A0A087XPP2_POEFO Loading...

Protein preY, mitochondrial

AlphaFold DB (A0A3B3VDS5), UniProt , Accession A0A087XPP2, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 114 aa.

						>A0A087XPP2_POEFO|A0A087XPP2
MLKNVLSRLVTETGRVHRHVNRASSIQTLTTCRVSVRSFAEVKDEVQLPFDSSLLEVLVCPLSKKPLRYDANTNELINEELGIAYPIVDGIPNMIPQEARLIQKDTQTPKTPAE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46	Very low	48.1	Very low	240 Å²	240	159 Å²	159	100%	1.182	83%	0.826	S	S	*	*				0	79.8	0	-72.7	172.3	156.8	0	0	106.9
2	L	48.8	Very low	47.9	Very low	161 Å²	161	160.5 Å²	160.5	84%	0.843	83%	0.826	S	S	*	*				51.9	127.7	97.5	-81.9	165	0	0	0	113.4
3	K	46.5	Very low	48.2	Very low	188 Å²	188	158.3 Å²	158.3	82%	0.817	83%	0.825	S	S	*	*			trans	96.6	109.2	169	-58.9	171.7	-170.2	-174.6	0	111.6
4	N	49.5	Very low	47.9	Very low	158 Å²	158	151.9 Å²	151.9	85%	0.845	82%	0.816	S	S	*	*			cis	-152	128.3	38.7	-86.6	-15.2	0	0	0	113
5	V	51.2	Low	48.1	Very low	125 Å²	125	156.1 Å²	156.1	76%	0.758	82%	0.816	S	S	*	*			trans	-87.2	140.4	168.2	167.7	0	0	0	0	107.2
6	L	50.4	Low	48.2	Very low	151 Å²	151	154.4 Å²	154.4	79%	0.791	81%	0.813	S	S	*	*			trans	67.6	133.3	157.9	-96.8	82.9	0	0	0	120
7	S	39.6	Very low	48.2	Very low	90 Å²	90	154.7 Å²	154.7	63%	0.629	81%	0.809	S	S	*	*			trans	88.7	133.6	141.5	85.2	0	0	0	0	113.3
8	R	48.3	Very low	48.5	Very low	224 Å²	224	158.2 Å²	158.2	85%	0.845	81%	0.81	S	S	*	*			cis	-154.8	154.7	33.4	-72.7	176.2	-179.3	-166.9	-6.2	109.4
9	L	52.5	Low	48.4	Very low	161 Å²	161	158.2 Å²	158.2	84%	0.843	81%	0.806	S	S	*	*			trans	-21.2	137.8	151.4	-73.9	67.3	0	0	0	112
10	V	47.7	Very low	48.9	Very low	112 Å²	112	156.5 Å²	156.5	68%	0.679	80%	0.803	S	S	*	*				-176.8	114	106.1	153.7	0	0	0	0	106.7	E12	V10-E12 VanDerWaalsContact C-N 3.33Å; V10-E12 HydrophobicContact CG1-CB 4.11Å; V10-E12 HydrophobicContact CG1-CG 3.72Å; V10-E12 PolarHBondContact O-N 2.8Å; V10-E12 VanDerWaalsContact O-N 3.09Å
11	T	49.2	Very low	49	Very low	139 Å²	139	155.3 Å²	155.3	85%	0.853	80%	0.799	S	S	*	*			trans	-65.5	93.7	157.1	37.5	0	0	0	0	107.9
12	E	45.2	Very low	49.4	Very low	177 Å²	177	155.3 Å²	155.3	83%	0.827	79%	0.785	S	S	*	*			trans	-93.2	94.4	161.3	-102.2	-168	146.7	0	0	108.8	V10 G14	V10-E12 VanDerWaalsContact C-N 3.33Å; V10-E12 HydrophobicContact CG1-CB 4.11Å; V10-E12 HydrophobicContact CG1-CG 3.72Å; V10-E12 PolarHBondContact O-N 2.8Å; V10-E12 VanDerWaalsContact O-N 3.09Å; E12-G14 VanDerWaalsContact C-N 3.32Å; E12-G14 PolarHBondContact O-N 3.02Å; E12-G14 VanDerWaalsContact O-N 3.1Å
13	T	51.3	Low	49.5	Very low	132 Å²	132	152 Å²	152	81%	0.81	78%	0.781	S	S	*	*			trans	-72.9	94.2	159.7	41.2	0	0	0	0	107.1	R15	T13-R15 PolarHBondContact O-N 2.86Å
14	G	44.2	Very low	49.8	Very low	68 Å²	68	148.7 Å²	148.7	70%	0.701	78%	0.782	S	S	*	*			trans	-60.8	95	172	0	0	0	0	0	110.5	E12 V16	E12-G14 VanDerWaalsContact C-N 3.32Å; E12-G14 PolarHBondContact O-N 3.02Å; E12-G14 VanDerWaalsContact O-N 3.1Å; G14-V16 PolarHBondContact O-N 3.44Å
15	R	51.2	Low	50	Low	215 Å²	215	145.6 Å²	145.6	81%	0.811	77%	0.772	S	S	*	*			trans	-71.8	92.1	172.2	-166.5	-177.7	-170.7	105.9	-2.4	108.3	T13 H17	T13-R15 PolarHBondContact O-N 2.86Å; R15-H17 PolarHBondContact O-N 2.8Å
16	V	49.7	Very low	50.3	Low	129 Å²	129	147.2 Å²	147.2	78%	0.782	78%	0.775	S	S	*	*			trans	-68.5	99.2	172.4	179.4	0	0	0	0	108.5	G14 R18	G14-V16 PolarHBondContact O-N 3.44Å; V16-R18 PolarHBondContact O-N 2.78Å; V16-R18 VanDerWaalsContact O-N 3.13Å
17	H	48	Very low	50.5	Low	160 Å²	160	146.9 Å²	146.9	74%	0.741	77%	0.769	S	S	*	*			trans	-72.1	98.5	163.3	-102	88.6	0	0	0	108.1	R15 H19	R15-H17 PolarHBondContact O-N 2.8Å; H17-H19 PolarHBondContact O-N 2.76Å
18	R	53	Low	51.4	Low	217 Å²	217	148.6 Å²	148.6	82%	0.819	78%	0.777	S	S	*	*			trans	-74.6	96.5	170.2	-165.6	-179.5	-80.7	167.2	-5.8	108	V16 V20	V16-R18 PolarHBondContact O-N 2.78Å; V16-R18 VanDerWaalsContact O-N 3.13Å; R18-V20 PolarHBondContact O-N 3.38Å
19	H	47.2	Very low	51.8	Low	158 Å²	158	144.1 Å²	144.1	73%	0.731	77%	0.768	S	S	*	*			trans	-67.3	110.9	170.7	-171.9	-87.2	0	0	0	108.8	H17 N21	H17-H19 PolarHBondContact O-N 2.76Å; H19-N21 PolarHBondContact CE1-OD1 3.03Å; H19-N21 PolarHBondContact ND1-OD1 2.82Å
20	V	57.8	Low	52	Low	124 Å²	124	142.6 Å²	142.6	75%	0.752	77%	0.766	S	S	*	*			trans	-88.7	108.9	174.8	-156.6	0	0	0	0	107.2	R18 R22	R18-V20 PolarHBondContact O-N 3.38Å; V20-R22 PolarHBondContact O-N 2.99Å
21	N	51.3	Low	52.2	Low	133 Å²	133	142.7 Å²	142.7	71%	0.711	77%	0.767	S	S	*	*			trans	-63.3	116.8	173.6	-96.9	-19.1	0	0	0	109.4	H19 A23	H19-N21 PolarHBondContact CE1-OD1 3.03Å; H19-N21 PolarHBondContact ND1-OD1 2.82Å; N21-A23 VanDerWaalsContact C-N 3.35Å; N21-A23 PolarHBondContact O-N 2.94Å
22	R	54.4	Low	52.3	Low	240 Å²	240	141.3 Å²	141.3	91%	0.906	76%	0.762	S	S	*	*			trans	-77.2	85.7	175.5	-152.3	-179.1	-166.9	-162.7	3.5	108.3	V20 S24	V20-R22 PolarHBondContact O-N 2.99Å; R22-S24 PolarHBondContact O-N 3.07Å
23	A	52.2	Low	52.9	Low	91 Å²	91	144.1 Å²	144.1	75%	0.752	77%	0.765	S	S	*	*			trans	-85.2	106.7	168.1	0	0	0	0	0	108.8	N21 S25	N21-A23 VanDerWaalsContact C-N 3.35Å; N21-A23 PolarHBondContact O-N 2.94Å; A23-S25 PolarHBondContact O-N 3.37Å; A23-S25 VanDerWaalsContact O-N 3.1Å
24	S	52.9	Low	53.2	Low	119 Å²	119	143.5 Å²	143.5	83%	0.832	76%	0.761	S	S	*	*			trans	-68	98.1	169.8	-54.3	0	0	0	0	108.9	R22	R22-S24 PolarHBondContact O-N 3.07Å
