A0A087XEP3_POEFO Loading...

Zgc:136864

AlphaFold DB (A0A3B3VHZ6), UniProt , Accession A0A087XEP3, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 97 aa.

						>A0A087XEP3_POEFO|A0A087XEP3
MAQGSKKFKAQRPGGSKKHQQNKQKGPKKGGRIIAPKKAQVVQQQKLKKGLEVAIRNKIEQEVTQKASSSLHKPLAVVKGAEGKGKSAAARPGTSSK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.4	Very low	63.7	Low	243 Å²	243	165.8 Å²	165.8	100%	1.197	89%	0.888	S	S	*	*				0	125.9	0	-73.8	-179.2	173.1	0	0	108.6	Q3	M1-Q3 PolarHBondContact O-N 3.28Å
2	A	65.5	Low	64	Low	112 Å²	112	170.8 Å²	170.8	93%	0.926	89%	0.885	S	S	*	*			trans	-87.9	104.1	176.9	0	0	0	0	0	109.6
3	Q	65.7	Low	63.5	Low	195 Å²	195	168.1 Å²	168.1	91%	0.911	89%	0.885	S	S	*	*			trans	-103.9	91.3	174.4	-150.1	173.3	3.5	0	0	108.5	M1	M1-Q3 PolarHBondContact O-N 3.28Å
4	G	63	Low	62.7	Low	76 Å²	76	160.9 Å²	160.9	78%	0.784	87%	0.871	S	S	*	*			trans	-75.8	128.9	175.4	0	0	0	0	0	111.4
5	S	66.9	Low	62.4	Low	118 Å²	118	156.1 Å²	156.1	83%	0.825	88%	0.875	S	S	*	*			trans	-87.6	115.6	167.7	54.2	0	0	0	0	109.7	K7	S5-K7 PolarHBondContact O-N 3.06Å
6	K	69.8	Low	61.9	Low	194 Å²	194	151.6 Å²	151.6	84%	0.843	86%	0.857	S	S	*	*			trans	-55.8	123.3	171.9	-76.2	171.6	175.7	173.8	0	109.3	F8	K6-F8 PolarHBondContact O-N 3.15Å; K6-F8 VanDerWaalsContact O-N 3.16Å
7	K	66.7	Low	61.8	Low	205 Å²	205	155.2 Å²	155.2	89%	0.891	86%	0.861	S	S	*	*			trans	-69.8	106.9	170.2	-60.4	-164.9	-175.2	-172.8	0	108.6	S5 K9	S5-K7 PolarHBondContact O-N 3.06Å; K7-K9 PolarHBondContact O-N 2.87Å
8	F	64.6	Low	61.4	Low	200 Å²	200	156.2 Å²	156.2	88%	0.877	86%	0.855	S	S	*	*			trans	-59.5	118.3	168.3	-79.9	-92.5	0	0	0	108.6	K6 A10	K6-F8 PolarHBondContact O-N 3.15Å; K6-F8 VanDerWaalsContact O-N 3.16Å; F8-A10 PolarHBondContact O-N 3.17Å
9	K	63.9	Low	61.1	Low	200 Å²	200	157.4 Å²	157.4	87%	0.87	85%	0.853	S	S	*	*			trans	-68.4	118.6	162.9	-72.7	-150.2	179.6	-175.6	0	106.8	K7 Q11	K7-K9 PolarHBondContact O-N 2.87Å; K9-Q11 PolarHBondContact O-N 3.16Å
10	A	66.1	Low	61	Low	93 Å²	93	159.1 Å²	159.1	77%	0.769	86%	0.855	S	S	*	*			trans	-60.7	100.2	171.5	0	0	0	0	0	109	F8 R12	F8-A10 PolarHBondContact O-N 3.17Å; A10-R12 PolarHBondContact O-N 3.12Å; A10-R12 VanDerWaalsContact O-N 3.15Å
11	Q	63.2	Low	60.8	Low	188 Å²	188	159.5 Å²	159.5	88%	0.879	85%	0.852	S	S	*	*			trans	-76.1	95.7	167.8	-174.4	173.4	-63.4	0	0	107.1	K9	K9-Q11 PolarHBondContact O-N 3.16Å
12	R	67.3	Low	61.5	Low	226 Å²	226	155.1 Å²	155.1	85%	0.853	83%	0.833	S	S	*	*			trans	-70.4	124.7	168.7	-71.7	-179.8	171.5	171.1	-2.9	108.4	A10 G14	A10-R12 PolarHBondContact O-N 3.12Å; A10-R12 VanDerWaalsContact O-N 3.15Å; R12-G14 PolarHBondContact O-N 2.77Å
13	P	57.8	Low	61.4	Low	135 Å²	135	158.1 Å²	158.1	88%	0.877	83%	0.826	S	S	*	*	S	Bend	trans	-77.3	110.8	173.8	31.1	-29	0	0	0	107.8
14	G	52.6	Low	61.5	Low	67 Å²	67	157.8 Å²	157.8	69%	0.691	82%	0.824	S	S	*	*			trans	165.3	51.4	-177.1	0	0	0	0	0	113	R12 S16	R12-G14 PolarHBondContact O-N 2.77Å; G14-S16 PolarHBondContact O-N 3.28Å
15	G	57.5	Low	61.8	Low	90 Å²	90	163.2 Å²	163.2	93%	0.928	83%	0.826	S	S	*	*			trans	-69.1	96.3	167.9	0	0	0	0	0	110.1
16	S	55	Low	62.2	Low	84 Å²	84	160 Å²	160	59%	0.587	81%	0.811	S	S	*	*			trans	-121.5	102.2	151.2	69.2	0	0	0	0	107.5	G14 K18	G14-S16 PolarHBondContact O-N 3.28Å; S16-K18 PolarHBondContact O-N 2.7Å
17	K	59.5	Low	62.7	Low	213 Å²	213	155.5 Å²	155.5	93%	0.926	80%	0.802	S	S	*	*			trans	-63.2	77.1	157.8	-75.1	179.6	-178.7	173.2	0	106.7	H19	K17-H19 PolarHBondContact O-N 3.29Å; K17-H19 VanDerWaalsContact O-N 3.12Å
18	K	55.5	Low	63.4	Low	173 Å²	173	154 Å²	154	75%	0.752	80%	0.795	S	S	*	*			trans	-62.9	116.7	162.5	-71.6	-162.8	179.3	-174	0	104.9	S16 Q20	S16-K18 PolarHBondContact O-N 2.7Å; K18-Q20 PolarHBondContact O-N 3.02Å
19	H	55.6	Low	64.2	Low	179 Å²	179	154.9 Å²	154.9	83%	0.829	80%	0.799	S	S	*	*			trans	-37.2	119.1	162.6	-93.7	-103.3	0	0	0	106.8	K17 Q21	K17-H19 PolarHBondContact O-N 3.29Å; K17-H19 VanDerWaalsContact O-N 3.12Å; H19-Q21 PolarHBondContact O-N 3.49Å
20	Q	57.7	Low	65	Low	191 Å²	191	149.3 Å²	149.3	89%	0.893	80%	0.798	S	S	*	*			trans	-58.4	99	173.4	-72.6	-151.9	-15.6	0	0	105.9	K18 N22	K18-Q20 PolarHBondContact O-N 3.02Å; Q20-N22 PolarHBondContact O-N 3.05Å
