3.47Å; L8-K12 WeakPolarHBondContact O-CB 3.43Å; L8-K12 PolarHBondContact O-N 2.9Å
9	S	69.5	Low	65.3	Low	74 Å²	74	110.6 Å²	110.6	52%	0.517	61%	0.612	S	S	.	*	H	α-helix	trans	-63.8	-42.2	175.5	-65.4	0	0	0	112.2	M5 K12 E13	M5-S9 PolarHBondContact O-N 3.41Å; M5-S9 PolarHBondContact O-OG 2.74Å; S9-K12 PolarHBondContact O-N 3.45Å; S9-E13 PolarHBondContact O-N 3.44Å
10	K	66.3	Low	64.9	Low	150 Å²	150	111.7 Å²	111.7	65%	0.652	61%	0.612	S	S	*	*	H	α-helix	trans	-65.1	-38.7	174.1	-90.8	-175.7	173.8	-179.2	112.9	K6 G7 K12 G14	K6-K10 PolarHBondContact O-N 3.15Å; G7-K10 PolarHBondContact O-N 3.12Å; K10-K12 VanDerWaalsContact C-N 3.34Å; K10-G14 PolarHBondContact O-N 2.82Å
11	A	65.1	Low	64.6	Low	63 Å²	63	113.8 Å²	113.8	52%	0.521	62%	0.615	S	S	.	*	H	α-helix	trans	-66	-38.6	176.2	0	0	0	0	111.6	G7 L8 G14 M15	G7-A11 WeakPolarHBondContact O-CB 3.4Å; G7-A11 PolarHBondContact O-N 3.22Å; L8-A11 PolarHBondContact O-N 3.47Å; A11-G14 PolarHBondContact O-N 2.68Å; A11-M15 WeakPolarHBondContact O-CB 3.41Å; A11-M15 PolarHBondContact O-N 2.89Å
12	K	63.6	Low	64.4	Low	165 Å²	165	108.1 Å²	108.1	72%	0.717	59%	0.592	S	S	*	*	H	α-helix	trans	-66.3	-42.8	176.3	-168.6	-178.6	-178.3	-172.8	112.2	L8 S9 K10 M15 A16	L8-K12 WeakPolarHBondContact O-CB 3.43Å; L8-K12 PolarHBondContact O-N 2.9Å; S9-K12 PolarHBondContact O-N 3.45Å; K10-K12 VanDerWaalsContact C-N 3.34Å; K12-M15 PolarHBondContact O-N 3.01Å; K12-A16 PolarHBondContact O-N 2.9Å
13	E	63.1	Low	63.7	Low	138 Å²	138	109.2 Å²	109.2	65%	0.645	59%	0.591	S	S	*	*	H	α-helix	trans	-62.9	-44.1	173.2	-78.8	-179.7	157.5	0	111.7	S9 M15 A16 V17	S9-E13 PolarHBondContact O-N 3.44Å; E13-M15 VanDerWaalsContact C-N 3.31Å; E13-M15 PolarHBondContact O-N 3.34Å; E13-A16 PolarHBondContact O-N 2.85Å; E13-V17 WeakPolarHBondContact O-CG2 3.46Å; E13-V17 PolarHBondContact O-N 2.94Å; E13-V17 VanDerWaalsContact O-N 3.11Å
14	G	60.2	Low	63.3	Low	41 Å²	41	109.2 Å²	109.2	42%	0.423	58%	0.582	S	S	.	*	H	α-helix	trans	-61.6	-36.5	176.4	0	0	0	0	113.4	K10 A11 A18	K10-G14 PolarHBondContact O-N 2.82Å; A11-G14 PolarHBondContact O-N 2.68Å; G14-A18 WeakPolarHBondContact O-CB 3.27Å; G14-A18 PolarHBondContact O-N 3.36Å
15	M	56.4	Low	62.8	Low	144 Å²	144	103.2 Å²	103.2	71%	0.709	57%	0.568	S	S	*	*	H	α-helix	trans	-71.3	-37.1	176.7	-174.4	169.3	177.9	0	112.6	A11 K12 E13 A18 A19	A11-M15 WeakPolarHBondContact O-CB 3.41Å; A11-M15 PolarHBondContact O-N 2.89Å; K12-M15 PolarHBondContact O-N 3.01Å; E13-M15 VanDerWaalsContact C-N 3.31Å; E13-M15 PolarHBondContact O-N 3.34Å; M15-A18 PolarHBondContact O-N 3.18Å; M15-A19 VanDerWaalsContact O-CB 3.31Å; M15-A19 WeakPolarHBondContact O-CB 3.26Å; M15-A19 PolarHBondContact O-N 3.4Å
16	A	60.3	Low	61.7	Low	57 Å²	57	101.2 Å²	101.2	47%	0.471	56%	0.563	S	S	.	*	H	α-helix	trans	-62.8	-44.2	174.5	0	0	0	0	111.2	K12 E13 A19 E20	K12-A16 PolarHBondContact O-N 2.9Å; E13-A16 PolarHBondContact O-N 2.85Å; A16-A19 PolarHBondContact O-N 3.45Å; A16-E20 WeakPolarHBondContact O-CB 3.25Å; A16-E20 PolarHBondContact O-N 3.34Å
17	V	60.3	Low	60.9	Low	91 Å²	91	96.7 Å²	96.7	55%	0.552	55%	0.554	S	S	*	*	H	α-helix	trans	-64.5	-41.2	176.3	175	0	0	0	111.7	E13 E20 K21	E13-V17 WeakPolarHBondContact O-CG2 3.46Å; E13-V17 PolarHBondContact O-N 2.94Å; E13-V17 VanDerWaalsContact O-N 3.11Å; V17-E20 PolarHBondContact O-N 3.11Å; V17-K21 WeakPolarHBondContact O-CB 3.15Å; V17-K21 PolarHBondContact O-N 3.27Å
18	A	56.8	Low	60	Low	51 Å²	51	98.4 Å²	98.4	42%	0.421	56%	0.556	S	S	.	*	H	α-helix	trans	-65.4	-39.7	176.2	0	0	0	0	112.1	G14 M15 T22	G14-A18 WeakPolarHBondContact O-CB 3.27Å; G14-A18 PolarHBondContact O-N 3.36Å; M15-A18 PolarHBondContact O-N 3.18Å; A18-T22 VanDerWaalsContact O-CB 3.28Å; A18-T22 WeakPolarHBondContact O-CB 3.34Å; A18-T22 PolarHBondContact O-N 2.98Å; A18-T22 PolarHBondContact O-OG1 3.45Å
