A0A087XFS6_POEFO Loading...

Small nuclear ribonucleoprotein E

Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs. As part of the U7 snRNP it is involved in histone 3'-end processing.

AlphaFold DB (A0A3B3TSE1), UniProt , Accession A0A087XFS6, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 92 aa.

						>A0A087XFS6_POEFO|A0A087XFS6
MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHMKTKNRKPLGRIMLKGDNITLLQSVSN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.3	Very low	57.2	Low	237 Å²	237	167.7 Å²	167.7	100%	1.167	87%	0.869	S	S	*	*				0	108.1	0	-73.9	169.9	178.9	0	0	107.9
2	A	43.8	Very low	58.7	Low	101 Å²	101	170.9 Å²	170.9	84%	0.835	87%	0.871	S	S	*	*			trans	-94.5	111.8	-177.8	0	0	0	0	0	109.6	R4	A2-R4 PolarHBondContact O-N 3.12Å
3	Y	50.3	Low	60.4	Low	233 Å²	233	167.2 Å²	167.2	91%	0.914	86%	0.861	S	S	*	*			trans	-72.3	95.5	168.1	-82.2	-86.2	0	0	0	108.5	G5	Y3-G5 VanDerWaalsContact C-N 3.35Å; Y3-G5 PolarHBondContact O-N 2.77Å
4	R	52.2	Low	62.2	Low	240 Å²	240	168.3 Å²	168.3	91%	0.906	86%	0.864	S	S	*	*			trans	-74.6	92.2	169.5	-155.6	177.7	-168.5	175.4	3.2	106.9	A2 Q6	A2-R4 PolarHBondContact O-N 3.12Å; R4-Q6 PolarHBondContact O-N 3.31Å
5	G	54.5	Low	63.9	Low	70 Å²	70	162.9 Å²	162.9	72%	0.722	84%	0.842	S	S	*	*			trans	-54.6	113.1	174.7	0	0	0	0	0	109.7	Y3 G7	Y3-G5 VanDerWaalsContact C-N 3.35Å; Y3-G5 PolarHBondContact O-N 2.77Å; G5-G7 PolarHBondContact O-N 3.29Å
6	Q	58.2	Low	65.8	Low	192 Å²	192	160.8 Å²	160.8	90%	0.897	83%	0.827	S	S	*	*			trans	-61.8	104.9	167.3	-76.2	177.7	-4.9	0	0	106.8	R4 Q8	R4-Q6 PolarHBondContact O-N 3.31Å; Q6-Q8 PolarHBondContact O-N 3.37Å
7	G	61.3	Low	67.3	Low	69 Å²	69	157 Å²	157	71%	0.711	82%	0.815	S	S	*	*			trans	-54.6	116.8	171	0	0	0	0	0	108.4	G5 K9	G5-G7 PolarHBondContact O-N 3.29Å; G7-K9 PolarHBondContact O-N 2.84Å
8	Q	62.2	Low	68.9	Low	183 Å²	183	152.8 Å²	152.8	86%	0.855	79%	0.793	S	S	*	*			trans	-51.7	115.5	172.2	-90.4	172.9	-39.8	0	0	107.9	Q6 V10	Q6-Q8 PolarHBondContact O-N 3.37Å; Q8-V10 VanDerWaalsContact C-N 3.3Å; Q8-V10 PolarHBondContact O-N 3.2Å
9	K	64.3	Low	70.2	Confident	206 Å²	206	149.2 Å²	149.2	90%	0.896	78%	0.775	S	S	*	*			trans	-65.6	96.5	171.3	-71.3	-176.6	178.4	179.3	0	106.8	G7 Q11	G7-K9 PolarHBondContact O-N 2.84Å; K9-Q11 PolarHBondContact O-N 2.87Å
10	V	68.4	Low	71.4	Confident	133 Å²	133	145.4 Å²	145.4	81%	0.806	76%	0.755	S	S	*	*			trans	-61.3	109.1	173.8	-176.8	0	0	0	0	106.9	Q8 K12	Q8-V10 VanDerWaalsContact C-N 3.3Å; Q8-V10 PolarHBondContact O-N 3.2Å; V10-K12 PolarHBondContact O-N 3.18Å
11	Q	67.8	Low	72.5	Confident	181 Å²	181	138.8 Å²	138.8	85%	0.846	72%	0.721	S	S	*	*			trans	-70.3	113.9	175.4	-139	171.5	13.6	0	0	107	K9 V13	K9-Q11 PolarHBondContact O-N 2.87Å; Q11-V13 PolarHBondContact O-N 2.96Å
12	K	75.8	Confident	74.8	Confident	206 Å²	206	131.9 Å²	131.9	90%	0.896	68%	0.684	S	S	*	*			trans	-73	103	-176.9	-150.1	175.8	-171	-179.7	0	108	V10 M14	V10-K12 PolarHBondContact O-N 3.18Å; K12-M14 PolarHBondContact O-N 3.06Å
13	V	79.8	Confident	77.3	Confident	122 Å²	122	134.3 Å²	134.3	74%	0.739	67%	0.672	S	S	*	*			trans	-60.8	129.4	176	-178.6	0	0	0	0	108.3	Q11	Q11-V13 PolarHBondContact O-N 2.96Å
14	M	86.1	Confident	79.4	Confident	183 Å²	183	124.4 Å²	124.4	90%	0.901	63%	0.633	S	S	*	*			trans	-74	127.1	173.4	-172.5	-179.8	-69.8	0	0	108.5	K12	K12-M14 PolarHBondContact O-N 3.06Å
15	V	88.5	Confident	81.5	Confident	88 Å²	88	115.6 Å²	115.6	53%	0.533	60%	0.604	S	S	.	*			trans	-113.8	135.9	-175.3	-178.3	0	0	0	0	109	N19	V15-N19 HydrophobicContact CG1-CB 3.6Å
16	Q	93.2	Very high	83.4	Confident	129 Å²	129	119.4 Å²	119.4	60%	0.603	60%	0.603	S	S	*	*			trans	-64.9	139.7	173.5	-68.1	-64.7	-21.3	0	0	110.4	I18 N19	Q16-I18 HydrophobicContact CB-CG2 4.23Å; Q16-I18 PolarHBondContact O-N 2.96Å; Q16-N19 WeakPolarHBondContact O-CB 3.43Å; Q16-N19 PolarHBondContact O-N 3.33Å
17	P	92.4	Very high	85.2	Confident	96 Å²	96	114.7 Å²	114.7	62%	0.623	58%	0.584	S	S	*	*	H	α-helix	trans	-56.1	-36.5	-177.6	-27.5	35	0	0	0	113.9	N19 L20 I21	P17-N19 PolarHBondContact O-N 3.28Å; P17-L20 VanDerWaalsContact O-CB 3.24Å; P17-L20 WeakPolarHBondContact O-CB 3.15Å; P17-L20 PolarHBondContact O-N 2.98Å; P17-I21 PolarHBondContact O-N 3.27Å
18	I	95.3	Very high	86.7	Confident	82 Å²	82	120.6 Å²	120.6	42%	0.421	58%	0.584	S	S	.	*	H	α-helix	trans	-59.4	-35.7	177.4	-160.4	175.1	0	0	0	112	Q16 L20 I21 F22 F50	Q16-I18 HydrophobicContact CB-CG2 4.23Å; Q16-I18 PolarHBondContact O-N 2.96Å; I18-L20 PolarHBondContact O-N 3Å; I18-I21 PolarHBondContact O-N 2.92Å; I18-I21 VanDerWaalsContact O-N 3.16Å; I18-F22 HydrophobicContact CD1-CE2 3.82Å; I18-F22 HydrophobicContact CD1-CZ 4.46Å; I18-F22 HydrophobicContact CG1-CD2 3.95Å; I18-F22 HydrophobicContact CG1-CE2 3.62Å; I18-F22 HydrophobicContact CG2-CE2 4.49Å; I18-F22 WeakPolarHBondContact O-CD2 3.34Å; I18-F22 PolarHBondContact O-N 3.16Å; I18-F50 HydrophobicContact CD1-CE2 4.27Å; I18-F50 HydrophobicContact CG1-CE2 4.06Å; I18-F50 HydrophobicContact CG1-CZ 4.25Å
19	N	94.1	Very high	88.3	Confident	84 Å²	84	113.2 Å²	113.2	45%	0.449	55%	0.553	S	S	.	*	H	α-helix	trans	-67	-28.3	177.5	-64.6	-12.4	0	0	0	111.7	V15 Q16 P17 R23	V15-N19 HydrophobicContact CG1-CB 3.6Å; Q16-N19 WeakPolarHBondContact O-CB 3.43Å; Q16-N19 PolarHBondContact O-N 3.33Å; P17-N19 PolarHBondContact O-N 3.28Å; N19-R23 WeakPolarHBondContact O-CB 3.19Å; N19-R23 PolarHBondContact O-N 3.33Å
20	L	93.4	Very high	89.8	Confident	73 Å²	73	106.7 Å²	106.7	38%	0.382	52%	0.523	S	S	.	.	H	α-helix	trans	-69.4	-41.1	174.2	-168.3	69.5	0	0	0	111.1	P17 I18 R23 Y24	P17-L20 VanDerWaalsContact O-CB 3.24Å; P17-L20 WeakPolarHBondContact O-CB 3.15Å; P17-L20 PolarHBondContact O-N 2.98Å; I18-L20 PolarHBondContact O-N 3Å; L20-R23 WeakPolarHBondContact O-CB 3.42Å; L20-R23 PolarHBondContact O-N 2.87Å; L20-Y24 HydrophobicContact CD1-CE1 4.36Å; L20-Y24 HydrophobicContact CD2-CE2 4.03Å; L20-Y24 HydrophobicContact CG-CD2 4.48Å; L20-Y24 HydrophobicContact CG-CE1 4.4Å; L20-Y24 HydrophobicContact CG-CE2 3.76Å; L20-Y24 WeakPolarHBondContact O-CD2 3.43Å; L20-Y24 PolarHBondContact O-N 2.88Å
