A0A087XQM3_POEFO Loading...

Protein transport protein Sec61 subunit gamma

Component of SEC61 channel-forming translocon complex that mediates transport of signal peptide-containing precursor polypeptides across the endoplasmic reticulum (ER). Forms a ribosome receptor and a gated pore in the ER membrane, both functions required for cotranslational translocation of nascent polypeptides. The SEC61 channel is also involved in ER membrane insertion of transmembrane proteins: it mediates membrane insertion of the first few transmembrane segments of proteins, while insertion of subsequent transmembrane regions of multi-pass membrane proteins is mediated by the multi-pass translocon (MPT) complex.

AlphaFold DB (P60060), UniProt , Accession A0A087XQM3, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 68 aa.

						>A0A087XQM3_POEFO|A0A087XQM3
MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.7	Low	79.1	Confident	200 Å²	200	115.8 Å²	115.8	99%	0.985	60%	0.596	S	S	*	*				0	-33.9	0	-70.2	-65.5	-123.3	0	0	111.2	V4 M5	M1-V4 PolarHBondContact O-N 3.02Å; M1-M5 PolarHBondContact O-N 3.11Å
2	D	73.8	Confident	80.1	Confident	134 Å²	134	119.8 Å²	119.8	72%	0.717	60%	0.598	S	S	*	*	H	α-helix	trans	-66.6	-38.7	-175.9	-49.7	-73.2	0	0	0	114.3	V4 M5 Q6	D2-V4 VanDerWaalsContact C-N 3.32Å; D2-V4 PolarHBondContact O-N 3.22Å; D2-M5 PolarHBondContact O-N 3.39Å; D2-Q6 WeakPolarHBondContact O-CG 2.98Å; D2-Q6 PolarHBondContact O-N 3.33Å
3	Q	72.7	Confident	81	Confident	154 Å²	154	117.5 Å²	117.5	72%	0.72	58%	0.584	S	S	*	*	H	α-helix	trans	-61	-40.5	175.7	-71.4	-179.8	-40.5	0	0	112.1	Q6 F7	Q3-Q6 PolarHBondContact O-N 3.36Å; Q3-F7 WeakPolarHBondContact O-CD2 3.2Å; Q3-F7 PolarHBondContact O-N 3.32Å
4	V	75.3	Confident	82	Confident	94 Å²	94	119.3 Å²	119.3	57%	0.57	59%	0.587	S	S	*	*	H	α-helix	trans	-64.3	-44.1	177	178.5	0	0	0	0	110.2	M1 D2 Q6 F7 V8	M1-V4 PolarHBondContact O-N 3.02Å; D2-V4 VanDerWaalsContact C-N 3.32Å; D2-V4 PolarHBondContact O-N 3.22Å; V4-Q6 VanDerWaalsContact C-N 3.27Å; V4-Q6 PolarHBondContact O-N 3.34Å; V4-F7 PolarHBondContact O-N 3.23Å; V4-F7 VanDerWaalsContact O-N 3.11Å; V4-V8 HydrophobicContact CG1-CG2 3.94Å; V4-V8 WeakPolarHBondContact O-CG2 3.48Å; V4-V8 PolarHBondContact O-N 3.07Å