19	A	57.9	Low	59.3	Low	48 Å²	48	95.5 Å²	95.5	40%	0.397	55%	0.549	S	S	.	.	H	α-helix	trans	-67.1	-39	176.3	0	0	0	0	112	M15 A16 T22 K23	M15-A19 VanDerWaalsContact O-CB 3.31Å; M15-A19 WeakPolarHBondContact O-CB 3.26Å; M15-A19 PolarHBondContact O-N 3.4Å; A16-A19 PolarHBondContact O-N 3.45Å; A19-T22 PolarHBondContact O-N 3.41Å; A19-K23 WeakPolarHBondContact O-CG 3.47Å; A19-K23 PolarHBondContact O-N 3.25Å
20	E	57.6	Low	58.5	Low	133 Å²	133	94.4 Å²	94.4	62%	0.621	54%	0.544	S	S	*	.	H	α-helix	trans	-67.8	-46.8	177.5	-153.2	172.7	107.3	0	111.4	A16 V17 T22 K23 E24	A16-E20 WeakPolarHBondContact O-CB 3.25Å; A16-E20 PolarHBondContact O-N 3.34Å; V17-E20 PolarHBondContact O-N 3.11Å; E20-T22 VanDerWaalsContact C-N 3.27Å; E20-T22 PolarHBondContact O-N 2.87Å; E20-K23 PolarHBondContact O-N 2.74Å; E20-K23 VanDerWaalsContact O-N 3.14Å; E20-E24 PolarHBondContact O-N 3.42Å
21	K	58.4	Low	57.9	Low	156 Å²	156	93.7 Å²	93.7	68%	0.678	54%	0.543	S	S	*	.	H	α-helix	trans	-60.5	-34.5	172	-95.3	-170.7	172.8	-179.3	113.3	V17 G25	V17-K21 WeakPolarHBondContact O-CB 3.15Å; V17-K21 PolarHBondContact O-N 3.27Å; K21-G25 PolarHBondContact O-N 3.33Å
22	T	55.8	Low	57.5	Low	88 Å²	88	97.6 Å²	97.6	54%	0.54	55%	0.548	S	S	.	.	H	α-helix	trans	-71.6	-36.5	177	-58.3	0	0	0	111	A18 A19 E20 G25 V26	A18-T22 VanDerWaalsContact O-CB 3.28Å; A18-T22 WeakPolarHBondContact O-CB 3.34Å; A18-T22 PolarHBondContact O-N 2.98Å; A18-T22 PolarHBondContact O-OG1 3.45Å; A19-T22 PolarHBondContact O-N 3.41Å; E20-T22 VanDerWaalsContact C-N 3.27Å; E20-T22 PolarHBondContact O-N 2.87Å; T22-G25 PolarHBondContact O-N 3.07Å; T22-V26 HydrophobicContact CG2-CG2 4.27Å; T22-V26 VanDerWaalsContact O-CB 3.28Å; T22-V26 WeakPolarHBondContact O-CB 3.34Å; T22-V26 WeakPolarHBondContact O-CG2 3.34Å; T22-V26 PolarHBondContact O-N 3.48Å
23	K	58.8	Low	57.2	Low	157 Å²	157	93.9 Å²	93.9	68%	0.683	54%	0.539	S	S	*	.	H	α-helix	trans	-65.8	-44.4	174.5	-76.3	179.1	-178	-176.5	112.2	A19 E20 A27	A19-K23 WeakPolarHBondContact O-CG 3.47Å; A19-K23 PolarHBondContact O-N 3.25Å; E20-K23 PolarHBondContact O-N 2.74Å; E20-K23 VanDerWaalsContact O-N 3.14Å; K23-A27 VanDerWaalsContact O-CB 3.31Å; K23-A27 WeakPolarHBondContact O-CB 3.39Å; K23-A27 PolarHBondContact O-N 3.41Å
24	E	59.6	Low	56.8	Low	126 Å²	126	94.9 Å²	94.9	59%	0.589	54%	0.542	S	S	*	.	H	α-helix	trans	-64.5	-44.6	174.5	-73.7	-173.8	151.7	0	111.7	E20 V26 A27 V28	E20-E24 PolarHBondContact O-N 3.42Å; E24-V26 PolarHBondContact O-N 2.91Å; E24-A27 PolarHBondContact O-N 3.26Å; E24-V28 VanDerWaalsContact O-CG2 3.31Å; E24-V28 WeakPolarHBondContact O-CG2 3.49Å; E24-V28 PolarHBondContact O-N 2.86Å
25	G	55.5	Low	56.6	Low	42 Å²	42	99.3 Å²	99.3	43%	0.433	55%	0.551	S	S	.	*	H	α-helix	trans	-61.7	-40.7	177.3	0	0	0	0	113.3	K21 T22 A29	K21-G25 PolarHBondContact O-N 3.33Å; T22-G25 PolarHBondContact O-N 3.07Å; G25-A29 VanDerWaalsContact O-CB 3.3Å; G25-A29 WeakPolarHBondContact O-CB 3.12Å; G25-A29 PolarHBondContact O-N 3.39Å
26	V	51.7	Low	56.6	Low	94 Å²	94	94.1 Å²	94.1	57%	0.57	54%	0.535	S	S	*	.	H	α-helix	trans	-69.6	-39	175.7	166.9	0	0	0	111.5	T22 E24 A29 A30	T22-V26 HydrophobicContact CG2-CG2 4.27Å; T22-V26 VanDerWaalsContact O-CB 3.28Å; T22-V26 WeakPolarHBondContact O-CB 3.34Å; T22-V26 WeakPolarHBondContact O-CG2 3.34Å; T22-V26 PolarHBondContact O-N 3.48Å; E24-V26 PolarHBondContact O-N 2.91Å; V26-A29 PolarHBondContact O-N 2.79Å; V26-A30 WeakPolarHBondContact O-CB 3.32Å; V26-A30 PolarHBondContact O-N 3.45Å
27	A	57.9	Low	56.1	Low	58 Å²	58	95.9 Å²	95.9	48%	0.479	54%	0.539	S	S	.	.	H	α-helix	trans	-64.2	-45.3	175.8	0	0	0	0	111.7	K23 E24 A29 A30 E31	K23-A27 VanDerWaalsContact O-CB 3.31Å; K23-A27 WeakPolarHBondContact O-CB 3.39Å; K23-A27 PolarHBondContact O-N 3.41Å; E24-A27 PolarHBondContact O-N 3.26Å; A27-A29 PolarHBondContact O-N 2.97Å; A27-A30 PolarHBondContact O-N 2.93Å; A27-E31 WeakPolarHBondContact O-CB 3.39Å; A27-E31 PolarHBondContact O-N 2.92Å