25	S	52.1	Low	53.8	Low	93 Å²	93	145.3 Å²	145.3	65%	0.65	76%	0.763	S	S	*	*			trans	-126.8	100.6	164.6	-165.5	0	0	0	0	107.7	A23 Q27	A23-S25 PolarHBondContact O-N 3.37Å; A23-S25 VanDerWaalsContact O-N 3.1Å; S25-Q27 VanDerWaalsContact C-N 3.27Å; S25-Q27 PolarHBondContact O-N 2.86Å
26	I	58	Low	54.1	Low	159 Å²	159	140.5 Å²	140.5	82%	0.815	76%	0.757	S	S	*	*			trans	-73.6	89	173.1	-55.7	175.6	0	0	0	105.8
27	Q	55.6	Low	54.8	Low	143 Å²	143	144.9 Å²	144.9	67%	0.668	76%	0.76	S	S	*	*			trans	-88.6	104.2	159.8	-75.7	-175.3	-9.1	0	0	107	S25 L29	S25-Q27 VanDerWaalsContact C-N 3.27Å; S25-Q27 PolarHBondContact O-N 2.86Å; Q27-L29 HydrophobicContact CB-CG 4.27Å; Q27-L29 PolarHBondContact O-N 3.22Å
28	T	57.1	Low	55.5	Low	127 Å²	127	142 Å²	142	78%	0.779	76%	0.758	S	S	*	*			trans	-64.9	79.7	167.9	-45.8	0	0	0	0	108.1	T30	T28-T30 PolarHBondContact O-N 2.76Å
29	L	56.7	Low	55.8	Low	129 Å²	129	141 Å²	141	68%	0.675	76%	0.759	S	S	*	*			trans	-83.8	109.8	169.2	-66.3	177.4	0	0	0	106.9	Q27 T31	Q27-L29 HydrophobicContact CB-CG 4.27Å; Q27-L29 PolarHBondContact O-N 3.22Å; L29-T31 VanDerWaalsContact C-N 3.3Å; L29-T31 PolarHBondContact O-N 2.86Å
30	T	57.3	Low	56.5	Low	129 Å²	129	136.8 Å²	136.8	79%	0.791	75%	0.752	S	S	*	*			trans	-47.4	100.9	160.4	-56.4	0	0	0	0	107.2	T28 C32	T28-T30 PolarHBondContact O-N 2.76Å; T30-C32 VanDerWaalsContact C-N 3.35Å; T30-C32 PolarHBondContact O-N 2.96Å
31	T	51.3	Low	56.4	Low	115 Å²	115	139 Å²	139	71%	0.706	75%	0.754	S	S	*	*			trans	-63.9	101.9	177.3	55.8	0	0	0	0	106.1	L29 R33	L29-T31 VanDerWaalsContact C-N 3.3Å; L29-T31 PolarHBondContact O-N 2.86Å; T31-R33 PolarHBondContact O-N 2.85Å
32	C	51.9	Low	56.8	Low	110 Å²	110	138.2 Å²	138.2	74%	0.743	75%	0.754	S	S	*	*			trans	-54	103.8	154.3	-72.3	0	0	0	0	104.7	T30 V34	T30-C32 VanDerWaalsContact C-N 3.35Å; T30-C32 PolarHBondContact O-N 2.96Å; C32-V34 PolarHBondContact O-N 2.76Å
33	R	57.5	Low	57.1	Low	235 Å²	235	133.3 Å²	133.3	89%	0.887	74%	0.739	S	S	*	*			trans	-64.3	87.6	168.8	-89.3	-175.4	160.8	-171.3	-4.6	105.4	T31 S35	T31-R33 PolarHBondContact O-N 2.85Å; R33-S35 VanDerWaalsContact C-N 3.29Å; R33-S35 PolarHBondContact O-N 3.33Å
34	V	57.2	Low	57.7	Low	120 Å²	120	135.3 Å²	135.3	73%	0.727	74%	0.737	S	S	*	*			trans	-62.3	104.5	164.6	-177.6	0	0	0	0	104.1	C32 V36	C32-V34 PolarHBondContact O-N 2.76Å; V34-V36 PolarHBondContact O-N 2.74Å
35	S	58.5	Low	58.3	Low	106 Å²	106	135.8 Å²	135.8	74%	0.741	73%	0.726	S	S	*	*			trans	-65.8	89.7	173.5	-179.2	0	0	0	0	106.8	R33 R37	R33-S35 VanDerWaalsContact C-N 3.29Å; R33-S35 PolarHBondContact O-N 3.33Å; S35-R37 PolarHBondContact O-N 2.92Å
36	V	57.6	Low	59.2	Low	113 Å²	113	136 Å²	136	69%	0.685	72%	0.724	S	S	*	*			trans	-62.1	109.9	168.9	-160.8	0	0	0	0	105	V34 S38	V34-V36 PolarHBondContact O-N 2.74Å; V36-S38 PolarHBondContact O-N 2.96Å
37	R	63.2	Low	59.6	Low	222 Å²	222	136.5 Å²	136.5	84%	0.838	72%	0.722	S	S	*	*			trans	-57.1	117.1	170.8	-69.5	-176.9	176.3	-176.6	-1.6	105.8	S35 F39	S35-R37 PolarHBondContact O-N 2.92Å; R37-F39 PolarHBondContact O-N 3.44Å
38	S	62.8	Low	60.8	Low	100 Å²	100	135 Å²	135	70%	0.699	72%	0.718	S	S	*	*			trans	-56.3	123.5	176.5	-178.6	0	0	0	0	108	V36 A40	V36-S38 PolarHBondContact O-N 2.96Å; S38-A40 PolarHBondContact O-N 2.92Å; S38-A40 WeakPolarHBondContact OG-CB 3.2Å; S38-A40 PolarHBondContact OG-N 3.32Å
39	F	60	Low	62.2	Low	194 Å²	194	134.5 Å²	134.5	85%	0.851	72%	0.717	S	S	*	*			trans	-72.1	20.7	171.7	-74	-86.5	0	0	0	112.3	R37 E41	R37-F39 PolarHBondContact O-N 3.44Å; F39-E41 PolarHBondContact O-N 3.24Å
40	A	60.9	Low	63.9	Low	70 Å²	70	129.2 Å²	129.2	58%	0.579	69%	0.689	S	S	*	*			trans	-69.1	78.2	171	0	0	0	0	0	108.9	S38 V42	S38-A40 PolarHBondContact O-N 2.92Å; S38-A40 WeakPolarHBondContact OG-CB 3.2Å; S38-A40 PolarHBondContact OG-N 3.32Å; A40-V42 PolarHBondContact O-N 3.2Å
41	E	56.1	Low	65.6	Low	171 Å²	171	127.1 Å²	127.1	80%	0.799	67%	0.673	S	S	*	*			trans	6.4	76.6	147	-143.8	163.7	133.3	0	0	114	F39 K43	F39-E41 PolarHBondContact O-N 3.24Å; E41-K43 VanDerWaalsContact C-N 3.28Å; E41-K43 PolarHBondContact O-N 3.19Å; E41-K43 VanDerWaalsContact O-N 3.15Å
42	V	60.6	Low	67.6	Low	117 Å²	117	125 Å²	125	71%	0.709	66%	0.663	S	S	*	*			trans	-76.4	95.2	156.1	-177	0	0	0	0	104.2	A40 D44	A40-V42 PolarHBondContact O-N 3.2Å; V42-D44 PolarHBondContact O-N 3.11Å
43	K	59.5	Low	69.5	Low	136 Å²	136	123.5 Å²	123.5	59%	0.591	65%	0.653	S	S	*	*			trans	-69.7	89.8	167	-161	164.6	168.8	-114.7	0	105.4	E41 E45	E41-K43 VanDerWaalsContact C-N 3.28Å; E41-K43 PolarHBondContact O-N 3.19Å; E41-K43 VanDerWaalsContact O-N 3.15Å; K43-E45 WeakPolarHBondContact CD-OE1 3.2Å; K43-E45 WeakPolarHBondContact CE-OE1 3.33Å; K43-E45 WeakPolarHBondContact CE-OE2 3.15Å; K43-E45 VanDerWaalsContact CG-CD 3.47Å; K43-E45 HydrophobicContact CG-CG 4.23Å; K43-E45 WeakPolarHBondContact CG-OE1 3.38Å; K43-E45 IonicContact NZ-OE1 2.67Å; K43-E45 PolarHBondContact NZ-OE1 2.8Å; K43-E45 IonicContact NZ-OE2 2.78Å; K43-E45 PolarHBondContact NZ-OE2 2.93Å; K43-E45 PolarHBondContact O-N 3.15Å
44	D	65.6	Low	71.2	Confident	134 Å²	134	116 Å²	116	72%	0.717	63%	0.631	S	S	*	*			trans	-64.6	88.5	165.9	-97.2	-40.7	0	0	0	106	V42 V46	V42-D44 PolarHBondContact O-N 3.11Å; D44-V46 PolarHBondContact O-N 2.84Å
45	E	64.7	Low	73	Confident	129 Å²	129	112.4 Å²	112.4	60%	0.603	61%	0.607	S	S	*	*			trans	-71.9	60.6	177.5	-52.2	-78	178.4	0	0	109.8	K43 Q47	K43-E45 WeakPolarHBondContact CD-OE1 3.2Å; K43-E45 WeakPolarHBondContact CE-OE1 3.33Å; K43-E45 WeakPolarHBondContact CE-OE2 3.15Å; K43-E45 VanDerWaalsContact CG-CD 3.47Å; K43-E45 HydrophobicContact CG-CG 4.23Å; K43-E45 WeakPolarHBondContact CG-OE1 3.38Å; K43-E45 IonicContact NZ-OE1 2.67Å; K43-E45 PolarHBondContact NZ-OE1 2.8Å; K43-E45 IonicContact NZ-OE2 2.78Å; K43-E45 PolarHBondContact NZ-OE2 2.93Å; K43-E45 PolarHBondContact O-N 3.15Å; E45-Q47 PolarHBondContact O-N 2.98Å