5	M	75.6	Confident	82.9	Confident	104 Å²	104	116.6 Å²	116.6	51%	0.512	58%	0.58	S	S	.	*	H	α-helix	trans	-62	-35.1	178.5	-156.5	67.5	172.2	0	0	112.3	M1 D2 F7 V8 E9	M1-M5 PolarHBondContact O-N 3.11Å; D2-M5 PolarHBondContact O-N 3.39Å; M5-F7 VanDerWaalsContact C-N 3.29Å; M5-F7 PolarHBondContact O-N 2.95Å; M5-V8 PolarHBondContact O-N 3.43Å; M5-E9 HydrophobicContact CE-CG 4.4Å; M5-E9 WeakPolarHBondContact CE-OE1 3.09Å; M5-E9 HydrophobicContact CG-CG 4.42Å; M5-E9 PolarHBondContact O-N 3.28Å; M5-E9 VanDerWaalsContact O-N 3.07Å
6	Q	75.9	Confident	83.7	Confident	148 Å²	148	117 Å²	117	69%	0.692	58%	0.577	S	S	*	*	H	α-helix	trans	-64.6	-27.1	175.3	-73	-161.9	-41.5	0	0	114	D2 Q3 V4 P10	D2-Q6 WeakPolarHBondContact O-CG 2.98Å; D2-Q6 PolarHBondContact O-N 3.33Å; Q3-Q6 PolarHBondContact O-N 3.36Å; V4-Q6 VanDerWaalsContact C-N 3.27Å; V4-Q6 PolarHBondContact O-N 3.34Å; Q6-P10 WeakPolarHBondContact O-CD 3.4Å; Q6-P10 WeakPolarHBondContact O-CG 3.36Å
7	F	79	Confident	84.5	Confident	162 Å²	162	113.8 Å²	113.8	71%	0.711	56%	0.563	S	S	*	*	H	α-helix	trans	-89.5	-30.2	172.5	-67.8	-73.6	0	0	0	112.8	Q3 V4 M5 S11	Q3-F7 WeakPolarHBondContact O-CD2 3.2Å; Q3-F7 PolarHBondContact O-N 3.32Å; V4-F7 PolarHBondContact O-N 3.23Å; V4-F7 VanDerWaalsContact O-N 3.11Å; M5-F7 VanDerWaalsContact C-N 3.29Å; M5-F7 PolarHBondContact O-N 2.95Å; F7-S11 WeakPolarHBondContact O-CB 3.34Å; F7-S11 PolarHBondContact O-N 3.38Å; F7-S11 PolarHBondContact O-OG 3.34Å
8	V	87.9	Confident	85.2	Confident	47 Å²	47	109.9 Å²	109.9	29%	0.285	55%	0.548	S	S	.	.	H	α-helix	trans	-70.7	-40.6	-178.7	171.8	0	0	0	0	112.2	V4 M5 S11 R12	V4-V8 HydrophobicContact CG1-CG2 3.94Å; V4-V8 WeakPolarHBondContact O-CG2 3.48Å; V4-V8 PolarHBondContact O-N 3.07Å; M5-V8 PolarHBondContact O-N 3.43Å; V8-S11 WeakPolarHBondContact CA-OG 3.49Å; V8-S11 PolarHBondContact O-N 2.96Å; V8-S11 PolarHBondContact O-OG 3.37Å; V8-R12 HydrophobicContact CG1-CG 4.26Å; V8-R12 WeakPolarHBondContact O-CB 3.39Å; V8-R12 WeakPolarHBondContact O-CG 3.47Å; V8-R12 PolarHBondContact O-N 3.4Å
9	E	84.9	Confident	85.8	Confident	92 Å²	92	108.8 Å²	108.8	43%	0.43	54%	0.543	S	S	.	.	H	α-helix	trans	-66.1	-47.8	-178.5	-70.6	-58.8	132.9	0	0	113.1	M5 S11 R12 Q13	M5-E9 HydrophobicContact CE-CG 4.4Å; M5-E9 WeakPolarHBondContact CE-OE1 3.09Å; M5-E9 HydrophobicContact CG-CG 4.42Å; M5-E9 PolarHBondContact O-N 3.28Å; M5-E9 VanDerWaalsContact O-N 3.07Å; E9-S11 VanDerWaalsContact C-N 3.32Å; E9-S11 PolarHBondContact O-N 2.83Å; E9-R12 PolarHBondContact O-N 3.04Å; E9-Q13 PolarHBondContact O-N 3.5Å