21	I	94.9	Very high	91.1	Very high	7 Å²	7	100.3 Å²	100.3	4%	0.036	48%	0.484	C	S	.	.	H	α-helix	trans	-65.8	-44.4	176.3	-60.5	168.2	0	0	0	110.4	P17 I18 R23 Y24 L25 I47 F50 M54 L87	P17-I21 PolarHBondContact O-N 3.27Å; I18-I21 PolarHBondContact O-N 2.92Å; I18-I21 VanDerWaalsContact O-N 3.16Å; I21-R23 VanDerWaalsContact C-N 3.27Å; I21-R23 PolarHBondContact O-N 2.85Å; I21-Y24 PolarHBondContact O-N 3.33Å; I21-Y24 VanDerWaalsContact O-N 3.11Å; I21-L25 PolarHBondContact O-N 2.99Å; I21-I47 HydrophobicContact CG2-CD1 4.23Å; I21-F50 HydrophobicContact CG2-CB 4.44Å; I21-F50 HydrophobicContact CG2-CD1 3.61Å; I21-F50 HydrophobicContact CG2-CD2 4.21Å; I21-F50 HydrophobicContact CG2-CE1 3.78Å; I21-F50 HydrophobicContact CG2-CE2 4.36Å; I21-F50 HydrophobicContact CG2-CG 3.84Å; I21-F50 HydrophobicContact CG2-CZ 4.14Å; I21-M54 HydrophobicContact CD1-CE 3.21Å; I21-M54 HydrophobicContact CD1-SD 3.43Å; I21-M54 WeakPolarHBondContact CD1-SD 2.97Å; I21-M54 HydrophobicContact CG1-CE 4.47Å; I21-L87 HydrophobicContact CD1-CD1 4.39Å; I21-L87 HydrophobicContact CG1-CD1 4.22Å
22	F	95.6	Very high	92.5	Very high	91 Å²	91	92.7 Å²	92.7	40%	0.399	45%	0.449	S	S	.	.	H	α-helix	trans	-55.7	-43.4	172.4	-81.3	-61.9	0	0	0	111.7	I18 Y24 L25 Q26 F50	I18-F22 HydrophobicContact CD1-CE2 3.82Å; I18-F22 HydrophobicContact CD1-CZ 4.46Å; I18-F22 HydrophobicContact CG1-CD2 3.95Å; I18-F22 HydrophobicContact CG1-CE2 3.62Å; I18-F22 HydrophobicContact CG2-CE2 4.49Å; I18-F22 WeakPolarHBondContact O-CD2 3.34Å; I18-F22 PolarHBondContact O-N 3.16Å; F22-Y24 PolarHBondContact O-N 2.96Å; F22-L25 PolarHBondContact O-N 3.35Å; F22-Q26 WeakPolarHBondContact O-CB 3.42Å; F22-Q26 WeakPolarHBondContact O-CG 3.27Å; F22-Q26 PolarHBondContact O-N 2.87Å; F22-F50 AromaticContact CD1-CE1 3.81Å; F22-F50 HydrophobicContact CD1-CE1 3.81Å; F22-F50 AromaticContact CD1-CZ 3.79Å; F22-F50 HydrophobicContact CD1-CZ 3.79Å; F22-F50 HydrophobicContact CD2-CZ 4.19Å; F22-F50 AromaticContact CE1-CE1 3.79Å; F22-F50 HydrophobicContact CE1-CE1 3.79Å; F22-F50 AromaticContact CE1-CZ 3.48Å; F22-F50 HydrophobicContact CE1-CZ 3.48Å; F22-F50 VanDerWaalsContact CE1-CZ 3.48Å; F22-F50 AromaticContact CE2-CZ 3.91Å; F22-F50 HydrophobicContact CE2-CZ 3.91Å; F22-F50 HydrophobicContact CG-CE1 4.36Å; F22-F50 HydrophobicContact CG-CZ 4.13Å; F22-F50 HydrophobicContact CZ-CE1 4.33Å; F22-F50 HydrophobicContact CZ-CE2 4.45Å; F22-F50 AromaticContact CZ-CZ 3.55Å; F22-F50 HydrophobicContact CZ-CZ 3.55Å
23	R	94.6	Very high	93.5	Very high	153 Å²	153	82.9 Å²	82.9	58%	0.577	41%	0.406	S	S	*	.	H	α-helix	trans	-62.4	-41.5	176.2	-177.9	-179.3	174.5	-176.1	-0.6	112.1	N19 L20 I21 N27	N19-R23 WeakPolarHBondContact O-CB 3.19Å; N19-R23 PolarHBondContact O-N 3.33Å; L20-R23 WeakPolarHBondContact O-CB 3.42Å; L20-R23 PolarHBondContact O-N 2.87Å; I21-R23 VanDerWaalsContact C-N 3.27Å; I21-R23 PolarHBondContact O-N 2.85Å; R23-N27 VanDerWaalsContact O-CB 3.27Å; R23-N27 WeakPolarHBondContact O-CB 3.33Å; R23-N27 PolarHBondContact O-N 3.39Å
24	Y	95.2	Very high	94.3	Very high	25 Å²	25	81.3 Å²	81.3	10%	0.098	39%	0.387	C	S	.	.	H	α-helix	trans	-64	-40.9	176.7	-64.7	-31.9	0	0	0	112.4	L20 I21 F22 R28 S29 I31 I47	L20-Y24 HydrophobicContact CD1-CE1 4.36Å; L20-Y24 HydrophobicContact CD2-CE2 4.03Å; L20-Y24 HydrophobicContact CG-CD2 4.48Å; L20-Y24 HydrophobicContact CG-CE1 4.4Å; L20-Y24 HydrophobicContact CG-CE2 3.76Å; L20-Y24 WeakPolarHBondContact O-CD2 3.43Å; L20-Y24 PolarHBondContact O-N 2.88Å; I21-Y24 PolarHBondContact O-N 3.33Å; I21-Y24 VanDerWaalsContact O-N 3.11Å; F22-Y24 PolarHBondContact O-N 2.96Å; Y24-R28 WeakPolarHBondContact O-CA 3.43Å; Y24-R28 PolarHBondContact O-N 3.49Å; Y24-R28 VanDerWaalsContact O-N 3.17Å; Y24-S29 PolarHBondContact O-N 3.11Å; Y24-I31 HydrophobicContact CD1-CG2 4.16Å; Y24-I31 HydrophobicContact CD2-CG2 3.76Å; Y24-I31 HydrophobicContact CE2-CG2 4.2Å; Y24-I31 HydrophobicContact CG-CG2 3.74Å; Y24-I47 HydrophobicContact CD2-CD1 4.49Å
25	L	95.5	Very high	94.8	Very high	54 Å²	54	73.6 Å²	73.6	28%	0.283	35%	0.349	S	S	.	.	H	α-helix	trans	-64.3	-50.1	175.3	-174.6	156.8	0	0	0	111.3	I21 F22 N27 R28 I47 F50	I21-L25 PolarHBondContact O-N 2.99Å; F22-L25 PolarHBondContact O-N 3.35Å; L25-N27 PolarHBondContact O-N 3.24Å; L25-R28 PolarHBondContact O-N 2.97Å; L25-I47 HydrophobicContact CB-CG2 4.24Å; L25-I47 HydrophobicContact CD1-CG2 4.19Å; L25-I47 HydrophobicContact CG-CG2 4.44Å; L25-F50 HydrophobicContact CD1-CD1 3.91Å; L25-F50 HydrophobicContact CD1-CE1 4.1Å
26	Q	95.1	Very high	95.2	Very high	150 Å²	150	76 Å²	76	70%	0.701	35%	0.35	S	S	*	.	H	α-helix	trans	-62.6	-43.4	-178.7	-75.8	179.8	-20.3	0	0	112.6	F22 R28	F22-Q26 WeakPolarHBondContact O-CB 3.42Å; F22-Q26 WeakPolarHBondContact O-CG 3.27Å; F22-Q26 PolarHBondContact O-N 2.87Å; Q26-R28 PolarHBondContact O-N 2.79Å
27	N	95.2	Very high	95.2	Very high	94 Å²	94	77.6 Å²	77.6	50%	0.503	36%	0.357	S	S	.	.	T	Hydrogen-bonded Turn	trans	-81.3	-1.7	-178.8	-68.4	-9.7	0	0	0	113.1	R23 L25 S29	R23-N27 VanDerWaalsContact O-CB 3.27Å; R23-N27 WeakPolarHBondContact O-CB 3.33Å; R23-N27 PolarHBondContact O-N 3.39Å; L25-N27 PolarHBondContact O-N 3.24Å; N27-S29 VanDerWaalsContact CB-OG 3.31Å; N27-S29 WeakPolarHBondContact CB-OG 3.45Å; N27-S29 PolarHBondContact O-N 2.88Å; N27-S29 VanDerWaalsContact O-N 3.13Å
28	R	94.3	Very high	95.1	Very high	192 Å²	192	77.5 Å²	77.5	73%	0.725	35%	0.348	S	S	*	.	T	Hydrogen-bonded Turn	trans	43.7	43.5	-167.7	-63.2	-161.9	177.8	-167.1	1.2	112.2	Y24 L25 Q26	Y24-R28 WeakPolarHBondContact O-CA 3.43Å; Y24-R28 PolarHBondContact O-N 3.49Å; Y24-R28 VanDerWaalsContact O-N 3.17Å; L25-R28 PolarHBondContact O-N 2.97Å; Q26-R28 PolarHBondContact O-N 2.79Å