28	V	55.7	Low	56	Low	78 Å²	78	98 Å²	98	47%	0.473	55%	0.545	S	S	.	.	H	α-helix	trans	-65.3	-39	176.7	172.8	0	0	0	111.5	E24 E31 K32	E24-V28 VanDerWaalsContact O-CG2 3.31Å; E24-V28 WeakPolarHBondContact O-CG2 3.49Å; E24-V28 PolarHBondContact O-N 2.86Å; V28-E31 PolarHBondContact O-N 3.47Å; V28-K32 HydrophobicContact CG1-CD 4.3Å; V28-K32 HydrophobicContact CG1-CG 4.47Å; V28-K32 WeakPolarHBondContact O-CB 3.33Å; V28-K32 WeakPolarHBondContact O-CG 3.49Å; V28-K32 PolarHBondContact O-N 2.82Å
29	A	54.3	Low	56	Low	52 Å²	52	102 Å²	102	43%	0.43	55%	0.553	S	S	.	*	H	α-helix	trans	-65.4	-39.6	174.3	0	0	0	0	112.1	G25 V26 A27 T33	G25-A29 VanDerWaalsContact O-CB 3.3Å; G25-A29 WeakPolarHBondContact O-CB 3.12Å; G25-A29 PolarHBondContact O-N 3.39Å; V26-A29 PolarHBondContact O-N 2.79Å; A27-A29 PolarHBondContact O-N 2.97Å; A29-T33 VanDerWaalsContact O-CB 3.24Å; A29-T33 WeakPolarHBondContact O-CB 3.31Å; A29-T33 PolarHBondContact O-N 3.35Å; A29-T33 PolarHBondContact O-OG1 3.06Å
30	A	54.2	Low	55.7	Low	51 Å²	51	104.2 Å²	104.2	42%	0.421	56%	0.562	S	S	.	*	H	α-helix	trans	-67.8	-39.9	176.5	0	0	0	0	112.2	V26 A27 T33 K34	V26-A30 WeakPolarHBondContact O-CB 3.32Å; V26-A30 PolarHBondContact O-N 3.45Å; A27-A30 PolarHBondContact O-N 2.93Å; A30-T33 PolarHBondContact O-N 2.88Å; A30-K34 WeakPolarHBondContact O-CG 3.31Å; A30-K34 PolarHBondContact O-N 3.11Å
31	E	53.6	Low	55.7	Low	134 Å²	134	99.7 Å²	99.7	63%	0.626	55%	0.551	S	S	*	*	H	α-helix	trans	-66.5	-48.4	176.2	-165.5	175.4	105.8	0	111.5	A27 V28 T33 K34 E35	A27-E31 WeakPolarHBondContact O-CB 3.39Å; A27-E31 PolarHBondContact O-N 2.92Å; V28-E31 PolarHBondContact O-N 3.47Å; E31-T33 VanDerWaalsContact C-N 3.27Å; E31-T33 PolarHBondContact O-N 3.45Å; E31-K34 PolarHBondContact O-N 3.05Å; E31-K34 VanDerWaalsContact O-N 3.11Å; E31-E35 PolarHBondContact O-N 3.32Å
32	K	56.8	Low	55.5	Low	145 Å²	145	97 Å²	97	63%	0.63	55%	0.547	S	S	*	.	H	α-helix	trans	-63.3	-31.2	174.7	-74.4	-170	175.5	-172.2	113.2	V28 G36	V28-K32 HydrophobicContact CG1-CD 4.3Å; V28-K32 HydrophobicContact CG1-CG 4.47Å; V28-K32 WeakPolarHBondContact O-CB 3.33Å; V28-K32 WeakPolarHBondContact O-CG 3.49Å; V28-K32 PolarHBondContact O-N 2.82Å; K32-G36 PolarHBondContact O-N 3.48Å
33	T	56.4	Low	55.3	Low	87 Å²	87	99.3 Å²	99.3	53%	0.534	55%	0.55	S	S	.	.	H	α-helix	trans	-69.9	-37.7	174.3	-60.5	0	0	0	111.3	A29 A30 E31 G36 V37	A29-T33 VanDerWaalsContact O-CB 3.24Å; A29-T33 WeakPolarHBondContact O-CB 3.31Å; A29-T33 PolarHBondContact O-N 3.35Å; A29-T33 PolarHBondContact O-OG1 3.06Å; A30-T33 PolarHBondContact O-N 2.88Å; E31-T33 VanDerWaalsContact C-N 3.27Å; E31-T33 PolarHBondContact O-N 3.45Å; T33-G36 PolarHBondContact O-N 2.89Å; T33-V37 HydrophobicContact CG2-CG2 4.25Å; T33-V37 WeakPolarHBondContact O-CB 3.46Å; T33-V37 WeakPolarHBondContact O-CG2 3.49Å; T33-V37 PolarHBondContact O-N 3.44Å
34	K	53.6	Low	55	Low	160 Å²	160	94 Å²	94	70%	0.696	54%	0.535	S	S	*	.	H	α-helix	trans	-65.1	-43.8	174.3	-75.4	-177.6	-179.3	-174.6	112.1	A30 E31 M38	A30-K34 WeakPolarHBondContact O-CG 3.31Å; A30-K34 PolarHBondContact O-N 3.11Å; E31-K34 PolarHBondContact O-N 3.05Å; E31-K34 VanDerWaalsContact O-N 3.11Å; K34-M38 WeakPolarHBondContact O-CB 3.19Å; K34-M38 VanDerWaalsContact O-CG 3.27Å; K34-M38 WeakPolarHBondContact O-CG 3.35Å; K34-M38 PolarHBondContact O-N 3.5Å
35	E	56.3	Low	54.6	Low	134 Å²	134	96.4 Å²	96.4	63%	0.626	54%	0.544	S	S	*	.	H	α-helix	trans	-64.8	-42.6	174.4	-74.5	-168.9	147.8	0	112.2	E31 V37 M38 F39	E31-E35 PolarHBondContact O-N 3.32Å; E35-V37 PolarHBondContact O-N 3.43Å; E35-M38 PolarHBondContact O-N 2.92Å; E35-F39 VanDerWaalsContact O-CB 3.32Å; E35-F39 WeakPolarHBondContact O-CB 3.41Å; E35-F39 PolarHBondContact O-N 2.92Å
36	G	56.5	Low	54.4	Low	35 Å²	35	100.2 Å²	100.2	36%	0.361	55%	0.554	S	S	.	*	H	α-helix	trans	-61.5	-42.8	177.3	0	0	0	0	113	K32 T33 F39 V40	K32-G36 PolarHBondContact O-N 3.48Å; T33-G36 PolarHBondContact O-N 2.89Å; G36-F39 PolarHBondContact O-N 2.93Å; G36-V40 WeakPolarHBondContact O-CB 3.28Å; G36-V40 VanDerWaalsContact O-CG2 3.28Å; G36-V40 WeakPolarHBondContact O-CG2 3.41Å; G36-V40 PolarHBondContact O-N 3.27Å