10	P	90.9	Very high	86.4	Confident	81 Å²	81	111 Å²	111	53%	0.526	55%	0.545	S	S	.	.	H	α-helix	trans	-59.5	-39.6	173.5	-24.9	34.7	0	0	0	113.1	Q6 Q13 F14	Q6-P10 WeakPolarHBondContact O-CD 3.4Å; Q6-P10 WeakPolarHBondContact O-CG 3.36Å; P10-Q13 PolarHBondContact O-N 2.83Å; P10-F14 WeakPolarHBondContact O-CB 3.22Å; P10-F14 PolarHBondContact O-N 2.9Å
11	S	92.2	Very high	86.9	Confident	58 Å²	58	111.2 Å²	111.2	41%	0.406	55%	0.548	S	S	.	.	H	α-helix	trans	-67.9	-39.2	178.6	57.8	0	0	0	0	112.5	F7 V8 E9 Q13 F14 V15	F7-S11 WeakPolarHBondContact O-CB 3.34Å; F7-S11 PolarHBondContact O-N 3.38Å; F7-S11 PolarHBondContact O-OG 3.34Å; V8-S11 WeakPolarHBondContact CA-OG 3.49Å; V8-S11 PolarHBondContact O-N 2.96Å; V8-S11 PolarHBondContact O-OG 3.37Å; E9-S11 VanDerWaalsContact C-N 3.32Å; E9-S11 PolarHBondContact O-N 2.83Å; S11-Q13 PolarHBondContact O-N 3.3Å; S11-F14 PolarHBondContact O-N 2.92Å; S11-V15 WeakPolarHBondContact O-CG2 3.33Å; S11-V15 PolarHBondContact O-N 3.38Å
12	R	91.3	Very high	88.6	Confident	164 Å²	164	106.1 Å²	106.1	62%	0.619	53%	0.528	S	S	*	.	H	α-helix	trans	-60.7	-44.2	172.6	-79.7	-176.4	168.2	-164	-2.6	112	V8 E9 V15 K16	V8-R12 HydrophobicContact CG1-CG 4.26Å; V8-R12 WeakPolarHBondContact O-CB 3.39Å; V8-R12 WeakPolarHBondContact O-CG 3.47Å; V8-R12 PolarHBondContact O-N 3.4Å; E9-R12 PolarHBondContact O-N 3.04Å; R12-V15 PolarHBondContact O-N 2.91Å; R12-K16 WeakPolarHBondContact O-CB 3.47Å; R12-K16 PolarHBondContact O-N 3.2Å
13	Q	91.8	Very high	89.6	Confident	89 Å²	89	107.6 Å²	107.6	42%	0.416	53%	0.528	S	S	.	.	H	α-helix	trans	-64.5	-43.5	177.4	-174.2	54.5	36.9	0	0	111.2	E9 P10 S11 V15 K16 D17	E9-Q13 PolarHBondContact O-N 3.5Å; P10-Q13 PolarHBondContact O-N 2.83Å; S11-Q13 PolarHBondContact O-N 3.3Å; Q13-V15 PolarHBondContact O-N 3.47Å; Q13-K16 WeakPolarHBondContact O-CB 3.33Å; Q13-K16 PolarHBondContact O-N 3.02Å; Q13-D17 VanDerWaalsContact NE2-CG 3.31Å; Q13-D17 PolarHBondContact NE2-OD1 3.34Å; Q13-D17 PolarHBondContact NE2-OD2 3.28Å; Q13-D17 PolarHBondContact O-N 3.4Å
14	F	95.1	Very high	90.8	Very high	143 Å²	143	110.6 Å²	110.6	63%	0.627	53%	0.532	S	S	*	.	H	α-helix	trans	-58.9	-44.1	174.7	178.3	-97.8	0	0	0	113	P10 S11 D17 S18	P10-F14 WeakPolarHBondContact O-CB 3.22Å; P10-F14 PolarHBondContact O-N 2.9Å; S11-F14 PolarHBondContact O-N 2.92Å; F14-D17 PolarHBondContact O-N 2.93Å; F14-S18 WeakPolarHBondContact O-CB 3.46Å; F14-S18 PolarHBondContact O-N 3.22Å; F14-S18 PolarHBondContact O-OG 3.22Å