21	Q	58	Low	65.9	Low	168 Å²	168	147 Å²	147	79%	0.785	78%	0.783	S	S	*	*			trans	-50.3	121.6	163	-71.6	-177.8	-24.1	0	0	104.3	H19 K23	H19-Q21 PolarHBondContact O-N 3.49Å; Q21-K23 PolarHBondContact O-N 3.05Å
22	N	59.9	Low	66.8	Low	150 Å²	150	150.1 Å²	150.1	80%	0.802	79%	0.787	S	S	*	*			trans	-59.6	75.8	178.1	-171.7	10.5	0	0	0	107.8	Q20 Q24	Q20-N22 PolarHBondContact O-N 3.05Å; N22-Q24 PolarHBondContact O-N 2.62Å
23	K	62.3	Low	67.6	Low	176 Å²	176	144.8 Å²	144.8	77%	0.765	77%	0.774	S	S	*	*			trans	-58.6	115.3	167.4	-78.1	-176.9	176	-177.4	0	103.3	Q21 K25	Q21-K23 PolarHBondContact O-N 3.05Å; K23-K25 VanDerWaalsContact C-N 3.28Å; K23-K25 PolarHBondContact O-N 2.73Å
24	Q	67.6	Low	68.9	Low	187 Å²	187	142.6 Å²	142.6	87%	0.874	75%	0.754	S	S	*	*			trans	-51	102.4	175.1	-68.7	-175.4	-5.9	0	0	106.3	N22 G26	N22-Q24 PolarHBondContact O-N 2.62Å; Q24-G26 PolarHBondContact O-N 3Å
25	K	71	Confident	70.6	Confident	191 Å²	191	141.9 Å²	141.9	83%	0.83	74%	0.742	S	S	*	*			trans	-55.9	119.8	174.8	-79.5	176.5	177.8	175.7	0	103.9	K23	K23-K25 VanDerWaalsContact C-N 3.28Å; K23-K25 PolarHBondContact O-N 2.73Å
26	G	74.1	Confident	72	Confident	50 Å²	50	143.2 Å²	143.2	52%	0.515	73%	0.734	S	S	.	*			trans	-52.3	167.9	177.5	0	0	0	0	0	110.6	Q24 K28	Q24-G26 PolarHBondContact O-N 3Å; G26-K28 PolarHBondContact O-N 3.04Å
27	P	80.3	Confident	73.8	Confident	99 Å²	99	148.1 Å²	148.1	64%	0.643	75%	0.745	S	S	*	*			trans	-40.5	118.5	-179.3	-28	33.9	0	0	0	111.4	K29 I33	P27-K29 PolarHBondContact O-N 3.06Å; P27-I33 HydrophobicContact CB-CD1 3.32Å; P27-I33 HydrophobicContact CG-CD1 3.3Å
28	K	82	Confident	75.3	Confident	174 Å²	174	144.4 Å²	144.4	76%	0.757	73%	0.728	S	S	*	*			trans	-57.5	138.4	174.4	-69	-174.9	178	-178.5	0	107.6	G26 G30 G31	G26-K28 PolarHBondContact O-N 3.04Å; K28-G30 PolarHBondContact O-N 3.36Å; K28-G30 VanDerWaalsContact O-N 3.11Å; K28-G31 PolarHBondContact O-N 2.8Å
29	K	80.6	Confident	77	Confident	219 Å²	219	137.5 Å²	137.5	95%	0.952	70%	0.704	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.4	121.6	175.7	-171	177.7	-179.1	-179.5	0	109	P27	P27-K29 PolarHBondContact O-N 3.06Å
30	G	82.4	Confident	78.8	Confident	83 Å²	83	135.2 Å²	135.2	86%	0.856	69%	0.693	S	S	*	*	T	Hydrogen-bonded Turn	trans	88.4	-1.7	-175.5	0	0	0	0	0	116.4	K28 R32	K28-G30 PolarHBondContact O-N 3.36Å; K28-G30 VanDerWaalsContact O-N 3.11Å; G30-R32 PolarHBondContact O-N 3.23Å
31	G	83.5	Confident	80.6	Confident	44 Å²	44	129 Å²	129	45%	0.454	67%	0.669	S	S	.	*			trans	-74.9	121	176.5	0	0	0	0	0	112.1	K28 I33	K28-G31 PolarHBondContact O-N 2.8Å; G31-I33 PolarHBondContact O-N 3.09Å
32	R	82.9	Confident	82.4	Confident	254 Å²	254	122.9 Å²	122.9	96%	0.958	64%	0.643	S	S	*	*			trans	-74	120.2	170.3	-70.4	-177	-126.3	174.3	0.7	109.4	G30	G30-R32 PolarHBondContact O-N 3.23Å
33	I	83.1	Confident	84	Confident	114 Å²	114	121.9 Å²	121.9	59%	0.585	63%	0.633	S	S	*	*			trans	-114.4	138.9	177.5	-65.6	179	0	0	0	109.2	P27 G31 A35	P27-I33 HydrophobicContact CB-CD1 3.32Å; P27-I33 HydrophobicContact CG-CD1 3.3Å; G31-I33 PolarHBondContact O-N 3.09Å; I33-A35 PolarHBondContact O-N 3.39Å
34	I	86.7	Confident	85.6	Confident	89 Å²	89	119.4 Å²	119.4	46%	0.456	62%	0.624	S	S	.	*			trans	-75.7	121.9	174.5	-56.2	168.9	0	0	0	107.2	K38 A39 V42	I34-K38 HydrophobicContact CG2-CB 3.75Å; I34-A39 HydrophobicContact CG2-CB 4.24Å; I34-V42 HydrophobicContact CD1-CB 4.38Å; I34-V42 HydrophobicContact CD1-CG1 4.03Å; I34-V42 HydrophobicContact CD1-CG2 4.31Å; I34-V42 HydrophobicContact CG2-CG2 4.25Å
35	A	87.7	Confident	87	Confident	52 Å²	52	116.2 Å²	116.2	43%	0.43	61%	0.609	S	S	.	*			trans	-54.5	141.3	173.5	0	0	0	0	0	110	I33 K37 K38 A39	I33-A35 PolarHBondContact O-N 3.39Å; A35-K37 PolarHBondContact O-N 3.41Å; A35-K38 HydrophobicContact CB-CG 4.43Å; A35-K38 WeakPolarHBondContact O-CA 3.37Å; A35-K38 PolarHBondContact O-N 3.38Å; A35-A39 PolarHBondContact O-N 2.81Å; A35-A39 VanDerWaalsContact O-N 3.09Å