37	V	51.5	Low	54.2	Low	94 Å²	94	98.3 Å²	98.3	57%	0.57	55%	0.545	S	S	*	.	H	α-helix	trans	-69.4	-36.6	177.7	174	0	0	0	111.6	T33 E35 G41	T33-V37 HydrophobicContact CG2-CG2 4.25Å; T33-V37 WeakPolarHBondContact O-CB 3.46Å; T33-V37 WeakPolarHBondContact O-CG2 3.49Å; T33-V37 PolarHBondContact O-N 3.44Å; E35-V37 PolarHBondContact O-N 3.43Å; V37-G41 WeakPolarHBondContact O-CA 3.27Å; V37-G41 PolarHBondContact O-N 3.44Å
38	M	57.9	Low	53.8	Low	136 Å²	136	100.6 Å²	100.6	67%	0.67	55%	0.553	S	S	*	*	H	α-helix	trans	-70.8	-37.2	175	-69.9	-65.5	172.8	0	112.4	K34 E35 T42	K34-M38 WeakPolarHBondContact O-CB 3.19Å; K34-M38 VanDerWaalsContact O-CG 3.27Å; K34-M38 WeakPolarHBondContact O-CG 3.35Å; K34-M38 PolarHBondContact O-N 3.5Å; E35-M38 PolarHBondContact O-N 2.92Å; M38-T42 WeakPolarHBondContact O-CB 3.41Å; M38-T42 PolarHBondContact O-N 2.96Å; M38-T42 PolarHBondContact O-OG1 2.9Å
39	F	56.1	Low	53.7	Low	134 Å²	134	99.1 Å²	99.1	59%	0.588	55%	0.553	S	S	*	*	H	α-helix	trans	-67.5	-45.7	175.4	-178	-100.6	0	0	111.6	E35 G36 T42 K43	E35-F39 VanDerWaalsContact O-CB 3.32Å; E35-F39 WeakPolarHBondContact O-CB 3.41Å; E35-F39 PolarHBondContact O-N 2.92Å; G36-F39 PolarHBondContact O-N 2.93Å; F39-T42 PolarHBondContact O-N 3.49Å; F39-K43 HydrophobicContact CE1-CD 4.1Å; F39-K43 HydrophobicContact CZ-CD 4.2Å; F39-K43 HydrophobicContact CZ-CG 4.49Å; F39-K43 WeakPolarHBondContact O-CB 3.3Å; F39-K43 PolarHBondContact O-N 3.02Å
40	V	52.1	Low	53.6	Low	95 Å²	95	100.1 Å²	100.1	58%	0.576	55%	0.554	S	S	*	*	H	α-helix	trans	-66.8	-39.9	174.9	173.2	0	0	0	111.1	G36 T42 K43 A44	G36-V40 WeakPolarHBondContact O-CB 3.28Å; G36-V40 VanDerWaalsContact O-CG2 3.28Å; G36-V40 WeakPolarHBondContact O-CG2 3.41Å; G36-V40 PolarHBondContact O-N 3.27Å; V40-T42 VanDerWaalsContact C-N 3.34Å; V40-T42 PolarHBondContact O-N 3.43Å; V40-K43 PolarHBondContact O-N 2.92Å; V40-A44 WeakPolarHBondContact O-CB 3.31Å; V40-A44 PolarHBondContact O-N 3.18Å
41	G	56.4	Low	53.4	Low	38 Å²	38	101.9 Å²	101.9	39%	0.392	56%	0.559	S	S	.	*	H	α-helix	trans	-63.7	-38.1	176.7	0	0	0	0	113.1	V37 K45	V37-G41 WeakPolarHBondContact O-CA 3.27Å; V37-G41 PolarHBondContact O-N 3.44Å; G41-K45 PolarHBondContact O-N 2.97Å
42	T	54	Low	53.2	Low	99 Å²	99	98.2 Å²	98.2	61%	0.607	55%	0.552	S	S	*	*	H	α-helix	trans	-73	-45.3	174.8	-52.3	0	0	0	111.2	M38 F39 V40 A44 K45 D46	M38-T42 WeakPolarHBondContact O-CB 3.41Å; M38-T42 PolarHBondContact O-N 2.96Å; M38-T42 PolarHBondContact O-OG1 2.9Å; F39-T42 PolarHBondContact O-N 3.49Å; V40-T42 VanDerWaalsContact C-N 3.34Å; V40-T42 PolarHBondContact O-N 3.43Å; T42-A44 VanDerWaalsContact C-N 3.35Å; T42-A44 PolarHBondContact O-N 2.89Å; T42-K45 PolarHBondContact O-N 2.67Å; T42-D46 PolarHBondContact O-N 3.42Å
43	K	53.3	Low	52.9	Low	136 Å²	136	98.9 Å²	98.9	59%	0.591	56%	0.557	S	S	*	*	H	α-helix	trans	-63.3	-36.9	175.9	-105.9	-157.7	176.6	-171.4	113.1	F39 V40 D46 S47	F39-K43 HydrophobicContact CE1-CD 4.1Å; F39-K43 HydrophobicContact CZ-CD 4.2Å; F39-K43 HydrophobicContact CZ-CG 4.49Å; F39-K43 WeakPolarHBondContact O-CB 3.3Å; F39-K43 PolarHBondContact O-N 3.02Å; V40-K43 PolarHBondContact O-N 2.92Å; K43-D46 PolarHBondContact O-N 3.25Å; K43-S47 WeakPolarHBondContact O-CB 3.24Å; K43-S47 PolarHBondContact O-N 2.89Å; K43-S47 PolarHBondContact O-OG 3.38Å
44	A	51.8	Low	52.8	Low	45 Å²	45	102.4 Å²	102.4	37%	0.372	57%	0.565	S	S	.	*	H	α-helix	trans	-67.3	-36.9	-179.6	0	0	0	0	112.4	V40 T42 S47 V48	V40-A44 WeakPolarHBondContact O-CB 3.31Å; V40-A44 PolarHBondContact O-N 3.18Å; T42-A44 VanDerWaalsContact C-N 3.35Å; T42-A44 PolarHBondContact O-N 2.89Å; A44-S47 WeakPolarHBondContact CA-OG 3.49Å; A44-S47 PolarHBondContact O-OG 3.31Å; A44-V48 VanDerWaalsContact O-CG2 3.31Å; A44-V48 WeakPolarHBondContact O-CG2 3.28Å; A44-V48 PolarHBondContact O-N 3.38Å
45	K	50.5	Low	52.7	Low	178 Å²	178	98.8 Å²	98.8	77%	0.774	56%	0.556	S	S	*	*	H	α-helix	trans	-66.8	-39.1	173.8	-78.6	-176.4	175.3	-178.7	112	G41 T42	G41-K45 PolarHBondContact O-N 2.97Å; T42-K45 PolarHBondContact O-N 2.67Å