46	V	71.9	Confident	74.6	Confident	98 Å²	98	115.9 Å²	115.9	59%	0.594	61%	0.612	S	S	*	*			trans	-89	102.6	170.5	-176.8	0	0	0	0	106.4	D44 L48	D44-V46 PolarHBondContact O-N 2.84Å; V46-L48 PolarHBondContact O-N 2.82Å
47	Q	64.9	Low	76.3	Confident	169 Å²	169	116.2 Å²	116.2	79%	0.79	61%	0.613	S	S	*	*			trans	-64.9	104.2	167.7	-69.3	-158.2	-22.2	0	0	108.1	E45 P49	E45-Q47 PolarHBondContact O-N 2.98Å; Q47-P49 WeakPolarHBondContact O-CD 3.45Å
48	L	81.8	Confident	77.9	Confident	111 Å²	111	107.3 Å²	107.3	58%	0.581	58%	0.583	S	S	*	*	P	Polyproline II helix	trans	-71	123.9	175	-87.3	97.5	0	0	0	109.2	V46 G90	V46-L48 PolarHBondContact O-N 2.82Å; L48-G90 WeakPolarHBondContact O-CA 3.32Å; L48-G90 PolarHBondContact O-N 2.78Å
49	P	86.6	Confident	79.5	Confident	117 Å²	117	105.9 Å²	105.9	76%	0.76	57%	0.569	S	S	*	*	P	Polyproline II helix	trans	-66.9	146.1	173.4	28.3	-33.1	0	0	0	110.2	Q47	Q47-P49 WeakPolarHBondContact O-CD 3.45Å
50	F	93	Very high	81.3	Confident	17 Å²	17	96.7 Å²	96.7	8%	0.075	53%	0.529	C	S	.	.	P	Polyproline II helix	trans	-70.4	136.4	173.5	179.1	-106.5	0	0	0	110.9	L54 L55 Y69 L76 I87 P92	F50-L54 HydrophobicContact CE2-CD1 4.22Å; F50-L54 HydrophobicContact CZ-CB 4.36Å; F50-L55 HydrophobicContact CE1-CD2 4.27Å; F50-L55 HydrophobicContact CE1-CG 4.41Å; F50-L55 HydrophobicContact CZ-CD2 4.48Å; F50-Y69 HydrophobicContact CB-CE2 4.24Å; F50-Y69 HydrophobicContact CD1-CD1 4.07Å; F50-Y69 AromaticContact CD1-CD2 3.79Å; F50-Y69 HydrophobicContact CD1-CD2 3.79Å; F50-Y69 HydrophobicContact CD1-CE1 4.09Å; F50-Y69 AromaticContact CD1-CE2 3.83Å; F50-Y69 HydrophobicContact CD1-CE2 3.83Å; F50-Y69 AromaticContact CD1-CG 3.92Å; F50-Y69 HydrophobicContact CD1-CG 3.92Å; F50-Y69 AromaticContact CD1-CZ 3.97Å; F50-Y69 HydrophobicContact CE1-CD2 4.19Å; F50-Y69 HydrophobicContact CE1-CG 4.15Å; F50-Y69 HydrophobicContact CG-CE2 4.31Å; F50-L76 HydrophobicContact CE1-CD2 3.93Å; F50-L76 HydrophobicContact CZ-CD2 3.98Å; F50-I87 HydrophobicContact CB-CD1 4Å; F50-I87 HydrophobicContact CB-CG2 4.23Å; F50-I87 HydrophobicContact CD1-CD1 3.97Å; F50-I87 HydrophobicContact CD2-CD1 3.9Å; F50-I87 HydrophobicContact CD2-CG1 4.42Å; F50-I87 HydrophobicContact CD2-CG2 4.41Å; F50-I87 HydrophobicContact CE1-CD1 4.47Å; F50-I87 HydrophobicContact CE2-CD1 4.41Å; F50-I87 HydrophobicContact CG-CD1 3.66Å; F50-P92 HydrophobicContact CD2-CG 4.04Å; F50-P92 HydrophobicContact CE2-CG 3.52Å; F50-P92 HydrophobicContact CZ-CG 4.45Å
51	D	92.9	Very high	83	Confident	85 Å²	85	95.2 Å²	95.2	46%	0.455	51%	0.514	S	S	.	.			trans	-88	110	176.8	-176.1	1	0	0	0	111.2	S53 L54	D51-S53 PolarHBondContact O-N 3.09Å; D51-S53 WeakPolarHBondContact OD1-CB 3.38Å; D51-S53 PolarHBondContact OD1-N 3.23Å; D51-L54 HydrophobicContact CB-CD1 4.18Å; D51-L54 HydrophobicContact CB-CG 4.21Å; D51-L54 WeakPolarHBondContact O-CB 3.21Å; D51-L54 WeakPolarHBondContact O-CG 3.31Å; D51-L54 PolarHBondContact O-N 2.84Å
52	S	91.6	Very high	84.9	Confident	71 Å²	71	91.8 Å²	91.8	50%	0.497	50%	0.5	S	S	.	.	G	3₁₀ helix	trans	-63.7	-21.4	178.3	51.9	0	0	0	0	114.2	L54 L55	S52-L54 PolarHBondContact O-N 2.93Å; S52-L55 WeakPolarHBondContact O-CB 3.34Å; S52-L55 VanDerWaalsContact O-CG 3.31Å; S52-L55 WeakPolarHBondContact O-CG 3.48Å; S52-L55 PolarHBondContact O-N 2.89Å; S52-L55 VanDerWaalsContact O-N 3.11Å
53	S	92.1	Very high	86.5	Confident	78 Å²	78	87.7 Å²	87.7	55%	0.545	48%	0.477	S	S	.	.	G	3₁₀ helix	trans	-63.6	-20.9	176.2	-69.1	0	0	0	0	112.5	D51 L55	D51-S53 PolarHBondContact O-N 3.09Å; D51-S53 WeakPolarHBondContact OD1-CB 3.38Å; D51-S53 PolarHBondContact OD1-N 3.23Å; S53-L55 PolarHBondContact O-N 2.82Å
54	L	93.5	Very high	88.3	Confident	78 Å²	78	88 Å²	88	41%	0.408	48%	0.478	S	S	.	.	G	3₁₀ helix	trans	-68.9	-18.6	175.7	-62.1	175.1	0	0	0	113.4	F50 D51 S52 E56 V57 L58	F50-L54 HydrophobicContact CE2-CD1 4.22Å; F50-L54 HydrophobicContact CZ-CB 4.36Å; D51-L54 HydrophobicContact CB-CD1 4.18Å; D51-L54 HydrophobicContact CB-CG 4.21Å; D51-L54 WeakPolarHBondContact O-CB 3.21Å; D51-L54 WeakPolarHBondContact O-CG 3.31Å; D51-L54 PolarHBondContact O-N 2.84Å; S52-L54 PolarHBondContact O-N 2.93Å; L54-E56 PolarHBondContact O-N 2.67Å; L54-E56 VanDerWaalsContact O-N 3.14Å; L54-V57 VanDerWaalsContact O-CG2 3.26Å; L54-V57 WeakPolarHBondContact O-CG2 3.38Å; L54-V57 PolarHBondContact O-N 2.78Å; L54-V57 VanDerWaalsContact O-N 3.12Å; L54-L58 WeakPolarHBondContact O-CB 3.39Å; L54-L58 PolarHBondContact O-N 2.88Å
55	L	94.8	Very high	89.7	Confident	45 Å²	45	86.1 Å²	86.1	24%	0.236	46%	0.464	C	S	.	.	G	3₁₀ helix	trans	-61.8	-22	-179.4	-66.4	174	0	0	0	113.2	F50 S52 S53 V57 L76	F50-L55 HydrophobicContact CE1-CD2 4.27Å; F50-L55 HydrophobicContact CE1-CG 4.41Å; F50-L55 HydrophobicContact CZ-CD2 4.48Å; S52-L55 WeakPolarHBondContact O-CB 3.34Å; S52-L55 VanDerWaalsContact O-CG 3.31Å; S52-L55 WeakPolarHBondContact O-CG 3.48Å; S52-L55 PolarHBondContact O-N 2.89Å; S52-L55 VanDerWaalsContact O-N 3.11Å; S53-L55 PolarHBondContact O-N 2.82Å; L55-V57 VanDerWaalsContact C-N 3.28Å; L55-V57 PolarHBondContact O-N 2.98Å; L55-L76 HydrophobicContact CD2-CD2 3.83Å
56	E	92.8	Very high	91.2	Very high	179 Å²	179	84.7 Å²	84.7	84%	0.836	47%	0.465	S	S	*	.	G	3₁₀ helix	trans	-66.7	-29.6	177.2	-64.6	-177.7	-175.1	0	0	113	L54	L54-E56 PolarHBondContact O-N 2.67Å; L54-E56 VanDerWaalsContact O-N 3.14Å