36	P	86.9	Confident	88.2	Confident	117 Å²	117	114.1 Å²	114.1	76%	0.76	60%	0.6	S	S	*	*	H	α-helix	trans	-50.7	-39.7	-176.6	-29.3	34.6	0	0	0	113.6	K38 A39	P36-K38 VanDerWaalsContact C-N 3.32Å; P36-K38 PolarHBondContact O-N 2.91Å; P36-A39 WeakPolarHBondContact O-CB 3.31Å; P36-A39 PolarHBondContact O-N 3.11Å
37	K	91.6	Very high	89.3	Confident	188 Å²	188	117.1 Å²	117.1	82%	0.817	60%	0.604	S	S	*	*	H	α-helix	trans	-63.7	-30.7	176.1	-67.3	-174.9	176	-177.8	0	114.1	A35	A35-K37 PolarHBondContact O-N 3.41Å
38	K	92.8	Very high	90.2	Very high	134 Å²	134	119.2 Å²	119.2	58%	0.583	60%	0.603	S	S	*	*	H	α-helix	trans	-88.5	-15.6	178.6	-62.9	-62.5	-174.6	-178.2	0	112.4	I34 A35 P36 Q40 V41 V42	I34-K38 HydrophobicContact CG2-CB 3.75Å; A35-K38 HydrophobicContact CB-CG 4.43Å; A35-K38 WeakPolarHBondContact O-CA 3.37Å; A35-K38 PolarHBondContact O-N 3.38Å; P36-K38 VanDerWaalsContact C-N 3.32Å; P36-K38 PolarHBondContact O-N 2.91Å; K38-Q40 VanDerWaalsContact C-N 3.34Å; K38-Q40 PolarHBondContact O-N 3.5Å; K38-V41 PolarHBondContact O-N 3.24Å; K38-V42 WeakPolarHBondContact O-CG2 3.45Å; K38-V42 PolarHBondContact O-N 3.42Å
39	A	91.4	Very high	90.9	Very high	29 Å²	29	118 Å²	118	24%	0.24	60%	0.597	C	S	.	*	H	α-helix	trans	-60.7	-43.3	-179.6	0	0	0	0	0	112	I34 A35 P36 V42 Q43	I34-A39 HydrophobicContact CG2-CB 4.24Å; A35-A39 PolarHBondContact O-N 2.81Å; A35-A39 VanDerWaalsContact O-N 3.09Å; P36-A39 WeakPolarHBondContact O-CB 3.31Å; P36-A39 PolarHBondContact O-N 3.11Å; A39-V42 PolarHBondContact O-N 3.34Å; A39-Q43 VanDerWaalsContact O-CG 3.31Å; A39-Q43 WeakPolarHBondContact O-CG 3.46Å; A39-Q43 PolarHBondContact O-N 2.91Å
40	Q	93.1	Very high	91.7	Very high	130 Å²	130	109.6 Å²	109.6	61%	0.607	57%	0.573	S	S	*	*	H	α-helix	trans	-61.5	-46.4	176.9	-67.7	-179.2	-11.4	0	0	111.8	K38 V42 Q43 Q44	K38-Q40 VanDerWaalsContact C-N 3.34Å; K38-Q40 PolarHBondContact O-N 3.5Å; Q40-V42 VanDerWaalsContact C-N 3.34Å; Q40-V42 PolarHBondContact O-N 2.97Å; Q40-Q43 PolarHBondContact O-N 3.29Å; Q40-Q44 VanDerWaalsContact O-CG 3.3Å; Q40-Q44 WeakPolarHBondContact O-CG 3.36Å; Q40-Q44 PolarHBondContact O-N 3.16Å
41	V	95	Very high	92.5	Very high	62 Å²	62	110.4 Å²	110.4	38%	0.376	56%	0.557	S	S	.	*	H	α-helix	trans	-61.4	-43.2	178.1	179.6	0	0	0	0	111.2	K38 Q43 Q44 Q45	K38-V41 PolarHBondContact O-N 3.24Å; V41-Q43 PolarHBondContact O-N 3.43Å; V41-Q44 PolarHBondContact O-N 3.41Å; V41-Q45 HydrophobicContact CG1-CG 4.47Å; V41-Q45 WeakPolarHBondContact O-CB 3.3Å; V41-Q45 VanDerWaalsContact O-CG 3.3Å; V41-Q45 WeakPolarHBondContact O-CG 3.3Å; V41-Q45 PolarHBondContact O-N 2.94Å
42	V	94.8	Very high	93.1	Very high	39 Å²	39	112.1 Å²	112.1	24%	0.236	55%	0.553	C	S	.	*	H	α-helix	trans	-65.1	-39.9	177.7	172.2	0	0	0	0	111.6	I34 K38 A39 Q40 Q45 K46	I34-V42 HydrophobicContact CD1-CB 4.38Å; I34-V42 HydrophobicContact CD1-CG1 4.03Å; I34-V42 HydrophobicContact CD1-CG2 4.31Å; I34-V42 HydrophobicContact CG2-CG2 4.25Å; K38-V42 WeakPolarHBondContact O-CG2 3.45Å; K38-V42 PolarHBondContact O-N 3.42Å; A39-V42 PolarHBondContact O-N 3.34Å; Q40-V42 VanDerWaalsContact C-N 3.34Å; Q40-V42 PolarHBondContact O-N 2.97Å; V42-Q45 PolarHBondContact O-N 2.95Å; V42-K46 HydrophobicContact CG1-CD 4.3Å; V42-K46 VanDerWaalsContact O-CG 3.31Å; V42-K46 WeakPolarHBondContact O-CG 3.49Å; V42-K46 PolarHBondContact O-N 2.95Å
43	Q	94.5	Very high	93.7	Very high	128 Å²	128	103.3 Å²	103.3	60%	0.598	53%	0.528	S	S	*	.	H	α-helix	trans	-63.4	-46.1	175.5	-73.7	172.6	1.1	0	0	111.4	A39 Q40 V41 Q45 K46 L47	A39-Q43 VanDerWaalsContact O-CG 3.31Å; A39-Q43 WeakPolarHBondContact O-CG 3.46Å; A39-Q43 PolarHBondContact O-N 2.91Å; Q40-Q43 PolarHBondContact O-N 3.29Å; V41-Q43 PolarHBondContact O-N 3.43Å; Q43-Q45 PolarHBondContact O-N 3.41Å; Q43-K46 PolarHBondContact O-N 2.92Å; Q43-L47 WeakPolarHBondContact O-CB 3.31Å; Q43-L47 PolarHBondContact O-N 3.47Å
44	Q	96.1	Very high	94.4	Very high	124 Å²	124	100.5 Å²	100.5	58%	0.579	52%	0.522	S	S	*	.	H	α-helix	trans	-60.4	-43.3	176.1	-70.3	171.5	27.5	0	0	111.8	Q40 V41 K46 L47 K48	Q40-Q44 VanDerWaalsContact O-CG 3.3Å; Q40-Q44 WeakPolarHBondContact O-CG 3.36Å; Q40-Q44 PolarHBondContact O-N 3.16Å; V41-Q44 PolarHBondContact O-N 3.41Å; Q44-K46 PolarHBondContact O-N 3.5Å; Q44-L47 PolarHBondContact O-N 3.47Å; Q44-K48 WeakPolarHBondContact O-CB 3.35Å; Q44-K48 PolarHBondContact O-N 2.92Å