29	S	94.3	Very high	95	Very high	28 Å²	28	79 Å²	79	20%	0.196	36%	0.361	C	S	.	.			trans	-70.6	133.4	-178.5	-59.8	0	0	0	0	109.4	Y24 N27 I31	Y24-S29 PolarHBondContact O-N 3.11Å; N27-S29 VanDerWaalsContact CB-OG 3.31Å; N27-S29 WeakPolarHBondContact CB-OG 3.45Å; N27-S29 PolarHBondContact O-N 2.88Å; N27-S29 VanDerWaalsContact O-N 3.13Å; S29-I31 PolarHBondContact O-N 2.9Å
30	R	95.7	Very high	95	Very high	69 Å²	69	78.6 Å²	78.6	26%	0.26	36%	0.359	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-69	124.6	169.2	-162.9	164.1	-173.6	97	2.8	107.9	E44 D60 E62 V90	R30-E44 IonicContact NE-OE2 4Å; R30-D60 PolarHBondContact NH1-O 3.06Å; R30-D60 VanDerWaalsContact NH1-O 3.11Å; R30-D60 PolarHBondContact NH2-O 2.86Å; R30-E62 IonicContact CZ-OE2 3.69Å; R30-E62 IonicContact NH2-OE2 2.68Å; R30-E62 PolarHBondContact NH2-OE2 2.83Å; R30-V90 HydrophobicContact CG-CG2 4.46Å; R30-V90 WeakPolarHBondContact O-CG2 3.27Å; R30-V90 PolarHBondContact O-N 3.48Å
31	I	96.7	Very high	95.1	Very high	0 Å²	0	76.4 Å²	76.4	0%	0	35%	0.347	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.8	154.4	178.4	59.8	148.4	0	0	0	109.9	Y24 S29 V33 E44 G45 I47 L56 L58 L87 Q88 V90	Y24-I31 HydrophobicContact CD1-CG2 4.16Å; Y24-I31 HydrophobicContact CD2-CG2 3.76Å; Y24-I31 HydrophobicContact CE2-CG2 4.2Å; Y24-I31 HydrophobicContact CG-CG2 3.74Å; S29-I31 PolarHBondContact O-N 2.9Å; I31-V33 HydrophobicContact CD1-CG2 3.87Å; I31-E44 CarbonylContact O-C 3.44Å; I31-E44 WeakPolarHBondContact O-CA 3.3Å; I31-G45 VanDerWaalsContact CG1-O 3.3Å; I31-G45 WeakPolarHBondContact CG1-O 3.27Å; I31-G45 PolarHBondContact N-O 3.33Å; I31-G45 PolarHBondContact O-N 3.22Å; I31-I47 HydrophobicContact CD1-CD1 3.53Å; I31-I47 HydrophobicContact CD1-CG1 3.54Å; I31-I47 HydrophobicContact CG1-CD1 4.26Å; I31-I47 HydrophobicContact CG1-CG1 3.99Å; I31-L56 HydrophobicContact CD1-CD1 4.33Å; I31-L58 HydrophobicContact CD1-CD2 4.16Å; I31-L58 HydrophobicContact CG1-CD2 4.41Å; I31-L87 HydrophobicContact CD1-CD2 3.98Å; I31-Q88 CarbonylContact C-O 3.58Å; I31-Q88 VanDerWaalsContact CA-O 3.27Å; I31-Q88 WeakPolarHBondContact CA-O 3.23Å; I31-V90 VanDerWaalsContact C-CG2 3.5Å
32	Q	96.8	Very high	95.2	Very high	20 Å²	20	78.2 Å²	78.2	9%	0.093	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.5	125.7	170.1	-174.4	179.2	86.7	0	0	108.6	R42 I43 E44 Q88 V90	Q32-R42 HydrophobicContact CG-CB 3.86Å; Q32-R42 HydrophobicContact CG-CG 4.42Å; Q32-I43 CarbonylContact C-O 3.58Å; Q32-I43 WeakPolarHBondContact CA-O 3.41Å; Q32-E44 HydrophobicContact CB-CG 3.83Å; Q32-E44 HydrophobicContact CG-CG 3.83Å; Q32-E44 PolarHBondContact NE2-OE1 2.98Å; Q32-Q88 PolarHBondContact N-O 3.47Å; Q32-Q88 PolarHBondContact O-N 3.23Å; Q32-V90 HydrophobicContact CB-CG2 3.73Å
33	V	97.1	Very high	95.3	Very high	0 Å²	0	74.2 Å²	74.2	0%	0	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.3	124.6	177.7	-169.3	0	0	0	0	109	I31 R42 I43 L58 L79 I84 L86 L87	I31-V33 HydrophobicContact CD1-CG2 3.87Å; V33-R42 WeakPolarHBondContact O-CA 3.34Å; V33-R42 WeakPolarHBondContact O-CB 3.27Å; V33-I43 HydrophobicContact CB-CB 4.36Å; V33-I43 PolarHBondContact N-O 3.37Å; V33-I43 PolarHBondContact O-N 3.17Å; V33-L58 HydrophobicContact CG2-CD1 4.34Å; V33-L79 HydrophobicContact CB-CD2 4.07Å; V33-L79 HydrophobicContact CG1-CD2 3.65Å; V33-L79 HydrophobicContact CG2-CD2 4.09Å; V33-I84 HydrophobicContact CG1-CB 4.35Å; V33-I84 HydrophobicContact CG1-CG1 4Å; V33-I84 HydrophobicContact CG1-CG2 4.02Å; V33-L86 WeakPolarHBondContact CA-O 3.18Å; V33-L87 HydrophobicContact CB-CD2 4.2Å; V33-L87 HydrophobicContact CG1-CD2 3.9Å; V33-L87 HydrophobicContact CG2-CD2 3.65Å
34	W	97.1	Very high	95.4	Very high	89 Å²	89	67.6 Å²	67.6	34%	0.337	31%	0.312	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.4	129.2	171.6	-65.3	38.3	0	0	0	107.9	R42 T85 L86	W34-R42 VanDerWaalsContact CH2-NH2 3.28Å; W34-T85 WeakPolarHBondContact O-CB 3.42Å; W34-T85 PolarHBondContact O-N 3.04Å; W34-L86 HydrophobicContact CB-CB 4Å; W34-L86 HydrophobicContact CD2-CB 4.38Å; W34-L86 HydrophobicContact CD2-CD2 4.47Å; W34-L86 HydrophobicContact CG-CB 4.02Å; W34-L86 HydrophobicContact CG-CD2 4.3Å; W34-L86 PolarHBondContact N-O 2.85Å
35	L	96.9	Very high	95.5	Very high	22 Å²	22	66.4 Å²	66.4	12%	0.115	31%	0.307	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.6	150.2	-175.2	-62.6	177	0	0	0	111.3	Q38 M41 I43 L79 N83 T85	L35-Q38 HydrophobicContact CB-CB 3.94Å; L35-Q38 HydrophobicContact CD1-CB 4.43Å; L35-Q38 HydrophobicContact CD1-CG 4.28Å; L35-M41 HydrophobicContact CD1-CE 3.45Å; L35-M41 VanDerWaalsContact CD1-CE 3.45Å; L35-I43 HydrophobicContact CD1-CG1 4.14Å; L35-I43 HydrophobicContact CD2-CG1 4.03Å; L35-I43 HydrophobicContact CG-CG1 4.36Å; L35-L79 HydrophobicContact CD2-CD1 4.14Å; L35-L79 HydrophobicContact CD2-CD2 4.47Å; L35-N83 CarbonylContact C-O 3.56Å; L35-N83 VanDerWaalsContact CA-O 3.22Å; L35-N83 WeakPolarHBondContact CA-O 3.33Å; L35-N83 HydrophobicContact CD2-CB 4.46Å; L35-T85 VanDerWaalsContact C-OG1 3.3Å; L35-T85 PolarHBondContact O-OG1 3.44Å; L35-T85 VanDerWaalsContact O-OG1 3.14Å
36	Y	95.3	Very high	95.5	Very high	139 Å²	139	64.9 Å²	64.9	55%	0.545	30%	0.301	S	S	.	.	S	Bend	trans	-66.5	135	170.4	-171.6	-107.5	0	0	0	109.9	Q38 N83 T85	Y36-Q38 PolarHBondContact O-N 3.13Å; Y36-N83 PolarHBondContact N-O 3Å; Y36-T85 VanDerWaalsContact CA-OG1 3.28Å; Y36-T85 WeakPolarHBondContact CA-OG1 3.28Å; Y36-T85 PolarHBondContact N-OG1 3.32Å
37	E	93.5	Very high	95.6	Very high	162 Å²	162	57.8 Å²	57.8	76%	0.757	27%	0.267	S	S	*	.	S	Bend	trans	59.3	-19.9	-177.1	-67.7	177	171.1	0	0	117.3	V39	E37-V39 PolarHBondContact O-N 2.9Å