57	V	93.8	Very high	92.4	Very high	119 Å²	119	80.6 Å²	80.6	72%	0.721	44%	0.44	S	S	*	.	T	Hydrogen-bonded Turn	trans	-109	-16.7	-177.8	-62.5	0	0	0	0	113	L54 L55	L54-V57 VanDerWaalsContact O-CG2 3.26Å; L54-V57 WeakPolarHBondContact O-CG2 3.38Å; L54-V57 PolarHBondContact O-N 2.78Å; L54-V57 VanDerWaalsContact O-N 3.12Å; L55-V57 VanDerWaalsContact C-N 3.28Å; L55-V57 PolarHBondContact O-N 2.98Å
58	L	95.6	Very high	93.9	Very high	36 Å²	36	77.6 Å²	77.6	19%	0.188	42%	0.421	C	S	.	.			trans	-92.4	131.1	-171	-163.6	148.7	0	0	0	111.4	L54 L67 L76 P92 M94	L54-L58 WeakPolarHBondContact O-CB 3.39Å; L54-L58 PolarHBondContact O-N 2.88Å; L58-L67 HydrophobicContact CD2-CD1 3.45Å; L58-L67 VanDerWaalsContact CD2-CD1 3.45Å; L58-L67 HydrophobicContact CD2-CG 4.41Å; L58-L76 HydrophobicContact CD2-CD1 3.84Å; L58-P92 HydrophobicContact CD1-CG 4.39Å; L58-M94 HydrophobicContact CD2-CE 4.01Å
59	V	96.9	Very high	94.6	Very high	70 Å²	70	75 Å²	75	42%	0.424	40%	0.404	S	S	.	.	B	Isolated β-bridge	trans	-131.1	158.4	-178.3	-62.8	0	0	0	0	112	K65 M94	V59-K65 CarbonylContact C-O 3.47Å; V59-K65 WeakPolarHBondContact CA-O 3.4Å; V59-K65 WeakPolarHBondContact CB-O 3.42Å; V59-M94 WeakPolarHBondContact O-CE 3.22Å
60	C	96.8	Very high	95	Very high	0 Å²	0	70.9 Å²	70.9	0%	0	38%	0.376	C	S	.	.			trans	-60.7	134	174.3	-178	0	0	0	0	111.5	L62 S63 K64 K65 L67	C60-L62 PolarHBondContact O-N 3.2Å; C60-S63 VanDerWaalsContact CB-OG 3.22Å; C60-S63 WeakPolarHBondContact CB-OG 3.46Å; C60-S63 PolarHBondContact SG-OG 3.31Å; C60-K64 VanDerWaalsContact O-CA 3.22Å; C60-K64 WeakPolarHBondContact O-CA 3.28Å; C60-K64 PolarHBondContact O-N 3.12Å; C60-K65 PolarHBondContact N-O 3.31Å; C60-L67 HydrophobicContact CB-CD2 3.8Å; C60-L67 HydrophobicContact CB-CG 4.38Å
61	P	96.8	Very high	95	Very high	40 Å²	40	73.5 Å²	73.5	26%	0.26	40%	0.401	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67	-26.5	-179.2	27.9	-36.4	0	0	0	112.3	K64 Y85 M94	P61-K64 WeakPolarHBondContact O-CE 3.48Å; P61-K64 PolarHBondContact O-NZ 3.43Å; P61-Y85 WeakPolarHBondContact CD-OH 3.46Å; P61-Y85 HydrophobicContact CG-CE1 4.15Å; P61-Y85 HydrophobicContact CG-CE2 4.44Å; P61-Y85 VanDerWaalsContact CG-OH 3.29Å; P61-Y85 WeakPolarHBondContact CG-OH 3.43Å; P61-M94 VanDerWaalsContact CD-CE 3.4Å; P61-M94 HydrophobicContact CG-CB 4.49Å; P61-M94 HydrophobicContact CG-CE 4.37Å
62	L	96.1	Very high	95	Very high	98 Å²	98	76.8 Å²	76.8	51%	0.513	42%	0.418	S	S	.	.	T	Hydrogen-bonded Turn	trans	-88.6	-56.3	-178.6	-61.3	179.3	0	0	0	112.5	C60 L81 I83 P96	C60-L62 PolarHBondContact O-N 3.2Å; L62-L81 HydrophobicContact CB-CD1 3.82Å; L62-L81 HydrophobicContact CD1-CD1 4.14Å; L62-I83 HydrophobicContact CD1-CD1 3.94Å; L62-P96 HydrophobicContact CD1-CB 4.2Å; L62-P96 HydrophobicContact CD2-CB 3.97Å; L62-P96 HydrophobicContact CD2-CG 3.81Å; L62-P96 HydrophobicContact CG-CB 4.31Å; L62-P96 HydrophobicContact CG-CG 4.26Å
63	S	95.7	Very high	95.1	Very high	31 Å²	31	77 Å²	77	22%	0.217	42%	0.417	C	S	.	.	T	Hydrogen-bonded Turn	trans	-91.5	-13.6	-173.7	55.7	0	0	0	0	114.3	C60 K65 N78	C60-S63 VanDerWaalsContact CB-OG 3.22Å; C60-S63 WeakPolarHBondContact CB-OG 3.46Å; C60-S63 PolarHBondContact SG-OG 3.31Å; S63-K65 PolarHBondContact O-N 3.14Å; S63-N78 PolarHBondContact OG-ND2 2.65Å; S63-N78 VanDerWaalsContact OG-ND2 3.09Å
64	K	96.2	Very high	95.2	Very high	143 Å²	143	75.8 Å²	75.8	62%	0.622	40%	0.404	S	S	*	.			trans	58.5	20.5	-173.2	-48.4	-52.9	-172.4	-168.5	0	114.1	C60 P61	C60-K64 VanDerWaalsContact O-CA 3.22Å; C60-K64 WeakPolarHBondContact O-CA 3.28Å; C60-K64 PolarHBondContact O-N 3.12Å; P61-K64 WeakPolarHBondContact O-CE 3.48Å; P61-K64 PolarHBondContact O-NZ 3.43Å
65	K	95.5	Very high	95.4	Very high	95 Å²	95	72.8 Å²	72.8	41%	0.413	39%	0.388	S	S	.	.			trans	-93.9	158.7	178.3	-66	-71.6	-171.5	167.7	0	111.3	V59 C60 S63 E80	V59-K65 CarbonylContact C-O 3.47Å; V59-K65 WeakPolarHBondContact CA-O 3.4Å; V59-K65 WeakPolarHBondContact CB-O 3.42Å; C60-K65 PolarHBondContact N-O 3.31Å; S63-K65 PolarHBondContact O-N 3.14Å; K65-E80 WeakPolarHBondContact CE-OE1 3.26Å; K65-E80 WeakPolarHBondContact CG-OE2 3.18Å; K65-E80 IonicContact NZ-OE1 3.82Å
66	P	96	Very high	95.5	Very high	98 Å²	98	70.6 Å²	70.6	64%	0.636	38%	0.377	S	S	*	.	B	Isolated β-bridge	trans	-58.1	155.4	172.6	25.6	-35.2	0	0	0	111.7
67	L	96.6	Very high	95.7	Very high	13 Å²	13	62.4 Å²	62.4	7%	0.068	34%	0.339	C	S	.	.			trans	-113.2	152	177.3	-65	174.5	0	0	0	110.5	L58 C60 L76 I77 N78 Y85 M94	L58-L67 HydrophobicContact CD2-CD1 3.45Å; L58-L67 VanDerWaalsContact CD2-CD1 3.45Å; L58-L67 HydrophobicContact CD2-CG 4.41Å; C60-L67 HydrophobicContact CB-CD2 3.8Å; C60-L67 HydrophobicContact CB-CG 4.38Å; L67-L76 HydrophobicContact CB-CB 4.32Å; L67-L76 HydrophobicContact CD1-CB 3.9Å; L67-L76 HydrophobicContact CD1-CD1 4.12Å; L67-I77 WeakPolarHBondContact CA-O 2.92Å; L67-N78 HydrophobicContact CD2-CB 3.68Å; L67-Y85 HydrophobicContact CD1-CD2 4.48Å; L67-M94 HydrophobicContact CD1-CE 3.4Å; L67-M94 HydrophobicContact CD1-SD 4.17Å
68	R	95.8	Very high	95.8	Very high	105 Å²	105	56.9 Å²	56.9	40%	0.396	31%	0.305	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.9	126.4	170.9	-177.6	176.6	63	73.2	-6	109.2	D70 I77 E79	R68-D70 IonicContact NH1-OD2 3.75Å; R68-I77 PolarHBondContact N-O 3.15Å; R68-I77 PolarHBondContact O-N 3.03Å; R68-E79 IonicContact CZ-OE1 3.51Å; R68-E79 IonicContact NE-OE1 3.95Å; R68-E79 PolarHBondContact NE-OE1 2.99Å