45	Q	96.9	Very high	94.9	Very high	121 Å²	121	100.9 Å²	100.9	57%	0.565	52%	0.524	S	S	*	.	H	α-helix	trans	-63.8	-40.2	177.1	-75.6	177.1	-5.8	0	0	112.5	V41 V42 Q43 K48 K49	V41-Q45 HydrophobicContact CG1-CG 4.47Å; V41-Q45 WeakPolarHBondContact O-CB 3.3Å; V41-Q45 VanDerWaalsContact O-CG 3.3Å; V41-Q45 WeakPolarHBondContact O-CG 3.3Å; V41-Q45 PolarHBondContact O-N 2.94Å; V42-Q45 PolarHBondContact O-N 2.95Å; Q43-Q45 PolarHBondContact O-N 3.41Å; Q45-K48 PolarHBondContact O-N 3.45Å; Q45-K49 WeakPolarHBondContact O-CB 3.46Å; Q45-K49 PolarHBondContact O-N 3.3Å
46	K	96.3	Very high	95.3	Very high	147 Å²	147	105.1 Å²	105.1	64%	0.639	53%	0.529	S	S	*	.	H	α-helix	trans	-62.4	-45.2	174.7	-75.4	175.5	178.7	-176.5	0	111.3	V42 Q43 Q44 K49 G50	V42-K46 HydrophobicContact CG1-CD 4.3Å; V42-K46 VanDerWaalsContact O-CG 3.31Å; V42-K46 WeakPolarHBondContact O-CG 3.49Å; V42-K46 PolarHBondContact O-N 2.95Å; Q43-K46 PolarHBondContact O-N 2.92Å; Q44-K46 PolarHBondContact O-N 3.5Å; K46-K49 PolarHBondContact O-N 3.26Å; K46-G50 PolarHBondContact O-N 3.45Å
47	L	97.6	Very high	95.6	Very high	112 Å²	112	103.2 Å²	103.2	59%	0.586	51%	0.512	S	S	*	.	H	α-helix	trans	-61.2	-50.7	176.5	-174.3	158.7	0	0	0	110.5	Q43 Q44 K49 G50 L51	Q43-L47 WeakPolarHBondContact O-CB 3.31Å; Q43-L47 PolarHBondContact O-N 3.47Å; Q44-L47 PolarHBondContact O-N 3.47Å; L47-K49 PolarHBondContact O-N 2.81Å; L47-G50 PolarHBondContact O-N 3.48Å; L47-G50 VanDerWaalsContact O-N 3.16Å; L47-L51 HydrophobicContact CD2-CD1 3.44Å; L47-L51 VanDerWaalsContact CD2-CD1 3.44Å; L47-L51 HydrophobicContact CD2-CG 4Å; L47-L51 HydrophobicContact CG-CD1 4.45Å; L47-L51 WeakPolarHBondContact O-CG 2.86Å; L47-L51 PolarHBondContact O-N 3Å
48	K	97.8	Very high	95.8	Very high	144 Å²	144	100.3 Å²	100.3	63%	0.626	50%	0.499	S	S	*	.	H	α-helix	trans	-54.4	-51.5	177.5	-178.7	-178.3	175.6	-178.9	0	111.4	Q44 Q45 G50 L51 E52	Q44-K48 WeakPolarHBondContact O-CB 3.35Å; Q44-K48 PolarHBondContact O-N 2.92Å; Q45-K48 PolarHBondContact O-N 3.45Å; K48-G50 VanDerWaalsContact C-N 3.32Å; K48-G50 PolarHBondContact O-N 3.49Å; K48-L51 PolarHBondContact O-N 3.21Å; K48-E52 VanDerWaalsContact O-CB 3.25Å; K48-E52 WeakPolarHBondContact O-CB 3.24Å; K48-E52 PolarHBondContact O-N 3.03Å
49	K	97.9	Very high	95.9	Very high	147 Å²	147	98.2 Å²	98.2	64%	0.639	49%	0.494	S	S	*	.	H	α-helix	trans	-62.3	-39.3	179.6	-174	175.8	-177.7	174.1	0	112.1	Q45 K46 L47 V53	Q45-K49 WeakPolarHBondContact O-CB 3.46Å; Q45-K49 PolarHBondContact O-N 3.3Å; K46-K49 PolarHBondContact O-N 3.26Å; L47-K49 PolarHBondContact O-N 2.81Å; K49-V53 VanDerWaalsContact O-CG2 3.31Å; K49-V53 WeakPolarHBondContact O-CG2 3.35Å; K49-V53 PolarHBondContact O-N 2.85Å; K49-V53 VanDerWaalsContact O-N 3.15Å
50	G	97.3	Very high	95.9	Very high	43 Å²	43	101.5 Å²	101.5	44%	0.443	50%	0.504	S	S	.	.	H	α-helix	trans	-63.1	-49.3	177.1	0	0	0	0	0	112.2	K46 L47 K48 A54	K46-G50 PolarHBondContact O-N 3.45Å; L47-G50 PolarHBondContact O-N 3.48Å; L47-G50 VanDerWaalsContact O-N 3.16Å; K48-G50 VanDerWaalsContact C-N 3.32Å; K48-G50 PolarHBondContact O-N 3.49Å; G50-A54 WeakPolarHBondContact O-CB 3.43Å; G50-A54 PolarHBondContact O-N 3.5Å
51	L	98.1	Very high	95.8	Very high	100 Å²	100	101.7 Å²	101.7	52%	0.524	51%	0.505	S	S	.	.	H	α-helix	trans	-64.9	-43.4	178.2	-67.2	-175.2	0	0	0	112	L47 K48 V53 A54 I55	L47-L51 HydrophobicContact CD2-CD1 3.44Å; L47-L51 VanDerWaalsContact CD2-CD1 3.44Å; L47-L51 HydrophobicContact CD2-CG 4Å; L47-L51 HydrophobicContact CG-CD1 4.45Å; L47-L51 WeakPolarHBondContact O-CG 2.86Å; L47-L51 PolarHBondContact O-N 3Å; K48-L51 PolarHBondContact O-N 3.21Å; L51-V53 PolarHBondContact O-N 3.43Å; L51-A54 PolarHBondContact O-N 3.37Å; L51-I55 WeakPolarHBondContact O-CB 3.39Å; L51-I55 VanDerWaalsContact O-CG1 3.24Å; L51-I55 WeakPolarHBondContact O-CG1 3.25Å; L51-I55 PolarHBondContact O-N 2.89Å