46	D	52.7	Low	52.6	Low	121 Å²	121	97.8 Å²	97.8	65%	0.647	56%	0.56	S	S	*	*	H	α-helix	trans	-72.3	-38	178.2	-133.5	-92.5	0	0	112.4	T42 K43 G49 T50	T42-D46 PolarHBondContact O-N 3.42Å; K43-D46 PolarHBondContact O-N 3.25Å; D46-G49 PolarHBondContact O-N 2.93Å; D46-T50 PolarHBondContact O-N 2.68Å; D46-T50 PolarHBondContact O-OG1 2.96Å
47	S	47.4	Very low	52.4	Low	55 Å²	55	98 Å²	98	39%	0.385	56%	0.562	S	S	.	*	H	α-helix	trans	-74.1	-28.3	-179.4	56.5	0	0	0	114	K43 A44 G49 T50 V51	K43-S47 WeakPolarHBondContact O-CB 3.24Å; K43-S47 PolarHBondContact O-N 2.89Å; K43-S47 PolarHBondContact O-OG 3.38Å; A44-S47 WeakPolarHBondContact CA-OG 3.49Å; A44-S47 PolarHBondContact O-OG 3.31Å; S47-G49 VanDerWaalsContact C-N 3.35Å; S47-T50 WeakPolarHBondContact CA-OG1 3.21Å; S47-T50 PolarHBondContact O-OG1 3.11Å; S47-V51 WeakPolarHBondContact O-CB 3.32Å; S47-V51 WeakPolarHBondContact O-CG2 3.41Å; S47-V51 PolarHBondContact O-N 2.92Å
48	V	49.5	Very low	52.5	Low	106 Å²	106	95.9 Å²	95.9	64%	0.642	56%	0.555	S	S	*	*	H	α-helix	trans	-66.8	-36.7	173.9	168.2	0	0	0	111.6	A44 A52	A44-V48 VanDerWaalsContact O-CG2 3.31Å; A44-V48 WeakPolarHBondContact O-CG2 3.28Å; A44-V48 PolarHBondContact O-N 3.38Å; V48-A52 PolarHBondContact O-N 3.31Å
49	G	52.4	Low	52.1	Low	46 Å²	46	95.6 Å²	95.6	47%	0.474	55%	0.553	S	S	.	*	H	α-helix	trans	-66.1	-42.5	176	0	0	0	0	113.1	D46 S47 E53	D46-G49 PolarHBondContact O-N 2.93Å; S47-G49 VanDerWaalsContact C-N 3.35Å; G49-E53 PolarHBondContact O-N 3.14Å
50	T	52.9	Low	51.9	Low	74 Å²	74	91.4 Å²	91.4	45%	0.454	55%	0.548	S	S	.	.	H	α-helix	trans	-77	-30	-179.6	26.3	0	0	0	113.9	D46 S47 K54	D46-T50 PolarHBondContact O-N 2.68Å; D46-T50 PolarHBondContact O-OG1 2.96Å; S47-T50 WeakPolarHBondContact CA-OG1 3.21Å; S47-T50 PolarHBondContact O-OG1 3.11Å; T50-K54 WeakPolarHBondContact O-CB 3.28Å; T50-K54 PolarHBondContact O-N 3.27Å
51	V	49.3	Very low	52.1	Low	87 Å²	87	92.6 Å²	92.6	53%	0.527	55%	0.551	S	S	.	*	H	α-helix	trans	-70.6	-36.5	174.5	170.5	0	0	0	111.3	S47 T55	S47-V51 WeakPolarHBondContact O-CB 3.32Å; S47-V51 WeakPolarHBondContact O-CG2 3.41Å; S47-V51 PolarHBondContact O-N 2.92Å; V51-T55 VanDerWaalsContact O-CB 3.25Å; V51-T55 WeakPolarHBondContact O-CB 3.38Å; V51-T55 PolarHBondContact O-N 3.06Å; V51-T55 PolarHBondContact O-OG1 3.39Å
52	A	48.9	Very low	52.1	Low	57 Å²	57	95.3 Å²	95.3	47%	0.471	56%	0.556	S	S	.	*	H	α-helix	trans	-63	-46.4	173.7	0	0	0	0	111.6	V48 T55 T56	V48-A52 PolarHBondContact O-N 3.31Å; A52-T55 PolarHBondContact O-N 3.38Å; A52-T56 PolarHBondContact O-N 2.97Å; A52-T56 VanDerWaalsContact O-N 3.11Å
53	E	51.2	Low	52.1	Low	159 Å²	159	94.5 Å²	94.5	74%	0.743	55%	0.551	S	S	*	*	H	α-helix	trans	-66	-40.2	178.9	-160.5	174	103.1	0	112.4	G49 G57	G49-E53 PolarHBondContact O-N 3.14Å; E53-G57 PolarHBondContact O-N 3.42Å; E53-G57 VanDerWaalsContact O-N 3.15Å
54	K	53.6	Low	52.2	Low	161 Å²	161	92 Å²	92	70%	0.7	56%	0.555	S	S	*	*	H	α-helix	trans	-71	-31.5	175.1	-80.8	-179.9	178.8	-74.8	113.8	T50 A58	T50-K54 WeakPolarHBondContact O-CB 3.28Å; T50-K54 PolarHBondContact O-N 3.27Å; K54-A58 VanDerWaalsContact O-CB 3.26Å; K54-A58 WeakPolarHBondContact O-CB 3.46Å; K54-A58 PolarHBondContact O-N 2.88Å
55	T	52.2	Low	52.3	Low	84 Å²	84	94.1 Å²	94.1	52%	0.515	57%	0.573	S	S	.	*	H	α-helix	trans	-73.3	-40.5	178.7	-57	0	0	0	111.2	V51 A52 A58 M59	V51-T55 VanDerWaalsContact O-CB 3.25Å; V51-T55 WeakPolarHBondContact O-CB 3.38Å; V51-T55 PolarHBondContact O-N 3.06Å; V51-T55 PolarHBondContact O-OG1 3.39Å; A52-T55 PolarHBondContact O-N 3.38Å; T55-A58 PolarHBondContact O-N 3.4Å; T55-M59 WeakPolarHBondContact O-CB 3.39Å; T55-M59 PolarHBondContact O-N 3.2Å
56	T	54.5	Low	52.5	Low	113 Å²	113	89.5 Å²	89.5	69%	0.693	56%	0.56	S	S	*	*	H	α-helix	trans	-63.5	-41.8	172.3	-70.3	0	0	0	111.9	A52 G60	A52-T56 PolarHBondContact O-N 2.97Å; A52-T56 VanDerWaalsContact O-N 3.11Å; T56-G60 PolarHBondContact O-N 3Å