69	Y	96.7	Very high	95.7	Very high	57 Å²	57	60.5 Å²	60.5	22%	0.224	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.8	134.9	170.5	178.6	-129.6	0	0	0	110.7	F50 A71 N74 E75 L76 I87	F50-Y69 HydrophobicContact CB-CE2 4.24Å; F50-Y69 HydrophobicContact CD1-CD1 4.07Å; F50-Y69 AromaticContact CD1-CD2 3.79Å; F50-Y69 HydrophobicContact CD1-CD2 3.79Å; F50-Y69 HydrophobicContact CD1-CE1 4.09Å; F50-Y69 AromaticContact CD1-CE2 3.83Å; F50-Y69 HydrophobicContact CD1-CE2 3.83Å; F50-Y69 AromaticContact CD1-CG 3.92Å; F50-Y69 HydrophobicContact CD1-CG 3.92Å; F50-Y69 AromaticContact CD1-CZ 3.97Å; F50-Y69 HydrophobicContact CE1-CD2 4.19Å; F50-Y69 HydrophobicContact CE1-CG 4.15Å; F50-Y69 HydrophobicContact CG-CE2 4.31Å; Y69-A71 HydrophobicContact CE1-CB 3.99Å; Y69-N74 WeakPolarHBondContact CE2-OD1 3.4Å; Y69-N74 PolarHBondContact OH-OD1 3.34Å; Y69-E75 WeakPolarHBondContact CD2-O 3.43Å; Y69-L76 HydrophobicContact CD2-CD2 4.04Å; Y69-L76 HydrophobicContact CG-CD2 4.48Å; Y69-I87 HydrophobicContact CD2-CD1 3.68Å; Y69-I87 HydrophobicContact CE2-CD1 3.39Å
70	D	94.9	Very high	95.5	Very high	30 Å²	30	62.7 Å²	62.7	16%	0.16	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	108	169.6	-161.3	-35.7	0	0	0	109.7	R68 N72 N74 E75 I77	R68-D70 IonicContact NH1-OD2 3.75Å; D70-N72 PolarHBondContact O-N 3.38Å; D70-N72 WeakPolarHBondContact OD1-CB 3.44Å; D70-N72 PolarHBondContact OD1-N 2.85Å; D70-N72 PolarHBondContact OD1-ND2 3.35Å; D70-N74 WeakPolarHBondContact O-CA 3.43Å; D70-N74 PolarHBondContact O-N 3.31Å; D70-E75 PolarHBondContact N-O 2.88Å; D70-E75 PolarHBondContact O-N 2.9Å; D70-I77 HydrophobicContact CB-CD1 3.77Å
71	A	93.4	Very high	95.4	Very high	73 Å²	73	66.7 Å²	66.7	60%	0.603	35%	0.347	S	S	*	.	T	Hydrogen-bonded Turn	trans	-70.3	-20.5	-179.4	0	0	0	0	0	113	Y69	Y69-A71 HydrophobicContact CE1-CB 3.99Å
72	N	93.3	Very high	95.3	Very high	153 Å²	153	65.2 Å²	65.2	82%	0.818	34%	0.34	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76.1	-40.8	-178.5	-54.3	-67.6	0	0	0	111.3	D70	D70-N72 PolarHBondContact O-N 3.38Å; D70-N72 WeakPolarHBondContact OD1-CB 3.44Å; D70-N72 PolarHBondContact OD1-N 2.85Å; D70-N72 PolarHBondContact OD1-ND2 3.35Å
73	T	93.8	Very high	95.3	Very high	75 Å²	75	61.3 Å²	61.3	46%	0.46	32%	0.319	S	S	.	.	T	Hydrogen-bonded Turn	trans	-99.5	-8.8	179.3	62.3	0	0	0	0	113	E75	T73-E75 WeakPolarHBondContact CB-OE2 3.39Å; T73-E75 PolarHBondContact OG1-OE2 2.93Å
74	N	94.9	Very high	95.4	Very high	53 Å²	53	59.8 Å²	59.8	28%	0.283	31%	0.309	S	S	.	.	T	Hydrogen-bonded Turn	trans	55.4	51.6	-173.2	-160.2	34.2	0	0	0	112.3	Y69 D70 I87	Y69-N74 WeakPolarHBondContact CE2-OD1 3.4Å; Y69-N74 PolarHBondContact OH-OD1 3.34Å; D70-N74 WeakPolarHBondContact O-CA 3.43Å; D70-N74 PolarHBondContact O-N 3.31Å; N74-I87 PolarHBondContact ND2-O 3.4Å; N74-I87 VanDerWaalsContact ND2-O 3.15Å; N74-I87 WeakPolarHBondContact O-CB 3.46Å; N74-I87 PolarHBondContact O-N 2.72Å
75	E	96.4	Very high	95.5	Very high	15 Å²	15	53 Å²	53	7%	0.07	28%	0.279	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.5	153.7	-175.8	-67.2	172.5	146.3	0	0	111.7	Y69 D70 T73 A84 Y85 R100	Y69-E75 WeakPolarHBondContact CD2-O 3.43Å; D70-E75 PolarHBondContact N-O 2.88Å; D70-E75 PolarHBondContact O-N 2.9Å; T73-E75 WeakPolarHBondContact CB-OE2 3.39Å; T73-E75 PolarHBondContact OG1-OE2 2.93Å; E75-A84 HydrophobicContact CB-CB 4.22Å; E75-Y85 CarbonylContact C-O 3.51Å; E75-Y85 VanDerWaalsContact CA-O 3.28Å; E75-Y85 WeakPolarHBondContact CA-O 3.42Å; E75-R100 IonicContact OE1-CZ 2.96Å; E75-R100 IonicContact OE1-NH1 3.83Å; E75-R100 PolarHBondContact OE1-NH1 3.1Å; E75-R100 IonicContact OE2-NH1 2.74Å
76	L	97.3	Very high	95.6	Very high	0 Å²	0	50 Å²	50	0%	0	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.6	114.6	169.5	-61.4	174.8	0	0	0	109.8	F50 L55 L58 L67 Y69 A84 Y85 I87 P92 M94	F50-L76 HydrophobicContact CE1-CD2 3.93Å; F50-L76 HydrophobicContact CZ-CD2 3.98Å; L55-L76 HydrophobicContact CD2-CD2 3.83Å; L58-L76 HydrophobicContact CD2-CD1 3.84Å; L67-L76 HydrophobicContact CB-CB 4.32Å; L67-L76 HydrophobicContact CD1-CB 3.9Å; L67-L76 HydrophobicContact CD1-CD1 4.12Å; Y69-L76 HydrophobicContact CD2-CD2 4.04Å; Y69-L76 HydrophobicContact CG-CD2 4.48Å; L76-A84 CarbonylContact O-C 3.59Å; L76-A84 WeakPolarHBondContact O-CA 3.28Å; L76-Y85 PolarHBondContact N-O 2.8Å; L76-Y85 PolarHBondContact O-N 3.18Å; L76-I87 HydrophobicContact CD2-CD1 4.11Å; L76-I87 HydrophobicContact CG-CD1 3.91Å; L76-I87 HydrophobicContact CG-CG1 4.25Å; L76-P92 HydrophobicContact CD1-CB 3.7Å; L76-P92 HydrophobicContact CD1-CG 3.94Å; L76-M94 HydrophobicContact CD1-SD 4.06Å
77	I	96.8	Very high	95.6	Very high	7 Å²	7	45.9 Å²	45.9	4%	0.036	24%	0.242	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-98.7	131.9	-171.8	-67.6	171.6	0	0	0	110.6	L67 R68 D70 E79 A84 I102	L67-I77 WeakPolarHBondContact CA-O 2.92Å; R68-I77 PolarHBondContact N-O 3.15Å; R68-I77 PolarHBondContact O-N 3.03Å; D70-I77 HydrophobicContact CB-CD1 3.77Å; I77-E79 HydrophobicContact CG2-CG 4.05Å; I77-A84 HydrophobicContact CG1-CB 4.05Å; I77-I102 HydrophobicContact CG2-CD1 3.45Å; I77-I102 VanDerWaalsContact CG2-CD1 3.45Å