52	E	97	Very high	95.7	Very high	80 Å²	80	103.5 Å²	103.5	37%	0.374	51%	0.509	S	S	.	.	H	α-helix	trans	-58.9	-46.4	179.5	-177.9	176.1	176.1	0	0	111.9	K48 I55 R56	K48-E52 VanDerWaalsContact O-CB 3.25Å; K48-E52 WeakPolarHBondContact O-CB 3.24Å; K48-E52 PolarHBondContact O-N 3.03Å; E52-I55 PolarHBondContact O-N 3.45Å; E52-R56 VanDerWaalsContact O-CG 3.3Å; E52-R56 WeakPolarHBondContact O-CG 3.38Å; E52-R56 PolarHBondContact O-N 2.93Å; E52-R56 IonicContact OE1-CZ 3.36Å; E52-R56 IonicContact OE1-NE 3.67Å; E52-R56 IonicContact OE1-NH2 3.68Å; E52-R56 PolarHBondContact OE1-NH2 3.41Å
53	V	95.9	Very high	95.6	Very high	70 Å²	70	105.9 Å²	105.9	42%	0.424	52%	0.524	S	S	.	.	H	α-helix	trans	-65.7	-42.1	176.4	173.1	0	0	0	0	111.1	K49 L51 I55 R56 N57	K49-V53 VanDerWaalsContact O-CG2 3.31Å; K49-V53 WeakPolarHBondContact O-CG2 3.35Å; K49-V53 PolarHBondContact O-N 2.85Å; K49-V53 VanDerWaalsContact O-N 3.15Å; L51-V53 PolarHBondContact O-N 3.43Å; V53-I55 PolarHBondContact O-N 3.28Å; V53-R56 PolarHBondContact O-N 3.32Å; V53-N57 WeakPolarHBondContact O-CB 3.45Å; V53-N57 PolarHBondContact O-N 3.21Å; V53-N57 PolarHBondContact O-ND2 2.99Å; V53-N57 PolarHBondContact O-OD1 3.15Å
54	A	96.8	Very high	95.4	Very high	55 Å²	55	101.4 Å²	101.4	46%	0.455	51%	0.505	S	S	.	.	H	α-helix	trans	-63.3	-41.9	179	0	0	0	0	0	112.4	G50 L51 N57 K58	G50-A54 WeakPolarHBondContact O-CB 3.43Å; G50-A54 PolarHBondContact O-N 3.5Å; L51-A54 PolarHBondContact O-N 3.37Å; A54-N57 PolarHBondContact O-N 2.95Å; A54-K58 WeakPolarHBondContact O-CB 3.48Å; A54-K58 PolarHBondContact O-N 3.04Å
55	I	97	Very high	95.2	Very high	97 Å²	97	102.3 Å²	102.3	50%	0.497	51%	0.509	S	S	.	.	H	α-helix	trans	-64.8	-47.4	177.4	-69.4	165.4	0	0	0	110.4	L51 E52 V53 N57 K58 I59	L51-I55 WeakPolarHBondContact O-CB 3.39Å; L51-I55 VanDerWaalsContact O-CG1 3.24Å; L51-I55 WeakPolarHBondContact O-CG1 3.25Å; L51-I55 PolarHBondContact O-N 2.89Å; E52-I55 PolarHBondContact O-N 3.45Å; V53-I55 PolarHBondContact O-N 3.28Å; I55-N57 PolarHBondContact O-N 3.35Å; I55-K58 PolarHBondContact O-N 3.43Å; I55-I59 HydrophobicContact CG2-CD1 3.7Å; I55-I59 HydrophobicContact CG2-CG1 4.39Å; I55-I59 WeakPolarHBondContact O-CG1 3.31Å; I55-I59 PolarHBondContact O-N 3.42Å
56	R	96	Very high	94.9	Very high	141 Å²	141	104.4 Å²	104.4	53%	0.532	52%	0.516	S	S	.	.	H	α-helix	trans	-56.8	-49.6	176.6	-72.2	176	-172.7	-162.3	0.9	111.3	E52 V53 K58 I59 E60	E52-R56 VanDerWaalsContact O-CG 3.3Å; E52-R56 WeakPolarHBondContact O-CG 3.38Å; E52-R56 PolarHBondContact O-N 2.93Å; E52-R56 IonicContact OE1-CZ 3.36Å; E52-R56 IonicContact OE1-NE 3.67Å; E52-R56 IonicContact OE1-NH2 3.68Å; E52-R56 PolarHBondContact OE1-NH2 3.41Å; V53-R56 PolarHBondContact O-N 3.32Å; R56-K58 VanDerWaalsContact C-N 3.31Å; R56-K58 PolarHBondContact O-N 3.41Å; R56-I59 PolarHBondContact O-N 2.9Å; R56-E60 WeakPolarHBondContact O-CB 3.34Å; R56-E60 WeakPolarHBondContact O-CG 3.3Å; R56-E60 PolarHBondContact O-N 3.31Å
57	N	93.5	Very high	94.6	Very high	76 Å²	76	99 Å²	99	41%	0.406	50%	0.499	S	S	.	.	H	α-helix	trans	-60.4	-40.3	178.4	-68.2	-9.4	0	0	0	112.3	V53 A54 I55 E60 Q61	V53-N57 WeakPolarHBondContact O-CB 3.45Å; V53-N57 PolarHBondContact O-N 3.21Å; V53-N57 PolarHBondContact O-ND2 2.99Å; V53-N57 PolarHBondContact O-OD1 3.15Å; A54-N57 PolarHBondContact O-N 2.95Å; I55-N57 PolarHBondContact O-N 3.35Å; N57-E60 PolarHBondContact O-N 3.45Å; N57-Q61 WeakPolarHBondContact O-CB 3.35Å; N57-Q61 VanDerWaalsContact O-CG 3.25Å; N57-Q61 WeakPolarHBondContact O-CG 3.25Å; N57-Q61 PolarHBondContact O-N 3.49Å
58	K	95.7	Very high	94.2	Very high	128 Å²	128	95 Å²	95	56%	0.557	48%	0.481	S	S	*	.	H	α-helix	trans	-65.7	-45.5	178.8	-175.4	171.8	175.8	176.8	0	111.4	A54 I55 R56 Q61 E62	A54-K58 WeakPolarHBondContact O-CB 3.48Å; A54-K58 PolarHBondContact O-N 3.04Å; I55-K58 PolarHBondContact O-N 3.43Å; R56-K58 VanDerWaalsContact C-N 3.31Å; R56-K58 PolarHBondContact O-N 3.41Å; K58-Q61 PolarHBondContact O-N 2.64Å; K58-E62 WeakPolarHBondContact CE-OE1 3.36Å; K58-E62 HydrophobicContact CG-CG 4.46Å; K58-E62 IonicContact NZ-OE1 3.88Å; K58-E62 WeakPolarHBondContact O-CB 3.47Å; K58-E62 WeakPolarHBondContact O-CG 3.35Å; K58-E62 PolarHBondContact O-N 2.87Å