57	G	52.5	Low	52.7	Low	40 Å²	40	86 Å²	86	41%	0.412	55%	0.552	S	S	.	*	H	α-helix	trans	-67	-34.9	176.3	0	0	0	0	114.1	E53 N61	E53-G57 PolarHBondContact O-N 3.42Å; E53-G57 VanDerWaalsContact O-N 3.15Å; G57-N61 PolarHBondContact O-ND2 3.33Å
58	A	53.1	Low	52.9	Low	50 Å²	50	90.1 Å²	90.1	41%	0.413	57%	0.569	S	S	.	*	H	α-helix	trans	-75.1	-36.7	178.1	0	0	0	0	112.8	K54 T55 G60 N61 I62	K54-A58 VanDerWaalsContact O-CB 3.26Å; K54-A58 WeakPolarHBondContact O-CB 3.46Å; K54-A58 PolarHBondContact O-N 2.88Å; T55-A58 PolarHBondContact O-N 3.4Å; A58-G60 PolarHBondContact O-N 3.29Å; A58-N61 PolarHBondContact O-N 2.92Å; A58-I62 WeakPolarHBondContact O-CD1 3.43Å; A58-I62 VanDerWaalsContact O-CG1 3.27Å; A58-I62 WeakPolarHBondContact O-CG1 3.31Å; A58-I62 PolarHBondContact O-N 2.97Å
59	M	49.3	Very low	53	Low	129 Å²	129	91.1 Å²	91.1	64%	0.635	58%	0.575	S	S	*	*	H	α-helix	trans	-66.2	-36.3	179.8	-161.4	89.8	-166.1	0	112.5	T55 V63	T55-M59 WeakPolarHBondContact O-CB 3.39Å; T55-M59 PolarHBondContact O-N 3.2Å; M59-V63 PolarHBondContact O-N 3.35Å
60	G	51.4	Low	53.2	Low	47 Å²	47	97 Å²	97	49%	0.485	59%	0.587	S	S	.	*	H	α-helix	trans	-66.4	-35	177.7	0	0	0	0	113.7	T56 A58	T56-G60 PolarHBondContact O-N 3Å; A58-G60 PolarHBondContact O-N 3.29Å
61	N	57.4	Low	53.3	Low	119 Å²	119	103.2 Å²	103.2	64%	0.636	61%	0.608	S	S	*	*	H	α-helix	trans	-79.5	-29.3	-180	-67.2	-28.7	0	0	112.8	G57 A58 A65	G57-N61 PolarHBondContact O-ND2 3.33Å; A58-N61 PolarHBondContact O-N 2.92Å; N61-A65 WeakPolarHBondContact O-CB 3.39Å; N61-A65 PolarHBondContact O-N 2.99Å; N61-A65 VanDerWaalsContact O-N 3.08Å
62	I	55.9	Low	53.7	Low	96 Å²	96	105.8 Å²	105.8	49%	0.492	62%	0.619	S	S	.	*	H	α-helix	trans	-67.8	-44.5	177.6	-67.6	164.3	0	0	110.3	A58 A64 A65 T66	A58-I62 WeakPolarHBondContact O-CD1 3.43Å; A58-I62 VanDerWaalsContact O-CG1 3.27Å; A58-I62 WeakPolarHBondContact O-CG1 3.31Å; A58-I62 PolarHBondContact O-N 2.97Å; I62-A64 VanDerWaalsContact C-N 3.3Å; I62-A64 PolarHBondContact O-N 3.18Å; I62-A65 PolarHBondContact O-N 3.33Å; I62-T66 HydrophobicContact CG2-CG2 3.79Å; I62-T66 WeakPolarHBondContact O-CB 3.44Å; I62-T66 VanDerWaalsContact O-CG2 3.26Å; I62-T66 WeakPolarHBondContact O-CG2 3.34Å; I62-T66 PolarHBondContact O-N 2.95Å; I62-T66 PolarHBondContact O-OG1 2.92Å
63	V	54.8	Low	53.8	Low	82 Å²	82	111.7 Å²	111.7	50%	0.497	64%	0.637	S	S	.	*	H	α-helix	trans	-64	-34.7	178.5	173.3	0	0	0	112.5	M59	M59-V63 PolarHBondContact O-N 3.35Å
64	A	55.3	Low	53.4	Low	84 Å²	84	113.3 Å²	113.3	69%	0.694	64%	0.642	S	S	*	*	H	α-helix	trans	-71.5	-34.6	175.7	0	0	0	0	112.8	I62	I62-A64 VanDerWaalsContact C-N 3.3Å; I62-A64 PolarHBondContact O-N 3.18Å
65	A	54.1	Low	53.2	Low	89 Å²	89	111 Å²	111	74%	0.736	64%	0.643	S	S	*	*	H	α-helix	trans	-87.1	-28.5	-177.7	0	0	0	0	113.7	N61 I62 G67	N61-A65 WeakPolarHBondContact O-CB 3.39Å; N61-A65 PolarHBondContact O-N 2.99Å; N61-A65 VanDerWaalsContact O-N 3.08Å; I62-A65 PolarHBondContact O-N 3.33Å; A65-G67 PolarHBondContact O-N 2.91Å
66	T	55	Low	53.3	Low	81 Å²	81	113.7 Å²	113.7	50%	0.497	66%	0.66	S	S	.	*	T	Hydrogen-bonded Turn	trans	-81.9	-1.1	179.4	59	0	0	0	113.4	I62 L68	I62-T66 HydrophobicContact CG2-CG2 3.79Å; I62-T66 WeakPolarHBondContact O-CB 3.44Å; I62-T66 VanDerWaalsContact O-CG2 3.26Å; I62-T66 WeakPolarHBondContact O-CG2 3.34Å; I62-T66 PolarHBondContact O-N 2.95Å; I62-T66 PolarHBondContact O-OG1 2.92Å; T66-L68 PolarHBondContact O-N 3.27Å; T66-L68 VanDerWaalsContact O-N 3.12Å
67	G	56.3	Low	53.4	Low	48 Å²	48	115.4 Å²	115.4	50%	0.495	67%	0.665	S	S	.	*	T	Hydrogen-bonded Turn	trans	53.7	40.5	171.8	0	0	0	0	112.3	A65 V69	A65-G67 PolarHBondContact O-N 2.91Å; G67-V69 PolarHBondContact O-N 3.35Å
68	L	51.3	Low	53.2	Low	141 Å²	141	122.2 Å²	122.2	74%	0.738	69%	0.688	S	S	*	*			trans	-70.6	44	171.5	-70.6	172.5	0	0	111.2	T66 K70	T66-L68 PolarHBondContact O-N 3.27Å; T66-L68 VanDerWaalsContact O-N 3.12Å; L68-K70 PolarHBondContact O-N 3.3Å