78	N	96.8	Very high	95.4	Very high	3 Å²	3	49.1 Å²	49.1	2%	0.016	26%	0.262	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.3	109.8	163.8	-171	-84.5	0	0	0	110.1	S63 L67 E80 L81 G82 I83	S63-N78 PolarHBondContact OG-ND2 2.65Å; S63-N78 VanDerWaalsContact OG-ND2 3.09Å; L67-N78 HydrophobicContact CD2-CB 3.68Å; N78-E80 PolarHBondContact OD1-N 3.39Å; N78-L81 WeakPolarHBondContact OD1-CB 3.15Å; N78-L81 WeakPolarHBondContact OD1-CG 3.33Å; N78-L81 PolarHBondContact OD1-N 3.33Å; N78-G82 WeakPolarHBondContact O-CA 3.1Å; N78-G82 PolarHBondContact O-N 2.92Å; N78-I83 HydrophobicContact CB-CG1 3.98Å; N78-I83 PolarHBondContact N-O 3.13Å; N78-I83 PolarHBondContact O-N 2.91Å
79	E	93.3	Very high	95.3	Very high	111 Å²	111	49.2 Å²	49.2	52%	0.519	27%	0.27	S	S	.	.	T	Hydrogen-bonded Turn	trans	-75.6	-23.5	-175.1	-59.2	-171.9	168.6	0	0	114.1	R68 I77 K104	R68-E79 IonicContact CZ-OE1 3.51Å; R68-E79 IonicContact NE-OE1 3.95Å; R68-E79 PolarHBondContact NE-OE1 2.99Å; I77-E79 HydrophobicContact CG2-CG 4.05Å; E79-K104 PolarHBondContact O-NZ 3.26Å
80	E	92.8	Very high	95.1	Very high	117 Å²	117	47.3 Å²	47.3	55%	0.547	27%	0.269	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.5	-49.4	177.5	-67.5	-174.3	-177	0	0	110.6	K65 N78	K65-E80 WeakPolarHBondContact CE-OE1 3.26Å; K65-E80 WeakPolarHBondContact CG-OE2 3.18Å; K65-E80 IonicContact NZ-OE1 3.82Å; N78-E80 PolarHBondContact OD1-N 3.39Å
81	L	94.8	Very high	95	Very high	83 Å²	83	51.6 Å²	51.6	44%	0.435	29%	0.29	S	S	.	.	T	Hydrogen-bonded Turn	trans	-85.5	-15.5	-179.2	-62.7	-179.9	0	0	0	113.2	L62 N78 I83	L62-L81 HydrophobicContact CB-CD1 3.82Å; L62-L81 HydrophobicContact CD1-CD1 4.14Å; N78-L81 WeakPolarHBondContact OD1-CB 3.15Å; N78-L81 WeakPolarHBondContact OD1-CG 3.33Å; N78-L81 PolarHBondContact OD1-N 3.33Å; L81-I83 HydrophobicContact CB-CD1 4.15Å; L81-I83 HydrophobicContact CB-CG1 4.02Å; L81-I83 HydrophobicContact CB-CG2 4.29Å; L81-I83 HydrophobicContact CD1-CD1 3.94Å
82	G	95.1	Very high	95.1	Very high	10 Å²	10	49.8 Å²	49.8	10%	0.103	27%	0.272	C	S	.	.	T	Hydrogen-bonded Turn	trans	64.5	43.6	-175.8	0	0	0	0	0	111.9	N78 I102	N78-G82 WeakPolarHBondContact O-CA 3.1Å; N78-G82 PolarHBondContact O-N 2.92Å; G82-I102 WeakPolarHBondContact O-CG1 3.42Å; G82-I102 PolarHBondContact O-N 3.49Å
83	I	96.2	Very high	95.3	Very high	15 Å²	15	44.3 Å²	44.3	8%	0.077	24%	0.243	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-127.4	153.9	178	67.9	-179.8	0	0	0	111.5	L62 N78 L81 Y85 A99 R100 L101	L62-I83 HydrophobicContact CD1-CD1 3.94Å; N78-I83 HydrophobicContact CB-CG1 3.98Å; N78-I83 PolarHBondContact N-O 3.13Å; N78-I83 PolarHBondContact O-N 2.91Å; L81-I83 HydrophobicContact CB-CD1 4.15Å; L81-I83 HydrophobicContact CB-CG1 4.02Å; L81-I83 HydrophobicContact CB-CG2 4.29Å; L81-I83 HydrophobicContact CD1-CD1 3.94Å; I83-Y85 HydrophobicContact CD1-CE2 4Å; I83-Y85 VanDerWaalsContact CD1-OH 3.28Å; I83-Y85 WeakPolarHBondContact CD1-OH 3.44Å; I83-Y85 HydrophobicContact CG1-CE2 4.27Å; I83-A99 HydrophobicContact CB-CB 4.25Å; I83-A99 HydrophobicContact CD1-CB 4.27Å; I83-R100 CarbonylContact C-O 3.58Å; I83-R100 VanDerWaalsContact CA-O 3.28Å; I83-R100 WeakPolarHBondContact CA-O 3.43Å; I83-L101 HydrophobicContact CG2-CD2 3.9Å
84	A	97.6	Very high	95.4	Very high	0 Å²	0	43 Å²	43	0%	0	23%	0.232	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-129.8	131.1	178.9	0	0	0	0	0	110.7	E75 L76 I77 A99 R100 I102	E75-A84 HydrophobicContact CB-CB 4.22Å; L76-A84 CarbonylContact O-C 3.59Å; L76-A84 WeakPolarHBondContact O-CA 3.28Å; I77-A84 HydrophobicContact CG1-CB 4.05Å; A84-A99 CarbonylContact O-C 3.56Å; A84-A99 WeakPolarHBondContact O-CA 3.48Å; A84-R100 PolarHBondContact N-O 3.25Å; A84-R100 PolarHBondContact O-N 3.01Å; A84-I102 HydrophobicContact CB-CG2 3.92Å
85	Y	97.8	Very high	95.5	Very high	0 Å²	0	44 Å²	44	0%	0	24%	0.236	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-99.6	125	175.3	-62.5	-77.6	0	0	0	109.7	P61 L67 E75 L76 I83 N93 M94 A99	P61-Y85 WeakPolarHBondContact CD-OH 3.46Å; P61-Y85 HydrophobicContact CG-CE1 4.15Å; P61-Y85 HydrophobicContact CG-CE2 4.44Å; P61-Y85 VanDerWaalsContact CG-OH 3.29Å; P61-Y85 WeakPolarHBondContact CG-OH 3.43Å; L67-Y85 HydrophobicContact CD1-CD2 4.48Å; E75-Y85 CarbonylContact C-O 3.51Å; E75-Y85 VanDerWaalsContact CA-O 3.28Å; E75-Y85 WeakPolarHBondContact CA-O 3.42Å; L76-Y85 PolarHBondContact N-O 2.8Å; L76-Y85 PolarHBondContact O-N 3.18Å; I83-Y85 HydrophobicContact CD1-CE2 4Å; I83-Y85 VanDerWaalsContact CD1-OH 3.28Å; I83-Y85 WeakPolarHBondContact CD1-OH 3.44Å; I83-Y85 HydrophobicContact CG1-CE2 4.27Å; Y85-N93 WeakPolarHBondContact CB-O 3.29Å; Y85-N93 WeakPolarHBondContact CD1-O 3.28Å; Y85-M94 HydrophobicContact CD1-SD 4.08Å; Y85-M94 HydrophobicContact CD2-CE 4.16Å; Y85-M94 HydrophobicContact CD2-SD 3.65Å; Y85-M94 HydrophobicContact CE2-CE 4.31Å; Y85-M94 HydrophobicContact CE2-SD 4.28Å; Y85-M94 HydrophobicContact CG-SD 3.54Å; Y85-M94 VanDerWaalsContact CG-SD 3.54Å; Y85-A99 HydrophobicContact CD1-CB 3.84Å; Y85-A99 HydrophobicContact CE1-CB 3.61Å
86	P	97.1	Very high	95.4	Very high	33 Å²	33	45.9 Å²	45.9	21%	0.214	25%	0.25	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.2	149	-179.9	29.5	-32.3	0	0	0	111.9	N93	P86-N93 HydrophobicContact CG-CB 4.21Å; P86-N93 WeakPolarHBondContact O-CB 3.44Å; P86-N93 PolarHBondContact O-N 3.28Å