38	Q	91.3	Very high	95.8	Very high	94 Å²	94	56.3 Å²	56.3	44%	0.439	26%	0.259	S	S	.	.			trans	-100.9	81.9	-174.2	-174.7	92.2	-37.2	0	0	111.3	L35 Y36 N40 M41	L35-Q38 HydrophobicContact CB-CB 3.94Å; L35-Q38 HydrophobicContact CD1-CB 4.43Å; L35-Q38 HydrophobicContact CD1-CG 4.28Å; Y36-Q38 PolarHBondContact O-N 3.13Å; Q38-N40 PolarHBondContact O-N 2.99Å; Q38-M41 HydrophobicContact CG-CB 3.79Å; Q38-M41 HydrophobicContact CG-CE 4.29Å; Q38-M41 VanDerWaalsContact O-O 3.08Å
39	V	92.2	Very high	95.9	Very high	114 Å²	114	48.1 Å²	48.1	69%	0.691	23%	0.234	S	C	*	.	T	Hydrogen-bonded Turn	trans	-74.5	-20.8	-177.4	-62.7	0	0	0	0	114.8	E37 M41	E37-V39 PolarHBondContact O-N 2.9Å; V39-M41 VanDerWaalsContact C-N 3.35Å
40	N	94.3	Very high	96.1	Very high	75 Å²	75	49.1 Å²	49.1	40%	0.401	24%	0.235	S	C	.	.	T	Hydrogen-bonded Turn	trans	-84.7	-10.7	-175.2	-67	-50.3	0	0	0	113.4	Q38 M66 K67	Q38-N40 PolarHBondContact O-N 2.99Å; N40-M66 PolarHBondContact O-N 2.89Å; N40-K67 VanDerWaalsContact OD1-CE 3.27Å; N40-K67 WeakPolarHBondContact OD1-CE 3.46Å
41	M	95.6	Very high	96.1	Very high	27 Å²	27	48.5 Å²	48.5	13%	0.133	24%	0.237	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-132.4	141	-174.7	-170.2	174.1	79.8	0	0	109.7	L35 Q38 V39 E63 I64	L35-M41 HydrophobicContact CD1-CE 3.45Å; L35-M41 VanDerWaalsContact CD1-CE 3.45Å; Q38-M41 HydrophobicContact CG-CB 3.79Å; Q38-M41 HydrophobicContact CG-CE 4.29Å; Q38-M41 VanDerWaalsContact O-O 3.08Å; V39-M41 VanDerWaalsContact C-N 3.35Å; M41-E63 HydrophobicContact CG-CB 4.42Å; M41-E63 HydrophobicContact SD-CB 4.29Å; M41-E63 HydrophobicContact SD-CG 4.39Å; M41-I64 CarbonylContact C-O 3.48Å; M41-I64 WeakPolarHBondContact CA-O 3.27Å
42	R	96.8	Very high	96	Very high	44 Å²	44	56.1 Å²	56.1	17%	0.166	27%	0.272	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.6	155.1	173.2	-60.5	-174	-176.8	173	0.2	109	Q32 V33 W34 I64 M66	Q32-R42 HydrophobicContact CG-CB 3.86Å; Q32-R42 HydrophobicContact CG-CG 4.42Å; V33-R42 WeakPolarHBondContact O-CA 3.34Å; V33-R42 WeakPolarHBondContact O-CB 3.27Å; W34-R42 VanDerWaalsContact CH2-NH2 3.28Å; R42-I64 HydrophobicContact CB-CB 4.48Å; R42-I64 PolarHBondContact N-O 3Å; R42-I64 PolarHBondContact O-N 2.74Å; R42-M66 VanDerWaalsContact CD-SD 3.55Å; R42-M66 HydrophobicContact CG-CG 4.31Å; R42-M66 HydrophobicContact CG-SD 3.99Å; R42-M66 VanDerWaalsContact CZ-SD 3.53Å; R42-M66 PolarHBondContact NE-SD 2.86Å
43	I	97.3	Very high	96	Very high	8 Å²	8	62.7 Å²	62.7	4%	0.041	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.6	126.9	173.7	-58.6	-65.3	0	0	0	107.7	Q32 V33 L35 L58 E62 E63 L74 I77	Q32-I43 CarbonylContact C-O 3.58Å; Q32-I43 WeakPolarHBondContact CA-O 3.41Å; V33-I43 HydrophobicContact CB-CB 4.36Å; V33-I43 PolarHBondContact N-O 3.37Å; V33-I43 PolarHBondContact O-N 3.17Å; L35-I43 HydrophobicContact CD1-CG1 4.14Å; L35-I43 HydrophobicContact CD2-CG1 4.03Å; L35-I43 HydrophobicContact CG-CG1 4.36Å; I43-L58 HydrophobicContact CG2-CD1 3.7Å; I43-E62 WeakPolarHBondContact CA-O 3.43Å; I43-E63 HydrophobicContact CD1-CB 4.38Å; I43-E63 HydrophobicContact CD1-CG 3.73Å; I43-L74 HydrophobicContact CD1-CD1 4.14Å; I43-I77 HydrophobicContact CG2-CD1 4.02Å
44	E	97.3	Very high	95.9	Very high	14 Å²	14	66 Å²	66	7%	0.065	31%	0.314	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	146.6	169.5	-74.5	-179.1	-175.2	0	0	110.3	R30 I31 Q32 A61 E62 I64 R71 V90	R30-E44 IonicContact NE-OE2 4Å; I31-E44 CarbonylContact O-C 3.44Å; I31-E44 WeakPolarHBondContact O-CA 3.3Å; Q32-E44 HydrophobicContact CB-CG 3.83Å; Q32-E44 HydrophobicContact CG-CG 3.83Å; Q32-E44 PolarHBondContact NE2-OE1 2.98Å; E44-A61 CarbonylContact O-C 3.55Å; E44-A61 WeakPolarHBondContact O-CA 3.35Å; E44-E62 PolarHBondContact N-O 2.91Å; E44-E62 PolarHBondContact O-N 3.03Å; E44-I64 HydrophobicContact CB-CG1 4.17Å; E44-I64 HydrophobicContact CG-CD1 4.45Å; E44-I64 HydrophobicContact CG-CG1 3.76Å; E44-R71 IonicContact OE2-CZ 3.81Å; E44-R71 IonicContact OE2-NH2 2.73Å; E44-R71 PolarHBondContact OE2-NH2 3.26Å; E44-V90 HydrophobicContact CG-CG2 4.37Å
45	G	96.8	Very high	95.9	Very high	0 Å²	0	63.2 Å²	63.2	0%	0	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	176.6	177.6	177.2	0	0	0	0	0	112.4	I31	I31-G45 VanDerWaalsContact CG1-O 3.3Å; I31-G45 WeakPolarHBondContact CG1-O 3.27Å; I31-G45 PolarHBondContact N-O 3.33Å; I31-G45 PolarHBondContact O-N 3.22Å
46	C	97.1	Very high	96	Very high	21 Å²	21	62.1 Å²	62.1	14%	0.142	30%	0.3	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.7	126.3	176	-66.4	0	0	0	0	109.6	I48 L58 D59	C46-I48 PolarHBondContact O-N 3.19Å; C46-L58 CarbonylContact O-C 3.57Å; C46-L58 WeakPolarHBondContact O-CA 3.43Å; C46-D59 PolarHBondContact N-O 2.87Å; C46-D59 PolarHBondContact O-N 2.99Å
47	I	97.5	Very high	96.1	Very high	1 Å²	1	57.9 Å²	57.9	1%	0.005	29%	0.288	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.8	125.2	177.7	-58.6	170.9	0	0	0	109.3	I21 Y24 L25 I31 L56 L58	I21-I47 HydrophobicContact CG2-CD1 4.23Å; Y24-I47 HydrophobicContact CD2-CD1 4.49Å; L25-I47 HydrophobicContact CB-CG2 4.24Å; L25-I47 HydrophobicContact CD1-CG2 4.19Å; L25-I47 HydrophobicContact CG-CG2 4.44Å; I31-I47 HydrophobicContact CD1-CD1 3.53Å; I31-I47 HydrophobicContact CD1-CG1 3.54Å; I31-I47 HydrophobicContact CG1-CD1 4.26Å; I31-I47 HydrophobicContact CG1-CG1 3.99Å; I47-L56 HydrophobicContact CD1-CD1 4.39Å; I47-L58 HydrophobicContact CB-CD2 4.46Å; I47-L58 HydrophobicContact CG1-CD2 3.76Å
48	I	97.6	Very high	96.3	Very high	63 Å²	63	50.1 Å²	50.1	32%	0.323	25%	0.252	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.5	-11.9	171.7	58.9	167.8	0	0	0	113.1	C46 V57 D59 R76	C46-I48 PolarHBondContact O-N 3.19Å; I48-V57 HydrophobicContact CD1-CB 4.46Å; I48-V57 HydrophobicContact CD1-CG1 3.62Å; I48-V57 HydrophobicContact CG1-CB 3.88Å; I48-V57 HydrophobicContact CG1-CG1 3.56Å; I48-V57 WeakPolarHBondContact CG1-O 3.46Å; I48-V57 PolarHBondContact N-O 3.19Å; I48-D59 HydrophobicContact CD1-CB 4.23Å; I48-D59 HydrophobicContact CG2-CB 3.78Å; I48-R76 HydrophobicContact CD1-CG 4.32Å