59	I	94.8	Very high	93.7	Very high	90 Å²	90	92.9 Å²	92.9	46%	0.462	48%	0.484	S	S	.	.	H	α-helix	trans	-60.7	-46.8	176.1	-67.9	168.3	0	0	0	110.3	I55 R56 Q61 E62 V63	I55-I59 HydrophobicContact CG2-CD1 3.7Å; I55-I59 HydrophobicContact CG2-CG1 4.39Å; I55-I59 WeakPolarHBondContact O-CG1 3.31Å; I55-I59 PolarHBondContact O-N 3.42Å; R56-I59 PolarHBondContact O-N 2.9Å; I59-Q61 VanDerWaalsContact C-N 3.31Å; I59-Q61 PolarHBondContact O-N 3.3Å; I59-E62 PolarHBondContact O-N 3.37Å; I59-V63 HydrophobicContact CG2-CG2 4.04Å; I59-V63 WeakPolarHBondContact O-CB 3.22Å; I59-V63 VanDerWaalsContact O-CG2 3.22Å; I59-V63 WeakPolarHBondContact O-CG2 3.32Å; I59-V63 PolarHBondContact O-N 2.68Å
60	E	90.9	Very high	93.3	Very high	98 Å²	98	90.7 Å²	90.7	46%	0.458	49%	0.487	S	S	.	.	H	α-helix	trans	-58.3	-43	178.3	-75.4	173.1	-164.6	0	0	112.1	R56 N57 T64	R56-E60 WeakPolarHBondContact O-CB 3.34Å; R56-E60 WeakPolarHBondContact O-CG 3.3Å; R56-E60 PolarHBondContact O-N 3.31Å; N57-E60 PolarHBondContact O-N 3.45Å; E60-T64 VanDerWaalsContact O-CB 3.26Å; E60-T64 WeakPolarHBondContact O-CB 3.35Å; E60-T64 PolarHBondContact O-N 2.92Å; E60-T64 PolarHBondContact O-OG1 2.84Å
61	Q	91.5	Very high	92.7	Very high	134 Å²	134	92.9 Å²	92.9	63%	0.626	49%	0.488	S	S	*	.	H	α-helix	trans	-64.6	-50.1	176.2	-73.7	173.8	5.7	0	0	111.9	N57 K58 I59 V63 T64 Q65	N57-Q61 WeakPolarHBondContact O-CB 3.35Å; N57-Q61 VanDerWaalsContact O-CG 3.25Å; N57-Q61 WeakPolarHBondContact O-CG 3.25Å; N57-Q61 PolarHBondContact O-N 3.49Å; K58-Q61 PolarHBondContact O-N 2.64Å; I59-Q61 VanDerWaalsContact C-N 3.31Å; I59-Q61 PolarHBondContact O-N 3.3Å; Q61-V63 PolarHBondContact O-N 3.49Å; Q61-T64 PolarHBondContact O-N 3.02Å; Q61-Q65 WeakPolarHBondContact O-CB 3.5Å; Q61-Q65 PolarHBondContact O-N 3.49Å
62	E	93.6	Very high	92.2	Very high	100 Å²	100	97 Å²	97	47%	0.467	51%	0.505	S	S	.	.	H	α-helix	trans	-62.7	-43.7	-178.6	-74.4	177.8	-179.5	0	0	112	K58 I59 Q65 K66	K58-E62 WeakPolarHBondContact CE-OE1 3.36Å; K58-E62 HydrophobicContact CG-CG 4.46Å; K58-E62 IonicContact NZ-OE1 3.88Å; K58-E62 WeakPolarHBondContact O-CB 3.47Å; K58-E62 WeakPolarHBondContact O-CG 3.35Å; K58-E62 PolarHBondContact O-N 2.87Å; I59-E62 PolarHBondContact O-N 3.37Å; E62-Q65 PolarHBondContact O-N 2.91Å; E62-K66 WeakPolarHBondContact O-CB 3.21Å; E62-K66 PolarHBondContact O-N 3.39Å
63	V	92.1	Very high	91.9	Very high	89 Å²	89	100.1 Å²	100.1	54%	0.539	52%	0.517	S	S	.	.	H	α-helix	trans	-64.7	-43.2	177.4	171.8	0	0	0	0	110.5	I59 Q61 K66 A67	I59-V63 HydrophobicContact CG2-CG2 4.04Å; I59-V63 WeakPolarHBondContact O-CB 3.22Å; I59-V63 VanDerWaalsContact O-CG2 3.22Å; I59-V63 WeakPolarHBondContact O-CG2 3.32Å; I59-V63 PolarHBondContact O-N 2.68Å; Q61-V63 PolarHBondContact O-N 3.49Å; V63-K66 PolarHBondContact O-N 3.19Å; V63-A67 VanDerWaalsContact O-CB 3.29Å; V63-A67 WeakPolarHBondContact O-CB 3.13Å; V63-A67 PolarHBondContact O-N 3.36Å
64	T	90.6	Very high	91.3	Very high	34 Å²	34	101.6 Å²	101.6	21%	0.209	53%	0.528	C	S	.	.	H	α-helix	trans	-65.3	-40.8	177.6	-57.2	0	0	0	0	111.6	E60 Q61 A67 S68 L75 V77	E60-T64 VanDerWaalsContact O-CB 3.26Å; E60-T64 WeakPolarHBondContact O-CB 3.35Å; E60-T64 PolarHBondContact O-N 2.92Å; E60-T64 PolarHBondContact O-OG1 2.84Å; Q61-T64 PolarHBondContact O-N 3.02Å; T64-A67 PolarHBondContact O-N 3.01Å; T64-S68 WeakPolarHBondContact O-CB 3.26Å; T64-S68 PolarHBondContact O-N 3.1Å; T64-S68 PolarHBondContact O-OG 2.76Å; T64-L75 HydrophobicContact CG2-CB 4.33Å; T64-V77 HydrophobicContact CG2-CG2 3.71Å; T64-V77 WeakPolarHBondContact OG1-CG2 3.25Å
65	Q	90.8	Very high	90.7	Very high	143 Å²	143	103.1 Å²	103.1	67%	0.668	53%	0.528	S	S	*	.	H	α-helix	trans	-63.1	-48.1	176.9	-173.8	178.2	8.6	0	0	110.8	Q61 E62 A67 S68 S69	Q61-Q65 WeakPolarHBondContact O-CB 3.5Å; Q61-Q65 PolarHBondContact O-N 3.49Å; E62-Q65 PolarHBondContact O-N 2.91Å; Q65-A67 PolarHBondContact O-N 3.39Å; Q65-S68 PolarHBondContact O-N 3.25Å; Q65-S69 PolarHBondContact O-N 3.39Å; Q65-S69 PolarHBondContact O-OG 2.72Å