87	I	95.9	Very high	95.2	Very high	11 Å²	11	53.6 Å²	53.6	6%	0.056	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.1	122.2	169.6	-64.2	157.1	0	0	0	108.8	F50 Y69 N74 L76 P92	F50-I87 HydrophobicContact CB-CD1 4Å; F50-I87 HydrophobicContact CB-CG2 4.23Å; F50-I87 HydrophobicContact CD1-CD1 3.97Å; F50-I87 HydrophobicContact CD2-CD1 3.9Å; F50-I87 HydrophobicContact CD2-CG1 4.42Å; F50-I87 HydrophobicContact CD2-CG2 4.41Å; F50-I87 HydrophobicContact CE1-CD1 4.47Å; F50-I87 HydrophobicContact CE2-CD1 4.41Å; F50-I87 HydrophobicContact CG-CD1 3.66Å; Y69-I87 HydrophobicContact CD2-CD1 3.68Å; Y69-I87 HydrophobicContact CE2-CD1 3.39Å; N74-I87 PolarHBondContact ND2-O 3.4Å; N74-I87 VanDerWaalsContact ND2-O 3.15Å; N74-I87 WeakPolarHBondContact O-CB 3.46Å; N74-I87 PolarHBondContact O-N 2.72Å; L76-I87 HydrophobicContact CD2-CD1 4.11Å; L76-I87 HydrophobicContact CG-CD1 3.91Å; L76-I87 HydrophobicContact CG-CG1 4.25Å; I87-P92 HydrophobicContact CG1-CB 4.45Å; I87-P92 HydrophobicContact CG1-CG 4.36Å
88	V	93.8	Very high	95.1	Very high	80 Å²	80	58.2 Å²	58.2	49%	0.485	31%	0.308	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120	125.1	-179.4	-176	0	0	0	0	108.2	G90 I91	V88-G90 PolarHBondContact O-N 3.04Å; V88-I91 PolarHBondContact N-O 3.02Å; V88-I91 WeakPolarHBondContact O-CA 3.36Å; V88-I91 WeakPolarHBondContact O-CB 3.48Å; V88-I91 PolarHBondContact O-N 3.23Å
89	D	91.9	Very high	95.1	Very high	107 Å²	107	59 Å²	59	57%	0.572	32%	0.315	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.6	35.6	-177.3	-55.3	-35.8	0	0	0	113.9	I91	D89-I91 PolarHBondContact O-N 3.01Å
90	G	92.3	Very high	95.2	Very high	18 Å²	18	60.3 Å²	60.3	19%	0.186	32%	0.315	C	S	.	.	T	Hydrogen-bonded Turn	trans	76.5	0.4	-176.6	0	0	0	0	0	114.5	L48 V88	L48-G90 WeakPolarHBondContact O-CA 3.32Å; L48-G90 PolarHBondContact O-N 2.78Å; V88-G90 PolarHBondContact O-N 3.04Å
91	I	93.6	Very high	95.3	Very high	120 Å²	120	61.7 Å²	61.7	62%	0.615	33%	0.325	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.1	120.7	-178.9	-56.6	175.4	0	0	0	109.9	V88 D89 N93	V88-I91 PolarHBondContact N-O 3.02Å; V88-I91 WeakPolarHBondContact O-CA 3.36Å; V88-I91 WeakPolarHBondContact O-CB 3.48Å; V88-I91 PolarHBondContact O-N 3.23Å; D89-I91 PolarHBondContact O-N 3.01Å; I91-N93 PolarHBondContact O-N 2.93Å
92	P	95.7	Very high	95.2	Very high	35 Å²	35	60.2 Å²	60.2	23%	0.227	32%	0.317	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.7	123.1	172.7	-25.7	36.4	0	0	0	112.7	F50 L58 L76 I87 M94	F50-P92 HydrophobicContact CD2-CG 4.04Å; F50-P92 HydrophobicContact CE2-CG 3.52Å; F50-P92 HydrophobicContact CZ-CG 4.45Å; L58-P92 HydrophobicContact CD1-CG 4.39Å; L76-P92 HydrophobicContact CD1-CB 3.7Å; L76-P92 HydrophobicContact CD1-CG 3.94Å; I87-P92 HydrophobicContact CG1-CB 4.45Å; I87-P92 HydrophobicContact CG1-CG 4.36Å; P92-M94 HydrophobicContact CB-CG 3.95Å; P92-M94 HydrophobicContact CB-SD 4.36Å; P92-M94 PolarHBondContact O-N 2.76Å
93	N	96.7	Very high	94.5	Very high	37 Å²	37	68.4 Å²	68.4	20%	0.198	35%	0.353	C	S	.	.			trans	-89.3	93.8	171.9	-175.2	-9.4	0	0	0	110.5	Y85 P86 I91 I95 E98	Y85-N93 WeakPolarHBondContact CB-O 3.29Å; Y85-N93 WeakPolarHBondContact CD1-O 3.28Å; P86-N93 HydrophobicContact CG-CB 4.21Å; P86-N93 WeakPolarHBondContact O-CB 3.44Å; P86-N93 PolarHBondContact O-N 3.28Å; I91-N93 PolarHBondContact O-N 2.93Å; N93-I95 VanDerWaalsContact C-N 3.32Å; N93-I95 PolarHBondContact O-N 2.82Å; N93-I95 VanDerWaalsContact OD1-CG1 3.31Å; N93-I95 WeakPolarHBondContact OD1-CG1 3.22Å; N93-I95 PolarHBondContact OD1-N 2.82Å; N93-E98 PolarHBondContact ND2-OE2 2.86Å
94	M	96.5	Very high	93	Very high	49 Å²	49	74.4 Å²	74.4	24%	0.241	38%	0.378	C	S	.	.			trans	-95.4	32.5	-172.9	-62.1	-69.1	-83	0	0	112.9	L58 V59 P61 L67 L76 Y85 P92 P96	L58-M94 HydrophobicContact CD2-CE 4.01Å; V59-M94 WeakPolarHBondContact O-CE 3.22Å; P61-M94 VanDerWaalsContact CD-CE 3.4Å; P61-M94 HydrophobicContact CG-CB 4.49Å; P61-M94 HydrophobicContact CG-CE 4.37Å; L67-M94 HydrophobicContact CD1-CE 3.4Å; L67-M94 HydrophobicContact CD1-SD 4.17Å; L76-M94 HydrophobicContact CD1-SD 4.06Å; Y85-M94 HydrophobicContact CD1-SD 4.08Å; Y85-M94 HydrophobicContact CD2-CE 4.16Å; Y85-M94 HydrophobicContact CD2-SD 3.65Å; Y85-M94 HydrophobicContact CE2-CE 4.31Å; Y85-M94 HydrophobicContact CE2-SD 4.28Å; Y85-M94 HydrophobicContact CG-SD 3.54Å; Y85-M94 VanDerWaalsContact CG-SD 3.54Å; P92-M94 HydrophobicContact CB-CG 3.95Å; P92-M94 HydrophobicContact CB-SD 4.36Å; P92-M94 PolarHBondContact O-N 2.76Å; M94-P96 WeakPolarHBondContact O-CD 3.43Å
95	I	96.5	Very high	91.1	Very high	72 Å²	72	81.2 Å²	81.2	37%	0.369	42%	0.415	S	S	.	.			trans	-82.6	118.6	176.2	-62.3	174.6	0	0	0	108.9	N93 Q97 E98 A99	N93-I95 VanDerWaalsContact C-N 3.32Å; N93-I95 PolarHBondContact O-N 2.82Å; N93-I95 VanDerWaalsContact OD1-CG1 3.31Å; N93-I95 WeakPolarHBondContact OD1-CG1 3.22Å; N93-I95 PolarHBondContact OD1-N 2.82Å; I95-Q97 HydrophobicContact CG2-CB 4.29Å; I95-Q97 PolarHBondContact O-N 2.83Å; I95-Q97 VanDerWaalsContact O-N 3.13Å; I95-E98 HydrophobicContact CB-CB 4.22Å; I95-E98 HydrophobicContact CB-CG 4.16Å; I95-E98 HydrophobicContact CG2-CB 4.42Å; I95-E98 HydrophobicContact CG2-CG 3.98Å; I95-E98 PolarHBondContact O-N 3.45Å; I95-A99 PolarHBondContact O-N 2.8Å
96	P	94.2	Very high	88.7	Confident	56 Å²	56	86.4 Å²	86.4	36%	0.364	45%	0.447	S	S	.	.	T	Hydrogen-bonded Turn	trans	-55	-33.8	-177	-30.9	38.1	0	0	0	115.3	L62 M94 E98 A99	L62-P96 HydrophobicContact CD1-CB 4.2Å; L62-P96 HydrophobicContact CD2-CB 3.97Å; L62-P96 HydrophobicContact CD2-CG 3.81Å; L62-P96 HydrophobicContact CG-CB 4.31Å; L62-P96 HydrophobicContact CG-CG 4.26Å; M94-P96 WeakPolarHBondContact O-CD 3.43Å; P96-E98 VanDerWaalsContact C-N 3.31Å; P96-A99 WeakPolarHBondContact O-CB 3.31Å