49	G	97.4	Very high	96.6	Very high	20 Å²	20	47.3 Å²	47.3	21%	0.206	24%	0.24	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-169.1	156.3	174.4	0	0	0	0	0	111.7	V57	G49-V57 PolarHBondContact O-N 3.11Å
50	F	97.5	Very high	96.8	Very high	50 Å²	50	46.8 Å²	46.8	22%	0.219	23%	0.234	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-149.6	164.3	171.8	70	-85	0	0	0	110.9	I18 I21 F22 L25 N55 L56	I18-F50 HydrophobicContact CD1-CE2 4.27Å; I18-F50 HydrophobicContact CG1-CE2 4.06Å; I18-F50 HydrophobicContact CG1-CZ 4.25Å; I21-F50 HydrophobicContact CG2-CB 4.44Å; I21-F50 HydrophobicContact CG2-CD1 3.61Å; I21-F50 HydrophobicContact CG2-CD2 4.21Å; I21-F50 HydrophobicContact CG2-CE1 3.78Å; I21-F50 HydrophobicContact CG2-CE2 4.36Å; I21-F50 HydrophobicContact CG2-CG 3.84Å; I21-F50 HydrophobicContact CG2-CZ 4.14Å; F22-F50 AromaticContact CD1-CE1 3.81Å; F22-F50 HydrophobicContact CD1-CE1 3.81Å; F22-F50 AromaticContact CD1-CZ 3.79Å; F22-F50 HydrophobicContact CD1-CZ 3.79Å; F22-F50 HydrophobicContact CD2-CZ 4.19Å; F22-F50 AromaticContact CE1-CE1 3.79Å; F22-F50 HydrophobicContact CE1-CE1 3.79Å; F22-F50 AromaticContact CE1-CZ 3.48Å; F22-F50 HydrophobicContact CE1-CZ 3.48Å; F22-F50 VanDerWaalsContact CE1-CZ 3.48Å; F22-F50 AromaticContact CE2-CZ 3.91Å; F22-F50 HydrophobicContact CE2-CZ 3.91Å; F22-F50 HydrophobicContact CG-CE1 4.36Å; F22-F50 HydrophobicContact CG-CZ 4.13Å; F22-F50 HydrophobicContact CZ-CE1 4.33Å; F22-F50 HydrophobicContact CZ-CE2 4.45Å; F22-F50 AromaticContact CZ-CZ 3.55Å; F22-F50 HydrophobicContact CZ-CZ 3.55Å; L25-F50 HydrophobicContact CD1-CD1 3.91Å; L25-F50 HydrophobicContact CD1-CE1 4.1Å; F50-N55 WeakPolarHBondContact CA-O 3.48Å; F50-L56 HydrophobicContact CB-CD2 3.53Å
51	D	96.6	Very high	96.9	Very high	55 Å²	55	43.3 Å²	43.3	29%	0.294	22%	0.215	S	C	.	.			trans	-125.3	-176.4	177.2	70.8	10.7	0	0	0	113.1	Y53 M54 N55	D51-Y53 PolarHBondContact O-N 3.11Å; D51-Y53 WeakPolarHBondContact OD1-CA 3.36Å; D51-Y53 PolarHBondContact OD1-N 2.95Å; D51-M54 PolarHBondContact O-N 3.34Å; D51-M54 VanDerWaalsContact O-N 3.12Å; D51-M54 PolarHBondContact OD1-N 2.86Å; D51-N55 PolarHBondContact N-O 3.34Å; D51-N55 WeakPolarHBondContact OD1-CB 3.44Å; D51-N55 PolarHBondContact OD1-N 2.8Å; D51-N55 WeakPolarHBondContact OD2-CB 3.31Å; D51-N55 PolarHBondContact OD2-ND2 2.85Å
52	E	95.3	Very high	97	Very high	160 Å²	160	43.8 Å²	43.8	75%	0.748	22%	0.217	S	C	*	.	T	Hydrogen-bonded Turn	trans	-64.6	-21.7	179.4	65	-167.3	-166.8	0	0	114.2	M54	E52-M54 VanDerWaalsContact C-N 3.34Å
53	Y	95.4	Very high	97	Very high	158 Å²	158	43.4 Å²	43.4	62%	0.62	22%	0.217	S	C	*	.	T	Hydrogen-bonded Turn	trans	-93.4	5.7	176.5	-55	-72.7	0	0	0	112.6	D51 N55	D51-Y53 PolarHBondContact O-N 3.11Å; D51-Y53 WeakPolarHBondContact OD1-CA 3.36Å; D51-Y53 PolarHBondContact OD1-N 2.95Å; Y53-N55 PolarHBondContact O-N 3.16Å
54	M	95.9	Very high	96.9	Very high	69 Å²	69	43.9 Å²	43.9	34%	0.34	22%	0.219	S	C	.	.			trans	63.7	22.9	-175.9	-57.1	-82.2	-64.5	0	0	113.5	I21 D51 E52 L56 G81 I84 L87	I21-M54 HydrophobicContact CD1-CE 3.21Å; I21-M54 HydrophobicContact CD1-SD 3.43Å; I21-M54 WeakPolarHBondContact CD1-SD 2.97Å; I21-M54 HydrophobicContact CG1-CE 4.47Å; D51-M54 PolarHBondContact O-N 3.34Å; D51-M54 VanDerWaalsContact O-N 3.12Å; D51-M54 PolarHBondContact OD1-N 2.86Å; E52-M54 VanDerWaalsContact C-N 3.34Å; M54-L56 PolarHBondContact O-N 3.28Å; M54-G81 WeakPolarHBondContact O-CA 3.36Å; M54-I84 VanDerWaalsContact O-CD1 3.27Å; M54-I84 WeakPolarHBondContact O-CD1 3.24Å; M54-L87 HydrophobicContact CE-CD1 4.26Å
55	N	97.1	Very high	96.8	Very high	31 Å²	31	46.4 Å²	46.4	17%	0.166	23%	0.231	C	C	.	.			trans	-65.3	130.8	165.3	-58.5	-46.9	0	0	0	107.9	F50 D51 Y53 M78 L79 K80 G81	F50-N55 WeakPolarHBondContact CA-O 3.48Å; D51-N55 PolarHBondContact N-O 3.34Å; D51-N55 WeakPolarHBondContact OD1-CB 3.44Å; D51-N55 PolarHBondContact OD1-N 2.8Å; D51-N55 WeakPolarHBondContact OD2-CB 3.31Å; D51-N55 PolarHBondContact OD2-ND2 2.85Å; Y53-N55 PolarHBondContact O-N 3.16Å; N55-M78 HydrophobicContact CB-CE 3.62Å; N55-L79 CarbonylContact C-O 3.53Å; N55-L79 VanDerWaalsContact CA-O 3.3Å; N55-L79 WeakPolarHBondContact CA-O 3.44Å; N55-K80 VanDerWaalsContact OD1-CA 3.27Å; N55-K80 WeakPolarHBondContact OD1-CA 3.3Å; N55-G81 PolarHBondContact OD1-N 2.9Å
56	L	97.5	Very high	96.6	Very high	0 Å²	0	50 Å²	50	0%	0	25%	0.248	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	131.9	-176.5	-57.6	-177.5	0	0	0	110.1	I31 I47 F50 M54 L58 M78 L79 I84 L87	I31-L56 HydrophobicContact CD1-CD1 4.33Å; I47-L56 HydrophobicContact CD1-CD1 4.39Å; F50-L56 HydrophobicContact CB-CD2 3.53Å; M54-L56 PolarHBondContact O-N 3.28Å; L56-L58 HydrophobicContact CB-CD2 4.28Å; L56-L58 HydrophobicContact CB-CG 4.37Å; L56-M78 CarbonylContact O-C 3.53Å; L56-M78 WeakPolarHBondContact O-CA 3.22Å; L56-L79 PolarHBondContact N-O 2.74Å; L56-L79 PolarHBondContact O-N 3.44Å; L56-I84 HydrophobicContact CD1-CD1 3.65Å; L56-I84 HydrophobicContact CG-CD1 3.78Å; L56-L87 HydrophobicContact CD1-CD1 4.25Å; L56-L87 HydrophobicContact CD1-CD2 3.82Å
57	V	97.9	Very high	96.4	Very high	49 Å²	49	57.2 Å²	57.2	30%	0.297	28%	0.278	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	117.5	164.3	-170.8	0	0	0	0	107.5	I48 G49 R76 I77	I48-V57 HydrophobicContact CD1-CB 4.46Å; I48-V57 HydrophobicContact CD1-CG1 3.62Å; I48-V57 HydrophobicContact CG1-CB 3.88Å; I48-V57 HydrophobicContact CG1-CG1 3.56Å; I48-V57 WeakPolarHBondContact CG1-O 3.46Å; I48-V57 PolarHBondContact N-O 3.19Å; G49-V57 PolarHBondContact O-N 3.11Å; V57-R76 HydrophobicContact CG1-CG 4.39Å; V57-I77 WeakPolarHBondContact CA-O 3.22Å