69	V	52.7	Low	53.3	Low	126 Å²	126	125.3 Å²	125.3	76%	0.764	70%	0.697	S	S	*	*			trans	-76	111.4	160.7	179.6	0	0	0	105.8	G67	G67-V69 PolarHBondContact O-N 3.35Å
70	K	54.7	Low	53.5	Low	169 Å²	169	124.7 Å²	124.7	74%	0.735	70%	0.703	S	S	*	*			trans	35.3	112.5	159.4	-85.1	162.6	178.2	165.8	117.9	L68 D72	L68-K70 PolarHBondContact O-N 3.3Å; K70-D72 PolarHBondContact O-N 2.97Å
71	K	56.1	Low	53.6	Low	205 Å²	205	128.9 Å²	128.9	89%	0.891	71%	0.71	S	S	*	*	S	Bend	trans	-62.6	60.3	165.4	-161.7	179.4	-178.1	168.4	112
72	D	56.5	Low	53.4	Low	141 Å²	141	131.3 Å²	131.3	75%	0.754	72%	0.718	S	S	*	*			trans	-133.4	13.5	-179.8	-75.6	-54.3	0	0	113.7	K70	K70-D72 PolarHBondContact O-N 2.97Å
73	E	52.5	Low	53.1	Low	182 Å²	182	136.9 Å²	136.9	85%	0.85	73%	0.734	S	S	*	*			trans	-136.9	31.7	-175.8	-143.3	170.9	146.5	0	114.6
74	F	41.4	Very low	52.9	Low	192 Å²	192	136 Å²	136	84%	0.842	74%	0.742	S	S	*	*			trans	-101.5	114.5	163.3	-78.7	-79.5	0	0	109.5	T76	F74-T76 PolarHBondContact O-N 3.47Å
75	P	49.6	Very low	52.5	Low	113 Å²	113	139 Å²	139	73%	0.734	74%	0.742	S	S	*	*			trans	-63.9	126.9	177.3	25.3	-31.2	0	0	109.7	D77	P75-D77 PolarHBondContact O-N 2.9Å
76	T	55.5	Low	52.2	Low	140 Å²	140	142.7 Å²	142.7	86%	0.859	74%	0.744	S	S	*	*	S	Bend	trans	-73	29.5	-178.6	39.8	0	0	0	114.5	F74	F74-T76 PolarHBondContact O-N 3.47Å
77	D	55.4	Low	52	Low	149 Å²	149	143.6 Å²	143.6	80%	0.797	76%	0.759	S	S	*	*			trans	-113.3	51	-172.8	-80.8	-16	0	0	113.2	P75	P75-D77 PolarHBondContact O-N 2.9Å
78	M	49.4	Very low	51.8	Low	184 Å²	184	150 Å²	150	91%	0.906	78%	0.778	S	S	*	*			trans	-122	98.1	157.1	-96.9	-168.2	-97.4	0	109.5	P80	M78-P80 WeakPolarHBondContact O-CD 3.44Å
79	N	53.9	Low	51.8	Low	114 Å²	114	152.2 Å²	152.2	61%	0.61	79%	0.785	S	S	*	*			trans	-62.6	117.9	174.4	-177.5	9.5	0	0	110.3	E81	N79-E81 VanDerWaalsContact C-N 3.27Å; N79-E81 PolarHBondContact O-N 3.35Å; N79-E81 PolarHBondContact OD1-N 3.45Å
80	P	54.4	Low	51.7	Low	117 Å²	117	149.7 Å²	149.7	76%	0.76	79%	0.785	S	S	*	*	G	3₁₀ helix	trans	-79.9	2.8	179.5	31.5	-33.4	0	0	114.5	M78	M78-P80 WeakPolarHBondContact O-CD 3.44Å
81	E	53.9	Low	50.9	Low	134 Å²	134	151.2 Å²	151.2	63%	0.626	79%	0.794	S	S	*	*	G	3₁₀ helix	trans	-79.4	-15.9	-177	-73.3	-165.4	152.2	0	115.5	N79	N79-E81 VanDerWaalsContact C-N 3.27Å; N79-E81 PolarHBondContact O-N 3.35Å; N79-E81 PolarHBondContact OD1-N 3.45Å
82	E	52.8	Low	50.2	Low	171 Å²	171	144.7 Å²	144.7	80%	0.799	79%	0.786	S	S	*	*	G	3₁₀ helix	trans	-82.6	-14.8	-175.3	-119.3	-174.7	-179.5	0	114.6
83	Y	48.8	Very low	49.5	Very low	213 Å²	213	147.2 Å²	147.2	84%	0.835	79%	0.793	S	S	*	*	G	3₁₀ helix	trans	-94.7	-0.4	-175.8	-131.8	-94	0	0	114.3
84	G	50.8	Low	49.3	Very low	64 Å²	64	142.8 Å²	142.8	66%	0.66	79%	0.788	S	S	*	*	S	Bend	trans	-113.1	-11.5	-171.7	0	0	0	0	116.2
85	Q	47.5	Very low	49.2	Very low	147 Å²	147	143 Å²	143	69%	0.687	79%	0.794	S	S	*	*	S	Bend	trans	-103.4	-16.8	-169.7	-79.3	178.5	5.1	0	115.1	A87	Q85-A87 VanDerWaalsContact C-N 3.29Å; Q85-A87 PolarHBondContact O-N 3.39Å
86	E	47.2	Very low	49.4	Very low	166 Å²	166	145.7 Å²	145.7	78%	0.776	80%	0.801	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.3	1.6	-177.2	60.6	-179.2	158.3	0	115
87	A	51.9	Low	48.9	Very low	100 Å²	100	147.9 Å²	147.9	83%	0.826	80%	0.801	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102.9	-0.8	-179.6	0	0	0	0	115.2	Q85	Q85-A87 VanDerWaalsContact C-N 3.29Å; Q85-A87 PolarHBondContact O-N 3.39Å
88	M	52.1	Low	48.8	Very low	181 Å²	181	145.8 Å²	145.8	89%	0.892	80%	0.796	S	S	*	*	S	Bend	trans	-130.8	21.9	-176.9	-154.1	-177.7	170.2	0	115.1
89	E	51.5	Low	48.4	Very low	188 Å²	188	146.3 Å²	146.3	88%	0.879	80%	0.796	S	S	*	*	S	Bend	trans	-117.7	83.3	169.9	-71.9	-167.7	165.5	0	110
90	G	49.7	Very low	47.8	Very low	74 Å²	74	144 Å²	144	76%	0.763	80%	0.799	S	S	*	*	S	Bend	trans	-174	4.8	180	0	0	0	0	119
91	Q	38.9	Very low	47.2	Very low	200 Å²	200	145.4 Å²	145.4	94%	0.935	80%	0.795	S	S	*	*	S	Bend	trans	-136.5	110.9	171.6	-65.3	-171.3	-88.7	0	109.6