66	K	92	Very high	90	Very high	164 Å²	164	102.8 Å²	102.8	71%	0.713	54%	0.54	S	S	*	.	H	α-helix	trans	-60.6	-44.7	177.6	-174.2	176.8	-178.7	179.4	0	111.9	E62 V63 S69 S70	E62-K66 WeakPolarHBondContact O-CB 3.21Å; E62-K66 PolarHBondContact O-N 3.39Å; V63-K66 PolarHBondContact O-N 3.19Å; K66-S69 PolarHBondContact O-N 3.42Å; K66-S69 PolarHBondContact O-OG 3.05Å; K66-S70 PolarHBondContact O-N 3.25Å
67	A	89.8	Confident	89.2	Confident	34 Å²	34	100.2 Å²	100.2	28%	0.281	54%	0.539	S	S	.	.	H	α-helix	trans	-64.8	-42.5	176.6	0	0	0	0	0	111.6	V63 T64 Q65 S69 S70 L71 L75	V63-A67 VanDerWaalsContact O-CB 3.29Å; V63-A67 WeakPolarHBondContact O-CB 3.13Å; V63-A67 PolarHBondContact O-N 3.36Å; T64-A67 PolarHBondContact O-N 3.01Å; Q65-A67 PolarHBondContact O-N 3.39Å; A67-S69 VanDerWaalsContact C-N 3.3Å; A67-S69 PolarHBondContact O-N 2.94Å; A67-S70 PolarHBondContact O-N 2.83Å; A67-S70 VanDerWaalsContact O-N 3.1Å; A67-L71 PolarHBondContact O-N 3.47Å; A67-L71 VanDerWaalsContact O-N 3.1Å; A67-L75 HydrophobicContact CB-CD1 3.76Å
68	S	89.1	Confident	88.6	Confident	28 Å²	28	102.7 Å²	102.7	20%	0.196	56%	0.557	C	S	.	*	H	α-helix	trans	-65.5	-31.8	178.8	-61.4	0	0	0	0	112.8	T64 Q65 S70 L75	T64-S68 WeakPolarHBondContact O-CB 3.26Å; T64-S68 PolarHBondContact O-N 3.1Å; T64-S68 PolarHBondContact O-OG 2.76Å; Q65-S68 PolarHBondContact O-N 3.25Å; S68-S70 VanDerWaalsContact C-N 3.35Å; S68-L75 PolarHBondContact OG-N 3.27Å
69	S	87.6	Confident	87.7	Confident	99 Å²	99	103.3 Å²	103.3	69%	0.692	56%	0.56	S	S	*	*	H	α-helix	trans	-73.9	-24.1	173.2	56.3	0	0	0	0	113.9	Q65 K66 A67	Q65-S69 PolarHBondContact O-N 3.39Å; Q65-S69 PolarHBondContact O-OG 2.72Å; K66-S69 PolarHBondContact O-N 3.42Å; K66-S69 PolarHBondContact O-OG 3.05Å; A67-S69 VanDerWaalsContact C-N 3.3Å; A67-S69 PolarHBondContact O-N 2.94Å
70	S	88.4	Confident	86.6	Confident	102 Å²	102	101.5 Å²	101.5	71%	0.713	56%	0.563	S	S	*	*	H	α-helix	trans	-88.9	-20.7	-179.9	-173.4	0	0	0	0	113.1	K66 A67 S68	K66-S70 PolarHBondContact O-N 3.25Å; A67-S70 PolarHBondContact O-N 2.83Å; A67-S70 VanDerWaalsContact O-N 3.1Å; S68-S70 VanDerWaalsContact C-N 3.35Å
71	L	86.1	Confident	85.1	Confident	88 Å²	88	102.2 Å²	102.2	46%	0.461	59%	0.586	S	S	.	*	S	Bend	trans	-99.7	151.2	-178.3	-119.7	68.4	0	0	0	111	A67 K73 L75	A67-L71 PolarHBondContact O-N 3.47Å; A67-L71 VanDerWaalsContact O-N 3.1Å; L71-K73 PolarHBondContact O-N 3.38Å; L71-L75 HydrophobicContact CD2-CD2 4.09Å; L71-L75 HydrophobicContact CD2-CG 4.45Å
72	H	87.8	Confident	83.5	Confident	187 Å²	187	101.9 Å²	101.9	87%	0.866	58%	0.584	S	S	*	*	S	Bend	trans	-69.4	-10.2	175.3	61.4	-88.1	0	0	0	113.4
73	K	89.5	Confident	81.5	Confident	145 Å²	145	100.6 Å²	100.6	63%	0.63	60%	0.598	S	S	*	*	S	Bend	trans	-134.3	130.7	178.1	-171.7	176.5	-177.8	178.1	0	110	L71	L71-K73 PolarHBondContact O-N 3.38Å
74	P	83.3	Confident	79.4	Confident	101 Å²	101	107 Å²	107	66%	0.656	62%	0.619	S	S	*	*			trans	-67.8	142.2	-178.9	27.5	-34.5	0	0	0	111.3
75	L	84.4	Confident	77.5	Confident	88 Å²	88	108.4 Å²	108.4	46%	0.461	64%	0.64	S	S	.	*			trans	-91.5	144.5	177.4	-60.3	177.1	0	0	0	110	T64 A67 S68 L71	T64-L75 HydrophobicContact CG2-CB 4.33Å; A67-L75 HydrophobicContact CB-CD1 3.76Å; S68-L75 PolarHBondContact OG-N 3.27Å; L71-L75 HydrophobicContact CD2-CD2 4.09Å; L71-L75 HydrophobicContact CD2-CG 4.45Å
76	A	82.8	Confident	75.2	Confident	90 Å²	90	110.5 Å²	110.5	74%	0.744	65%	0.647	S	S	*	*			trans	-111.4	129.8	175.5	0	0	0	0	0	110.1	V78	A76-V78 PolarHBondContact O-N 3.48Å
77	V	79.6	Confident	73	Confident	86 Å²	86	108.7 Å²	108.7	52%	0.521	66%	0.655	S	S	.	*	P	Polyproline II helix	trans	-72.4	116.5	173.1	-171.6	0	0	0	0	108.8	T64	T64-V77 HydrophobicContact CG2-CG2 3.71Å; T64-V77 WeakPolarHBondContact OG1-CG2 3.25Å
78	V	79.6	Confident	70.9	Confident	129 Å²	129	111.9 Å²	111.9	78%	0.782	68%	0.681	S	S	*	*	P	Polyproline II helix	trans	-84.3	120.4	171.8	180	0	0	0	0	107.8	A76 G80	A76-V78 PolarHBondContact O-N 3.48Å; V78-G80 PolarHBondContact O-N 3.09Å
79	K	77.1	Confident	68.9	Low	141 Å²	141	115 Å²	115	61%	0.613	71%	0.709	S	S	*	*	P	Polyproline II helix	trans	-64.3	118.4	173.1	-169.1	160.1	-173.6	165.3	0	108.4	E82	K79-E82 WeakPolarHBondContact CE-OE1 3.18Å; K79-E82 VanDerWaalsContact CE-OE2 3.25Å; K79-E82 WeakPolarHBondContact CE-OE2 3.29Å; K79-E82 HydrophobicContact CG-CG 4.34Å; K79-E82 IonicContact NZ-OE2 2.64Å