58	L	97.8	Very high	96.2	Very high	0 Å²	0	62 Å²	62	0%	0	31%	0.307	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.6	133	-179	-60.4	177.3	0	0	0	110	I31 V33 I43 C46 I47 L56 A61 R76 I77 L79	I31-L58 HydrophobicContact CD1-CD2 4.16Å; I31-L58 HydrophobicContact CG1-CD2 4.41Å; V33-L58 HydrophobicContact CG2-CD1 4.34Å; I43-L58 HydrophobicContact CG2-CD1 3.7Å; C46-L58 CarbonylContact O-C 3.57Å; C46-L58 WeakPolarHBondContact O-CA 3.43Å; I47-L58 HydrophobicContact CB-CD2 4.46Å; I47-L58 HydrophobicContact CG1-CD2 3.76Å; L56-L58 HydrophobicContact CB-CD2 4.28Å; L56-L58 HydrophobicContact CB-CG 4.37Å; L58-A61 HydrophobicContact CB-CB 4.1Å; L58-R76 WeakPolarHBondContact O-CA 3.49Å; L58-I77 HydrophobicContact CB-CG1 4.11Å; L58-I77 PolarHBondContact N-O 3.14Å; L58-I77 PolarHBondContact O-N 3.25Å; L58-L79 HydrophobicContact CD1-CD2 4.49Å
59	D	97.7	Very high	95.8	Very high	34 Å²	34	67.3 Å²	67.3	18%	0.182	33%	0.328	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.4	155.8	169.3	-138	13.8	0	0	0	110.4	C46 I48 A61 R76	C46-D59 PolarHBondContact N-O 2.87Å; C46-D59 PolarHBondContact O-N 2.99Å; I48-D59 HydrophobicContact CD1-CB 4.23Å; I48-D59 HydrophobicContact CG2-CB 3.78Å; D59-A61 PolarHBondContact O-N 3.01Å; D59-A61 VanDerWaalsContact O-N 3.16Å; D59-R76 IonicContact OD1-CZ 3.47Å; D59-R76 IonicContact OD1-NE 2.87Å; D59-R76 PolarHBondContact OD1-NE 2.99Å; D59-R76 IonicContact OD1-NH2 3.2Å; D59-R76 PolarHBondContact OD1-NH2 3.06Å; D59-R76 IonicContact OD2-CZ 3.74Å; D59-R76 IonicContact OD2-NE 3.8Å; D59-R76 IonicContact OD2-NH2 2.84Å; D59-R76 PolarHBondContact OD2-NH2 2.76Å
60	D	96	Very high	95.7	Very high	104 Å²	104	71 Å²	71	56%	0.556	34%	0.343	S	S	*	.	E	Extended strand (participates in β ladder)	trans	47.9	39.7	-175.8	-60.5	-40.4	0	0	0	113.3	R30	R30-D60 PolarHBondContact NH1-O 3.06Å; R30-D60 VanDerWaalsContact NH1-O 3.11Å; R30-D60 PolarHBondContact NH2-O 2.86Å
61	A	97.5	Very high	95.6	Very high	1 Å²	1	74.4 Å²	74.4	1%	0.008	35%	0.354	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.7	143.6	-172.8	0	0	0	0	0	111.7	E44 L58 D59 L74 G75 I77	E44-A61 CarbonylContact O-C 3.55Å; E44-A61 WeakPolarHBondContact O-CA 3.35Å; L58-A61 HydrophobicContact CB-CB 4.1Å; D59-A61 PolarHBondContact O-N 3.01Å; D59-A61 VanDerWaalsContact O-N 3.16Å; A61-L74 HydrophobicContact CB-CB 4.32Å; A61-L74 PolarHBondContact O-N 3.03Å; A61-G75 VanDerWaalsContact CB-O 3.22Å; A61-G75 WeakPolarHBondContact CB-O 3.45Å; A61-G75 PolarHBondContact N-O 3.06Å; A61-G75 PolarHBondContact O-N 2.95Å; A61-I77 HydrophobicContact CB-CD1 3.76Å; A61-I77 HydrophobicContact CB-CG1 3.78Å
62	E	97.6	Very high	95.6	Very high	38 Å²	38	77 Å²	77	18%	0.178	36%	0.363	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.6	139.6	179.2	-66.2	173.1	142	0	0	110.8	R30 I43 E44 I64 R71 K72	R30-E62 IonicContact CZ-OE2 3.69Å; R30-E62 IonicContact NH2-OE2 2.68Å; R30-E62 PolarHBondContact NH2-OE2 2.83Å; I43-E62 WeakPolarHBondContact CA-O 3.43Å; E44-E62 PolarHBondContact N-O 2.91Å; E44-E62 PolarHBondContact O-N 3.03Å; E62-I64 HydrophobicContact CB-CD1 4.15Å; E62-R71 IonicContact OE1-NH1 3.59Å; E62-R71 IonicContact OE2-CZ 2.79Å; E62-R71 IonicContact OE2-NE 3.27Å; E62-R71 PolarHBondContact OE2-NE 2.92Å; E62-R71 IonicContact OE2-NH1 3.03Å; E62-R71 PolarHBondContact OE2-NH1 3.06Å; E62-R71 IonicContact OE2-NH2 2.95Å; E62-R71 PolarHBondContact OE2-NH2 2.73Å; E62-K72 CarbonylContact C-O 3.57Å; E62-K72 VanDerWaalsContact CA-O 3.24Å; E62-K72 WeakPolarHBondContact CA-O 3.48Å
63	E	96.2	Very high	95.7	Very high	36 Å²	36	74.2 Å²	74.2	17%	0.168	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.2	126.7	165.8	-57	177.4	160.9	0	0	108.9	M41 I43 R71 K72 L74	M41-E63 HydrophobicContact CG-CB 4.42Å; M41-E63 HydrophobicContact SD-CB 4.29Å; M41-E63 HydrophobicContact SD-CG 4.39Å; I43-E63 HydrophobicContact CD1-CB 4.38Å; I43-E63 HydrophobicContact CD1-CG 3.73Å; E63-R71 CarbonylContact O-C 3.44Å; E63-R71 VanDerWaalsContact O-CA 3.28Å; E63-R71 WeakPolarHBondContact O-CA 3.21Å; E63-K72 HydrophobicContact CB-CB 4.29Å; E63-K72 PolarHBondContact N-O 3.27Å; E63-K72 PolarHBondContact O-N 2.68Å; E63-K72 WeakPolarHBondContact OE2-CD 3.48Å; E63-K72 IonicContact OE2-NZ 3.53Å; E63-L74 HydrophobicContact CG-CD1 3.5Å; E63-L74 VanDerWaalsContact CG-CD1 3.5Å; E63-L74 HydrophobicContact CG-CD2 3.97Å; E63-L74 HydrophobicContact CG-CG 3.83Å
64	I	95.8	Very high	95.8	Very high	17 Å²	17	69.4 Å²	69.4	9%	0.087	34%	0.344	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.3	112.8	178.2	-49.3	-61.5	0	0	0	108.6	M41 R42 E44 E62 M66 R71	M41-I64 CarbonylContact C-O 3.48Å; M41-I64 WeakPolarHBondContact CA-O 3.27Å; R42-I64 HydrophobicContact CB-CB 4.48Å; R42-I64 PolarHBondContact N-O 3Å; R42-I64 PolarHBondContact O-N 2.74Å; E44-I64 HydrophobicContact CB-CG1 4.17Å; E44-I64 HydrophobicContact CG-CD1 4.45Å; E44-I64 HydrophobicContact CG-CG1 3.76Å; E62-I64 HydrophobicContact CB-CD1 4.15Å; I64-M66 PolarHBondContact O-N 3.45Å; I64-R71 HydrophobicContact CD1-CB 3.94Å; I64-R71 HydrophobicContact CD1-CG 3.56Å
65	H	95.3	Very high	95.8	Very high	67 Å²	67	67.7 Å²	67.7	31%	0.31	34%	0.343	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.4	115.3	172	-71	-83.2	0	0	0	110.2	K67 T68 K69 N70	H65-K67 VanDerWaalsContact C-N 3.3Å; H65-K67 PolarHBondContact O-N 3Å; H65-T68 VanDerWaalsContact CB-OG1 3.23Å; H65-T68 WeakPolarHBondContact CB-OG1 3.12Å; H65-K69 WeakPolarHBondContact O-CA 3.45Å; H65-K69 PolarHBondContact O-N 3.25Å; H65-N70 PolarHBondContact N-O 2.87Å
66	M	91.9	Very high	95.9	Very high	75 Å²	75	74 Å²	74	37%	0.369	37%	0.365	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60.2	-35	-173.5	-71.2	-60.4	-38.8	0	0	113.9	N40 R42 I64	N40-M66 PolarHBondContact O-N 2.89Å; R42-M66 VanDerWaalsContact CD-SD 3.55Å; R42-M66 HydrophobicContact CG-CG 4.31Å; R42-M66 HydrophobicContact CG-SD 3.99Å; R42-M66 VanDerWaalsContact CZ-SD 3.53Å; R42-M66 PolarHBondContact NE-SD 2.86Å; I64-M66 PolarHBondContact O-N 3.45Å