92	G	39.7	Very low	47.1	Very low	69 Å²	69	143.7 Å²	143.7	71%	0.711	81%	0.805	S	S	*	*			trans	-69.8	145.6	-165.3	0	0	0	0	115.2
93	E	41.8	Very low	46.5	Very low	193 Å²	193	145.3 Å²	145.3	90%	0.902	81%	0.805	S	S	*	*				51.7	123.1	115.1	-59.7	-73.8	161.2	0	118.2
94	A	49.9	Very low	46.7	Very low	90 Å²	90	142.6 Å²	142.6	74%	0.744	81%	0.805	S	S	*	*			trans	82.6	90.3	162.1	0	0	0	0	117.7
95	M	39.4	Very low	46.9	Very low	196 Å²	196	148.5 Å²	148.5	97%	0.966	82%	0.815	S	S	*	*				-163.2	84.7	112.1	-79.5	-139.4	-83.3	0	109.4
96	L	52.3	Low	47.2	Very low	169 Å²	169	146.9 Å²	146.9	89%	0.885	82%	0.82	S	S	*	*			trans	-76.4	125.7	153.3	-108.9	85.2	0	0	107.1
97	E	44.8	Very low	47.3	Very low	187 Å²	187	148 Å²	148	87%	0.874	83%	0.825	S	S	*	*				175.6	157.8	129.4	-99.8	-177.9	-148	0	111.9
98	P	53.8	Low	47.4	Very low	105 Å²	105	152.7 Å²	152.7	68%	0.682	83%	0.83	S	S	*	*				-126.9	-173	-121.8	29.2	-5.1	0	0	113.6
99	E	41.7	Very low	47.4	Very low	195 Å²	195	152.9 Å²	152.9	91%	0.911	83%	0.829	S	S	*	*			trans	82.4	128.4	160	-50.3	-150.8	122.3	0	118.6
100	G	41.9	Very low	47.4	Very low	65 Å²	65	150.1 Å²	150.1	67%	0.67	83%	0.83	S	S	*	*			trans	159.6	73.4	167.5	0	0	0	0	115.3
101	E	41.4	Very low	47.5	Very low	146 Å²	146	154.8 Å²	154.8	68%	0.682	83%	0.832	S	S	*	*			trans	70.5	100.1	148.1	-46.5	-58.9	140.9	0	119.2	Y103	E101-Y103 HydrophobicContact CB-CD2 3.85Å; E101-Y103 HydrophobicContact CB-CE2 3.51Å; E101-Y103 HydrophobicContact CG-CE2 4.16Å; E101-Y103 PolarHBondContact O-N 3.38Å
102	A	50.5	Low	48.2	Very low	99 Å²	99	152.7 Å²	152.7	82%	0.818	83%	0.827	S	S	*	*			trans	-59	118.3	149.6	0	0	0	0	110
103	Y	41.1	Very low	48.7	Very low	204 Å²	204	160.1 Å²	160.1	80%	0.8	84%	0.835	S	S	*	*			trans	-117.8	79.3	160.8	-75.5	-81.9	0	0	108.5	E101	E101-Y103 HydrophobicContact CB-CD2 3.85Å; E101-Y103 HydrophobicContact CB-CE2 3.51Å; E101-Y103 HydrophobicContact CG-CE2 4.16Å; E101-Y103 PolarHBondContact O-N 3.38Å
104	D	53.4	Low	49.4	Very low	157 Å²	157	158.5 Å²	158.5	84%	0.84	83%	0.828	S	S	*	*			trans	-115	76.7	159.2	-162.4	-53.5	0	0	107.1
105	E	54.4	Low	49.8	Very low	188 Å²	188	160.4 Å²	160.4	88%	0.879	83%	0.833	S	S	*	*			trans	-158	68.3	177.9	-144.2	164	115.4	0	111.9
106	S	54.2	Low	50.5	Low	113 Å²	113	160.2 Å²	160.2	79%	0.79	83%	0.829	S	S	*	*	S	Bend	trans	-152.6	1.9	161.3	64	0	0	0	119.4
107	Q	48.8	Very low	50.4	Low	190 Å²	190	160.5 Å²	160.5	89%	0.888	86%	0.856	S	S	*	*	S	Bend	trans	-139.3	39.9	173.9	-69.7	-143.3	11.3	0	116.7
108	Q	53.8	Low	50.7	Low	198 Å²	198	159.2 Å²	159.2	93%	0.925	86%	0.856	S	S	*	*	S	Bend	trans	-132.7	61.1	161.2	-75	-166.6	-6.5	0	111.9
109	E	51.5	Low	50.5	Low	185 Å²	185	162.1 Å²	162.1	86%	0.864	87%	0.865	S	S	*	*			trans	-155.1	81.9	156	-152.9	176.2	137.6	0	110.6
110	S	51.9	Low	51	Low	129 Å²	129	160.2 Å²	160.2	90%	0.902	86%	0.862	S	S	*	*			trans	-148.4	60.8	159.5	-59.7	0	0	0	107.3
111	Q	51.5	Low	51.5	Low	172 Å²	172	165.8 Å²	165.8	80%	0.804	87%	0.873	S	S	*	*			trans	-101	152.9	150.1	-68	-135.2	43.8	0	107.4
112	D	54.1	Low	52.2	Low	157 Å²	157	167.1 Å²	167.1	84%	0.84	89%	0.885	S	S	*	*			trans	93.2	78.2	175.7	-50.5	-44.9	0	0	117.3
113	Y	49.8	Very low	52.3	Low	224 Å²	224	171.6 Å²	171.6	88%	0.878	89%	0.89	S	S	*	*			trans	-147.6	130	131.8	-152.4	-107	0	0	111.3
114	E	57.3	Low	53.1	Low	159 Å²	159	169.3 Å²	169.3	74%	0.743	90%	0.896	S	S	*	*			trans	-63.3	154.9	-160.9	-70	170.2	92	0	116.8	E116	E114-E116 PolarHBondContact O-N 3.46Å
115	P	58.6	Low	53.1	Low	130 Å²	130	170.2 Å²	170.2	84%	0.844	90%	0.901	S	S	*	*			trans	-81.1	107.3	164	32.6	-29.5	0	0	110.4
116	E	53.1	Low	52.9	Low	192 Å²	192	168.8 Å²	168.8	90%	0.897	90%	0.903	S	S	*	*			trans	-77.5	141.7	162.3	-78.7	-150.9	146.2	0	111.1	E114	E114-E116 PolarHBondContact O-N 3.46Å
117	A	50.7	Low	52.8	Low	176 Å²	176	173.8 Å²	173.8	100%	1.455	91%	0.913	S	S	*	*			trans	-67.1	0	-169.6	0	0	0	0	115.9

Retrieved 117 of 117 residues in 133.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).