80	G	71.3	Confident	67	Low	51 Å²	51	115 Å²	115	53%	0.526	71%	0.714	S	S	.	*	P	Polyproline II helix	trans	-58.1	165.6	175	0	0	0	0	0	111.2	V78 E82	V78-G80 PolarHBondContact O-N 3.09Å; G80-E82 WeakPolarHBondContact O-CG 3.46Å; G80-E82 PolarHBondContact O-N 3.17Å
81	A	61.1	Low	65.1	Low	114 Å²	114	121.3 Å²	121.3	94%	0.942	72%	0.722	S	S	*	*			trans	-67.6	77.4	173.3	0	0	0	0	0	109.9	G83	A81-G83 PolarHBondContact O-N 2.89Å
82	E	56.5	Low	63.4	Low	126 Å²	126	123 Å²	123	59%	0.589	74%	0.739	S	S	*	*			trans	-70.7	111.3	172.3	-52.7	-169.9	-167.4	0	0	106.2	K79 G80 K84	K79-E82 WeakPolarHBondContact CE-OE1 3.18Å; K79-E82 VanDerWaalsContact CE-OE2 3.25Å; K79-E82 WeakPolarHBondContact CE-OE2 3.29Å; K79-E82 HydrophobicContact CG-CG 4.34Å; K79-E82 IonicContact NZ-OE2 2.64Å; G80-E82 WeakPolarHBondContact O-CG 3.46Å; G80-E82 PolarHBondContact O-N 3.17Å; E82-K84 PolarHBondContact O-N 2.7Å
83	G	52.9	Low	61.2	Low	73 Å²	73	117.7 Å²	117.7	75%	0.753	74%	0.735	S	S	*	*			trans	-39.6	124.4	-175.5	0	0	0	0	0	112.2	A81 G85	A81-G83 PolarHBondContact O-N 2.89Å; G83-G85 PolarHBondContact O-N 3.17Å; G83-G85 VanDerWaalsContact O-N 3.09Å
84	K	46.5	Very low	59.2	Low	224 Å²	224	117.5 Å²	117.5	97%	0.974	75%	0.746	S	S	*	*	S	Bend	trans	-11.1	99.9	176.3	-89	-178.8	170.9	178.9	0	113.7	E82	E82-K84 PolarHBondContact O-N 2.7Å
85	G	51	Low	57.6	Low	64 Å²	64	118.5 Å²	118.5	66%	0.66	76%	0.755	S	S	*	*			trans	155.4	61.1	167.3	0	0	0	0	0	114.5	G83	G83-G85 PolarHBondContact O-N 3.17Å; G83-G85 VanDerWaalsContact O-N 3.09Å
86	K	43	Very low	55.9	Low	187 Å²	187	119.7 Å²	119.7	81%	0.813	77%	0.771	S	S	*	*			trans	-170.8	107.9	150.6	-99.1	152.9	-164	-164.4	0	108.3	A88	K86-A88 PolarHBondContact O-N 3.2Å
87	S	45.9	Very low	54	Low	126 Å²	126	128.9 Å²	128.9	88%	0.881	79%	0.794	S	S	*	*	P	Polyproline II helix	trans	-50.3	126.8	177	-44.3	0	0	0	0	110.4	A89	S87-A89 PolarHBondContact O-N 3.44Å
88	A	44.6	Very low	52.7	Low	101 Å²	101	131.1 Å²	131.1	84%	0.835	81%	0.808	S	S	*	*	P	Polyproline II helix	trans	-57.8	117.8	170.9	0	0	0	0	0	108.9	K86 A90	K86-A88 PolarHBondContact O-N 3.2Å; A88-A90 PolarHBondContact O-N 3.47Å
89	A	47.5	Very low	51.3	Low	93 Å²	93	131.2 Å²	131.2	77%	0.769	81%	0.809	S	S	*	*	P	Polyproline II helix	trans	-65.4	126.1	163.9	0	0	0	0	0	107.4	S87 R91	S87-A89 PolarHBondContact O-N 3.44Å; A89-R91 PolarHBondContact O-N 3.32Å
90	A	48.9	Very low	49.8	Very low	98 Å²	98	130.6 Å²	130.6	81%	0.81	82%	0.82	S	S	*	*	P	Polyproline II helix	trans	-52	129.6	-176.9	0	0	0	0	0	111.3	A88	A88-A90 PolarHBondContact O-N 3.47Å
91	R	47.2	Very low	48.6	Very low	235 Å²	235	135.3 Å²	135.3	89%	0.887	84%	0.838	S	S	*	*	P	Polyproline II helix	trans	-73.1	131.6	168.9	-58.8	175.4	87.2	-178.8	5.5	107.4	A89 G93	A89-R91 PolarHBondContact O-N 3.32Å; R91-G93 PolarHBondContact O-N 3.19Å
92	P	50.1	Low	47.8	Very low	123 Å²	123	136.6 Å²	136.6	80%	0.799	83%	0.831	S	S	*	*	P	Polyproline II helix	trans	-68.5	123.1	169.6	28.2	-30.1	0	0	0	108.2	T94	P92-T94 PolarHBondContact O-N 3.3Å
93	G	43.3	Very low	47.2	Very low	77 Å²	77	137.3 Å²	137.3	79%	0.794	85%	0.847	S	S	*	*	P	Polyproline II helix	trans	-69.3	125.7	175.9	0	0	0	0	0	110.3	R91 S95	R91-G93 PolarHBondContact O-N 3.19Å; G93-S95 PolarHBondContact O-N 3.1Å
94	T	46.5	Very low	46.8	Very low	140 Å²	140	141.9 Å²	141.9	86%	0.859	85%	0.854	S	S	*	*			trans	-87.4	98.9	165.2	57.7	0	0	0	0	107.6	P92	P92-T94 PolarHBondContact O-N 3.3Å
95	S	49	Very low	46.8	Very low	122 Å²	122	135.6 Å²	135.6	85%	0.853	85%	0.845	S	S	*	*			trans	-79.5	123.4	161.7	61.9	0	0	0	0	108.7	G93	G93-S95 PolarHBondContact O-N 3.1Å
96	S	50.5	Low	46.5	Very low	113 Å²	113	141.6 Å²	141.6	79%	0.79	86%	0.86	S	S	*	*			trans	-131.4	126	159.9	54	0	0	0	0	108.5
97	K	41.4	Very low	46.8	Very low	284 Å²	284	137.5 Å²	137.5	100%	1.235	87%	0.865	S	S	*	*			trans	-58.6	0	165.6	-85.9	175.1	169.9	177.4	0	111.2

Retrieved 97 of 97 residues in 63.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).