67	K	91.9	Very high	95.9	Very high	174 Å²	174	76 Å²	76	76%	0.757	38%	0.375	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.3	-46.6	-176.5	-67.6	-176.8	177.5	177.1	0	112.9	N40 H65	N40-K67 VanDerWaalsContact OD1-CE 3.27Å; N40-K67 WeakPolarHBondContact OD1-CE 3.46Å; H65-K67 VanDerWaalsContact C-N 3.3Å; H65-K67 PolarHBondContact O-N 3Å
68	T	93.3	Very high	95.9	Very high	102 Å²	102	79.6 Å²	79.6	63%	0.626	39%	0.39	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.6	-12.5	-175.1	54.7	0	0	0	0	112.6	H65 N70	H65-T68 VanDerWaalsContact CB-OG1 3.23Å; H65-T68 WeakPolarHBondContact CB-OG1 3.12Å; T68-N70 PolarHBondContact O-N 2.82Å; T68-N70 VanDerWaalsContact O-N 3.09Å; T68-N70 PolarHBondContact OG1-N 2.73Å
69	K	90.3	Very high	95.9	Very high	174 Å²	174	80.5 Å²	80.5	76%	0.757	40%	0.395	S	S	*	.			trans	53.9	21	-170	-57.8	-173.7	177.9	-177	0	113.4	H65	H65-K69 WeakPolarHBondContact O-CA 3.45Å; H65-K69 PolarHBondContact O-N 3.25Å
70	N	94.9	Very high	95.9	Very high	98 Å²	98	85 Å²	85	52%	0.524	41%	0.413	S	S	.	.			trans	-71.5	135.6	175.3	-167.9	-10.8	0	0	0	109.1	H65 T68	H65-N70 PolarHBondContact N-O 2.87Å; T68-N70 PolarHBondContact O-N 2.82Å; T68-N70 VanDerWaalsContact O-N 3.09Å; T68-N70 PolarHBondContact OG1-N 2.73Å
71	R	95.8	Very high	95.9	Very high	120 Å²	120	80.8 Å²	80.8	45%	0.453	39%	0.393	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.4	120	177.1	-49	-175.3	87.3	-158.1	14.6	108	E44 E62 E63 I64	E44-R71 IonicContact OE2-CZ 3.81Å; E44-R71 IonicContact OE2-NH2 2.73Å; E44-R71 PolarHBondContact OE2-NH2 3.26Å; E62-R71 IonicContact OE1-NH1 3.59Å; E62-R71 IonicContact OE2-CZ 2.79Å; E62-R71 IonicContact OE2-NE 3.27Å; E62-R71 PolarHBondContact OE2-NE 2.92Å; E62-R71 IonicContact OE2-NH1 3.03Å; E62-R71 PolarHBondContact OE2-NH1 3.06Å; E62-R71 IonicContact OE2-NH2 2.95Å; E62-R71 PolarHBondContact OE2-NH2 2.73Å; E63-R71 CarbonylContact O-C 3.44Å; E63-R71 VanDerWaalsContact O-CA 3.28Å; E63-R71 WeakPolarHBondContact O-CA 3.21Å; I64-R71 HydrophobicContact CD1-CB 3.94Å; I64-R71 HydrophobicContact CD1-CG 3.56Å
72	K	96.8	Very high	95.9	Very high	109 Å²	109	86 Å²	86	47%	0.474	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	118.8	177.1	-179.3	-178.7	163.9	-155.2	0	109.5	E62 E63	E62-K72 CarbonylContact C-O 3.57Å; E62-K72 VanDerWaalsContact CA-O 3.24Å; E62-K72 WeakPolarHBondContact CA-O 3.48Å; E63-K72 HydrophobicContact CB-CB 4.29Å; E63-K72 PolarHBondContact N-O 3.27Å; E63-K72 PolarHBondContact O-N 2.68Å; E63-K72 WeakPolarHBondContact OE2-CD 3.48Å; E63-K72 IonicContact OE2-NZ 3.53Å
73	P	97.3	Very high	95.8	Very high	102 Å²	102	87.2 Å²	87.2	66%	0.662	43%	0.429	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-69	133.9	178.7	28.6	-33.7	0	0	0	110.7
74	L	97.1	Very high	95.8	Very high	58 Å²	58	87.1 Å²	87.1	30%	0.304	43%	0.429	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	-23.2	174	-62	-178.1	0	0	0	112.3	I43 A61 E63 I77	I43-L74 HydrophobicContact CD1-CD1 4.14Å; A61-L74 HydrophobicContact CB-CB 4.32Å; A61-L74 PolarHBondContact O-N 3.03Å; E63-L74 HydrophobicContact CG-CD1 3.5Å; E63-L74 VanDerWaalsContact CG-CD1 3.5Å; E63-L74 HydrophobicContact CG-CD2 3.97Å; E63-L74 HydrophobicContact CG-CG 3.83Å; L74-I77 HydrophobicContact CB-CG2 3.79Å; L74-I77 HydrophobicContact CD1-CD1 3.79Å; L74-I77 HydrophobicContact CD1-CG2 4.34Å
75	G	97	Very high	95.9	Very high	32 Å²	32	90.3 Å²	90.3	33%	0.33	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	76.7	-131	-174.9	0	0	0	0	0	111.1	A61	A61-G75 VanDerWaalsContact CB-O 3.22Å; A61-G75 WeakPolarHBondContact CB-O 3.45Å; A61-G75 PolarHBondContact N-O 3.06Å; A61-G75 PolarHBondContact O-N 2.95Å
76	R	97.8	Very high	95.9	Very high	165 Å²	165	90.5 Å²	90.5	62%	0.623	45%	0.453	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.6	121.9	-179.3	-172.8	172.5	-66.8	175.7	-1.9	111.2	I48 V57 L58 D59	I48-R76 HydrophobicContact CD1-CG 4.32Å; V57-R76 HydrophobicContact CG1-CG 4.39Å; L58-R76 WeakPolarHBondContact O-CA 3.49Å; D59-R76 IonicContact OD1-CZ 3.47Å; D59-R76 IonicContact OD1-NE 2.87Å; D59-R76 PolarHBondContact OD1-NE 2.99Å; D59-R76 IonicContact OD1-NH2 3.2Å; D59-R76 PolarHBondContact OD1-NH2 3.06Å; D59-R76 IonicContact OD2-CZ 3.74Å; D59-R76 IonicContact OD2-NE 3.8Å; D59-R76 IonicContact OD2-NH2 2.84Å; D59-R76 PolarHBondContact OD2-NH2 2.76Å
77	I	97.9	Very high	96.1	Very high	40 Å²	40	88.6 Å²	88.6	21%	0.205	44%	0.444	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.6	158.7	-178.2	67.7	175	0	0	0	111.8	I43 V57 L58 A61 L74	I43-I77 HydrophobicContact CG2-CD1 4.02Å; V57-I77 WeakPolarHBondContact CA-O 3.22Å; L58-I77 HydrophobicContact CB-CG1 4.11Å; L58-I77 PolarHBondContact N-O 3.14Å; L58-I77 PolarHBondContact O-N 3.25Å; A61-I77 HydrophobicContact CB-CD1 3.76Å; A61-I77 HydrophobicContact CB-CG1 3.78Å; L74-I77 HydrophobicContact CB-CG2 3.79Å; L74-I77 HydrophobicContact CD1-CD1 3.79Å; L74-I77 HydrophobicContact CD1-CG2 4.34Å
78	M	97.6	Very high	96.3	Very high	125 Å²	125	84.5 Å²	84.5	62%	0.616	43%	0.427	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-107.4	117.8	165.1	-176.8	-175.6	178.7	0	0	108.4	N55 L56	N55-M78 HydrophobicContact CB-CE 3.62Å; L56-M78 CarbonylContact O-C 3.53Å; L56-M78 WeakPolarHBondContact O-CA 3.22Å
79	L	97.4	Very high	96.3	Very high	20 Å²	20	81.4 Å²	81.4	11%	0.105	41%	0.41	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.3	128.4	174.8	-176.6	65.4	0	0	0	109.3	V33 L35 N55 L56 L58 N83 I84	V33-L79 HydrophobicContact CB-CD2 4.07Å; V33-L79 HydrophobicContact CG1-CD2 3.65Å; V33-L79 HydrophobicContact CG2-CD2 4.09Å; L35-L79 HydrophobicContact CD2-CD1 4.14Å; L35-L79 HydrophobicContact CD2-CD2 4.47Å; N55-L79 CarbonylContact C-O 3.53Å; N55-L79 VanDerWaalsContact CA-O 3.3Å; N55-L79 WeakPolarHBondContact CA-O 3.44Å; L56-L79 PolarHBondContact N-O 2.74Å; L56-L79 PolarHBondContact O-N 3.44Å; L58-L79 HydrophobicContact CD1-CD2 4.49Å; L79-N83 HydrophobicContact CD1-CB 4.43Å; L79-I84 HydrophobicContact CD2-CD1 4.42Å; L79-I84 HydrophobicContact CD2-CG1 4.1Å