97	Q	94.7	Very high	86.3	Confident	162 Å²	162	93.6 Å²	93.6	76%	0.757	48%	0.477	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.4	-22.6	-179.1	-64.6	84	-17.5	0	0	112.9	I95	I95-Q97 HydrophobicContact CG2-CB 4.29Å; I95-Q97 PolarHBondContact O-N 2.83Å; I95-Q97 VanDerWaalsContact O-N 3.13Å
98	E	93.6	Very high	83.9	Confident	104 Å²	104	97.8 Å²	97.8	49%	0.486	50%	0.504	S	S	.	.	T	Hydrogen-bonded Turn	trans	-97.9	-6.3	-179.7	-61.2	-175	-168.2	0	0	112	N93 I95 P96 R100	N93-E98 PolarHBondContact ND2-OE2 2.86Å; I95-E98 HydrophobicContact CB-CB 4.22Å; I95-E98 HydrophobicContact CB-CG 4.16Å; I95-E98 HydrophobicContact CG2-CB 4.42Å; I95-E98 HydrophobicContact CG2-CG 3.98Å; I95-E98 PolarHBondContact O-N 3.45Å; P96-E98 VanDerWaalsContact C-N 3.31Å; E98-R100 PolarHBondContact O-N 2.99Å
99	A	96.3	Very high	82.1	Confident	19 Å²	19	99.3 Å²	99.3	16%	0.157	52%	0.515	C	S	.	.	P	Polyproline II helix	trans	-60.6	128.6	173.9	0	0	0	0	0	110.5	I83 A84 Y85 I95 P96	I83-A99 HydrophobicContact CB-CB 4.25Å; I83-A99 HydrophobicContact CD1-CB 4.27Å; A84-A99 CarbonylContact O-C 3.56Å; A84-A99 WeakPolarHBondContact O-CA 3.48Å; Y85-A99 HydrophobicContact CD1-CB 3.84Å; Y85-A99 HydrophobicContact CE1-CB 3.61Å; I95-A99 PolarHBondContact O-N 2.8Å; P96-A99 WeakPolarHBondContact O-CB 3.31Å
100	R	95.6	Very high	80.4	Confident	139 Å²	139	103.3 Å²	103.3	53%	0.525	53%	0.528	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.1	137.4	175.7	-69.2	-176.5	61.9	-122.7	-4.6	109.9	E75 I83 A84 E98	E75-R100 IonicContact OE1-CZ 2.96Å; E75-R100 IonicContact OE1-NH1 3.83Å; E75-R100 PolarHBondContact OE1-NH1 3.1Å; E75-R100 IonicContact OE2-NH1 2.74Å; I83-R100 CarbonylContact C-O 3.58Å; I83-R100 VanDerWaalsContact CA-O 3.28Å; I83-R100 WeakPolarHBondContact CA-O 3.43Å; A84-R100 PolarHBondContact N-O 3.25Å; A84-R100 PolarHBondContact O-N 3.01Å; E98-R100 PolarHBondContact O-N 2.99Å
101	L	95.4	Very high	78.7	Confident	145 Å²	145	108 Å²	108	76%	0.759	55%	0.553	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-73.5	129.2	170.4	-62.9	176.3	0	0	0	109.3	I83	I83-L101 HydrophobicContact CG2-CD2 3.9Å
102	I	93.3	Very high	77.2	Confident	53 Å²	53	108 Å²	108	27%	0.272	56%	0.561	S	S	.	*	P	Polyproline II helix	trans	-100.6	127.1	168.2	47.4	170.2	0	0	0	108	I77 G82 A84 K104	I77-I102 HydrophobicContact CG2-CD1 3.45Å; I77-I102 VanDerWaalsContact CG2-CD1 3.45Å; G82-I102 WeakPolarHBondContact O-CG1 3.42Å; G82-I102 PolarHBondContact O-N 3.49Å; A84-I102 HydrophobicContact CB-CG2 3.92Å; I102-K104 PolarHBondContact O-N 3.04Å
103	Q	79.7	Confident	75.6	Confident	181 Å²	181	110.9 Å²	110.9	85%	0.846	59%	0.587	S	S	*	*	P	Polyproline II helix	trans	-63.2	116.6	171.3	-67.5	-177.5	6.8	0	0	107	D105	Q103-D105 VanDerWaalsContact C-N 3.27Å; Q103-D105 PolarHBondContact O-N 3.13Å
104	K	64.9	Low	73.2	Confident	141 Å²	141	121.7 Å²	121.7	61%	0.613	64%	0.636	S	S	*	*			trans	-71.9	94.6	170.7	-164.6	166.9	-174	157.9	0	105.5	E79 I102 T106	E79-K104 PolarHBondContact O-NZ 3.26Å; I102-K104 PolarHBondContact O-N 3.04Å; K104-T106 VanDerWaalsContact C-N 3.26Å; K104-T106 PolarHBondContact O-N 3.47Å; K104-T106 PolarHBondContact O-OG1 3.18Å
105	D	58.5	Low	72.1	Confident	143 Å²	143	125.3 Å²	125.3	77%	0.765	66%	0.656	S	S	*	*			trans	-54.3	104.6	167.1	-83.5	-24.8	0	0	0	105.7	Q103 Q107	Q103-D105 VanDerWaalsContact C-N 3.27Å; Q103-D105 PolarHBondContact O-N 3.13Å; D105-Q107 PolarHBondContact O-N 3.34Å
106	T	45.9	Very low	70.8	Confident	110 Å²	110	128.1 Å²	128.1	68%	0.675	67%	0.671	S	S	*	*			trans	-68.3	89.3	178	-61.4	0	0	0	0	104.6	K104 T108	K104-T106 VanDerWaalsContact C-N 3.26Å; K104-T106 PolarHBondContact O-N 3.47Å; K104-T106 PolarHBondContact O-OG1 3.18Å; T106-T108 HydrophobicContact CG2-CG2 4.02Å; T106-T108 PolarHBondContact O-N 3.07Å; T106-T108 PolarHBondContact O-OG1 2.99Å
107	Q	47.8	Very low	69.5	Low	183 Å²	183	132.1 Å²	132.1	86%	0.855	69%	0.688	S	S	*	*			trans	-64.1	81.4	146.2	-83.5	-174.2	-26.7	0	0	105.3	D105	D105-Q107 PolarHBondContact O-N 3.34Å
108	T	44.8	Very low	68	Low	99 Å²	99	130.4 Å²	130.4	61%	0.607	68%	0.684	S	S	*	*			trans	-43.6	124.4	151.7	9.1	0	0	0	0	105.3	T106 K110	T106-T108 HydrophobicContact CG2-CG2 4.02Å; T106-T108 PolarHBondContact O-N 3.07Å; T106-T108 PolarHBondContact O-OG1 2.99Å; T108-K110 PolarHBondContact O-N 3.03Å
109	P	55.7	Low	66.4	Low	113 Å²	113	132 Å²	132	73%	0.734	70%	0.697	S	S	*	*			trans	-55.9	114.7	165.3	25.1	-29.6	0	0	0	104.1	T111	P109-T111 PolarHBondContact O-N 2.86Å
110	K	56.9	Low	64.4	Low	191 Å²	191	139.5 Å²	139.5	83%	0.83	73%	0.733	S	S	*	*			trans	-57.7	102.7	166.5	-47.2	177.4	-169.9	176.7	0	102.5	T108 P112	T108-K110 PolarHBondContact O-N 3.03Å; K110-P112 WeakPolarHBondContact O-CD 3.41Å
111	T	56.3	Low	62.2	Low	116 Å²	116	139.6 Å²	139.6	71%	0.712	75%	0.748	S	S	*	*			trans	-48.2	118.9	169.6	-52.3	0	0	0	0	104.8	P109 A113	P109-T111 PolarHBondContact O-N 2.86Å; T111-A113 PolarHBondContact O-N 3.09Å
112	P	63.3	Low	59.7	Low	121 Å²	121	139.2 Å²	139.2	79%	0.786	75%	0.747	S	S	*	*			trans	-63.9	95.4	158.3	-6.7	23.8	0	0	0	103.1	K110 E114	K110-P112 WeakPolarHBondContact O-CD 3.41Å; P112-E114 PolarHBondContact O-N 3.1Å
113	A	61.9	Low	56.9	Low	95 Å²	95	146.3 Å²	146.3	79%	0.785	79%	0.786	S	S	*	*			trans	-66.6	95	160.5	0	0	0	0	0	104.9	T111	T111-A113 PolarHBondContact O-N 3.09Å
114	E	46.5	Very low	54.8	Low	263 Å²	263	143.2 Å²	143.2	100%	1.229	78%	0.781	S	S	*	*			trans	-155.4	0	147.5	-144.9	174.6	129.5	0	0	109.9	P112	P112-E114 PolarHBondContact O-N 3.1Å

Retrieved 114 of 114 residues in 203.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).