80	K	97.8	Very high	96.3	Very high	129 Å²	129	75.6 Å²	75.6	56%	0.561	39%	0.389	S	S	*	.			trans	-74	140	177.4	-65.8	-175.5	176.3	-175.5	0	111.2	N55 D82 N83	N55-K80 VanDerWaalsContact OD1-CA 3.27Å; N55-K80 WeakPolarHBondContact OD1-CA 3.3Å; K80-D82 VanDerWaalsContact C-N 3.28Å; K80-D82 WeakPolarHBondContact CB-OD1 3.28Å; K80-D82 PolarHBondContact O-N 3.5Å; K80-N83 PolarHBondContact O-N 2.77Å
81	G	96.6	Very high	95.2	Very high	14 Å²	14	75.7 Å²	75.7	14%	0.144	40%	0.397	C	S	.	.	G	3₁₀ helix	trans	-65.3	-27.6	-175	0	0	0	0	0	114.4	M54 N55 N83 I84	M54-G81 WeakPolarHBondContact O-CA 3.36Å; N55-G81 PolarHBondContact OD1-N 2.9Å; G81-N83 PolarHBondContact O-N 2.92Å; G81-I84 WeakPolarHBondContact O-CB 3.24Å; G81-I84 PolarHBondContact O-N 2.9Å; G81-I84 VanDerWaalsContact O-N 3.11Å
82	D	97.1	Very high	92.9	Very high	110 Å²	110	81.1 Å²	81.1	59%	0.588	44%	0.435	S	S	*	.	G	3₁₀ helix	trans	-61.3	-25.6	174.6	58.4	-5.6	0	0	0	113.6	K80 I84	K80-D82 VanDerWaalsContact C-N 3.28Å; K80-D82 WeakPolarHBondContact CB-OD1 3.28Å; K80-D82 PolarHBondContact O-N 3.5Å; D82-I84 VanDerWaalsContact C-N 3.34Å
83	N	96	Very high	92.7	Very high	65 Å²	65	79.8 Å²	79.8	35%	0.348	43%	0.433	S	S	.	.	G	3₁₀ helix	trans	-87.1	-1.9	178.7	-70.4	-79.1	0	0	0	112.8	L35 Y36 L79 K80 G81	L35-N83 CarbonylContact C-O 3.56Å; L35-N83 VanDerWaalsContact CA-O 3.22Å; L35-N83 WeakPolarHBondContact CA-O 3.33Å; L35-N83 HydrophobicContact CD2-CB 4.46Å; Y36-N83 PolarHBondContact N-O 3Å; L79-N83 HydrophobicContact CD1-CB 4.43Å; K80-N83 PolarHBondContact O-N 2.77Å; G81-N83 PolarHBondContact O-N 2.92Å
84	I	96.8	Very high	92.4	Very high	33 Å²	33	78.6 Å²	78.6	17%	0.169	42%	0.421	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.3	113	-174.1	-57.5	-179.3	0	0	0	110.4	V33 M54 L56 L79 G81 D82 L87	V33-I84 HydrophobicContact CG1-CB 4.35Å; V33-I84 HydrophobicContact CG1-CG1 4Å; V33-I84 HydrophobicContact CG1-CG2 4.02Å; M54-I84 VanDerWaalsContact O-CD1 3.27Å; M54-I84 WeakPolarHBondContact O-CD1 3.24Å; L56-I84 HydrophobicContact CD1-CD1 3.65Å; L56-I84 HydrophobicContact CG-CD1 3.78Å; L79-I84 HydrophobicContact CD2-CD1 4.42Å; L79-I84 HydrophobicContact CD2-CG1 4.1Å; G81-I84 WeakPolarHBondContact O-CB 3.24Å; G81-I84 PolarHBondContact O-N 2.9Å; G81-I84 VanDerWaalsContact O-N 3.11Å; D82-I84 VanDerWaalsContact C-N 3.34Å; I84-L87 HydrophobicContact CG2-CD2 3.78Å; I84-L87 HydrophobicContact CG2-CG 3.94Å
85	T	97	Very high	92.2	Very high	84 Å²	84	79.7 Å²	79.7	52%	0.515	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.7	-44	172	-58.5	0	0	0	0	111.6	W34 L35 Y36	W34-T85 WeakPolarHBondContact O-CB 3.42Å; W34-T85 PolarHBondContact O-N 3.04Å; L35-T85 VanDerWaalsContact C-OG1 3.3Å; L35-T85 PolarHBondContact O-OG1 3.44Å; L35-T85 VanDerWaalsContact O-OG1 3.14Å; Y36-T85 VanDerWaalsContact CA-OG1 3.28Å; Y36-T85 WeakPolarHBondContact CA-OG1 3.28Å; Y36-T85 PolarHBondContact N-OG1 3.32Å
86	L	96.1	Very high	91.9	Very high	72 Å²	72	82.5 Å²	82.5	38%	0.377	43%	0.434	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.5	139.1	-176	-174.3	149.4	0	0	0	110.5	V33 W34 Q88	V33-L86 WeakPolarHBondContact CA-O 3.18Å; W34-L86 HydrophobicContact CB-CB 4Å; W34-L86 HydrophobicContact CD2-CB 4.38Å; W34-L86 HydrophobicContact CD2-CD2 4.47Å; W34-L86 HydrophobicContact CG-CB 4.02Å; W34-L86 HydrophobicContact CG-CD2 4.3Å; W34-L86 PolarHBondContact N-O 2.85Å; L86-Q88 HydrophobicContact CD2-CB 3.66Å
87	L	95.8	Very high	91.5	Very high	35 Å²	35	77.4 Å²	77.4	18%	0.183	42%	0.422	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.1	123.6	169.6	-61	178.9	0	0	0	109.6	I21 I31 V33 M54 L56 I84	I21-L87 HydrophobicContact CD1-CD1 4.39Å; I21-L87 HydrophobicContact CG1-CD1 4.22Å; I31-L87 HydrophobicContact CD1-CD2 3.98Å; V33-L87 HydrophobicContact CB-CD2 4.2Å; V33-L87 HydrophobicContact CG1-CD2 3.9Å; V33-L87 HydrophobicContact CG2-CD2 3.65Å; M54-L87 HydrophobicContact CE-CD1 4.26Å; L56-L87 HydrophobicContact CD1-CD1 4.25Å; L56-L87 HydrophobicContact CD1-CD2 3.82Å; I84-L87 HydrophobicContact CG2-CD2 3.78Å; I84-L87 HydrophobicContact CG2-CG 3.94Å
88	Q	95.1	Very high	91.1	Very high	87 Å²	87	79.9 Å²	79.9	41%	0.407	44%	0.436	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.1	131.6	179.8	-174.7	175.5	-8.9	0	0	110	I31 Q32 L86 V90	I31-Q88 CarbonylContact C-O 3.58Å; I31-Q88 VanDerWaalsContact CA-O 3.27Å; I31-Q88 WeakPolarHBondContact CA-O 3.23Å; Q32-Q88 PolarHBondContact N-O 3.47Å; Q32-Q88 PolarHBondContact O-N 3.23Å; L86-Q88 HydrophobicContact CD2-CB 3.66Å; Q88-V90 PolarHBondContact O-N 3.09Å
89	S	93.5	Very high	90.6	Very high	37 Å²	37	76.6 Å²	76.6	26%	0.259	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.8	130.4	166.6	-172.8	0	0	0	0	109.7	S91	S89-S91 PolarHBondContact O-N 2.82Å
90	V	90.3	Very high	90.1	Very high	53 Å²	53	81 Å²	81	32%	0.321	45%	0.448	S	S	.	.			trans	-88.7	90.2	171.6	-142.3	0	0	0	0	106.6	R30 I31 Q32 E44 Q88	R30-V90 HydrophobicContact CG-CG2 4.46Å; R30-V90 WeakPolarHBondContact O-CG2 3.27Å; R30-V90 PolarHBondContact O-N 3.48Å; I31-V90 VanDerWaalsContact C-CG2 3.5Å; Q32-V90 HydrophobicContact CB-CG2 3.73Å; E44-V90 HydrophobicContact CG-CG2 4.37Å; Q88-V90 PolarHBondContact O-N 3.09Å
91	S	73.1	Confident	89.4	Confident	99 Å²	99	77 Å²	77	69%	0.692	44%	0.438	S	S	*	.			trans	-77.4	123.5	171.3	-45.8	0	0	0	0	108	S89	S89-S91 PolarHBondContact O-N 2.82Å
92	N	46	Very low	88.8	Confident	235 Å²	235	82.7 Å²	82.7	100%	1.257	47%	0.465	S	S	*	.			trans	-70.1	0	156.4	-78.6	-17.9	0	0	0	109.7

Retrieved 92 of 92 residues in 27.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).