15	V	96	Very high	91.7	Very high	79 Å²	79	109.5 Å²	109.5	48%	0.479	53%	0.528	S	S	.	.	H	α-helix	trans	-62.5	-44	176.2	170.1	0	0	0	0	110.7	S11 R12 Q13 D17 S18 I19	S11-V15 WeakPolarHBondContact O-CG2 3.33Å; S11-V15 PolarHBondContact O-N 3.38Å; R12-V15 PolarHBondContact O-N 2.91Å; Q13-V15 PolarHBondContact O-N 3.47Å; V15-D17 PolarHBondContact O-N 2.85Å; V15-S18 PolarHBondContact O-N 2.92Å; V15-I19 HydrophobicContact CG1-CD1 3.93Å; V15-I19 WeakPolarHBondContact O-CG1 3.48Å; V15-I19 PolarHBondContact O-N 3.47Å
16	K	95.9	Very high	92.6	Very high	123 Å²	123	111.3 Å²	111.3	54%	0.535	55%	0.546	S	S	.	.	H	α-helix	trans	-61.3	-43.5	177.7	-172.8	178.3	-179.6	-179.6	0	111.9	R12 Q13 I19 R20	R12-K16 WeakPolarHBondContact O-CB 3.47Å; R12-K16 PolarHBondContact O-N 3.2Å; Q13-K16 WeakPolarHBondContact O-CB 3.33Å; Q13-K16 PolarHBondContact O-N 3.02Å; K16-I19 PolarHBondContact O-N 3.43Å; K16-R20 PolarHBondContact O-N 3.42Å
17	D	96.8	Very high	93.5	Very high	63 Å²	63	112.2 Å²	112.2	34%	0.337	55%	0.547	S	S	.	.	H	α-helix	trans	-69.4	-37.1	177.9	-70.2	-33.3	0	0	0	112	Q13 F14 V15 R20 L21	Q13-D17 VanDerWaalsContact NE2-CG 3.31Å; Q13-D17 PolarHBondContact NE2-OD1 3.34Å; Q13-D17 PolarHBondContact NE2-OD2 3.28Å; Q13-D17 PolarHBondContact O-N 3.4Å; F14-D17 PolarHBondContact O-N 2.93Å; V15-D17 PolarHBondContact O-N 2.85Å; D17-R20 WeakPolarHBondContact O-CB 3.47Å; D17-R20 PolarHBondContact O-N 2.78Å; D17-R20 IonicContact OD1-NH1 3.22Å; D17-R20 PolarHBondContact OD1-NH1 3.47Å; D17-L21 PolarHBondContact O-N 3.44Å
18	S	97.3	Very high	94.2	Very high	43 Å²	43	108.1 Å²	108.1	30%	0.301	54%	0.537	S	S	.	.	H	α-helix	trans	-62.4	-43.8	174	-61.4	0	0	0	0	112	F14 V15 R20 L21 V22	F14-S18 WeakPolarHBondContact O-CB 3.46Å; F14-S18 PolarHBondContact O-N 3.22Å; F14-S18 PolarHBondContact O-OG 3.22Å; V15-S18 PolarHBondContact O-N 2.92Å; S18-R20 VanDerWaalsContact C-N 3.33Å; S18-R20 PolarHBondContact O-N 3.49Å; S18-L21 WeakPolarHBondContact O-CB 3.37Å; S18-L21 PolarHBondContact O-N 2.96Å; S18-V22 WeakPolarHBondContact O-CG2 3.42Å; S18-V22 PolarHBondContact O-N 3.04Å
19	I	96.9	Very high	94.6	Very high	89 Å²	89	110.6 Å²	110.6	46%	0.456	55%	0.549	S	S	.	.	H	α-helix	trans	-64.3	-40.4	175.9	-68	167.4	0	0	0	110.7	V15 K16 L21 V22 K23	V15-I19 HydrophobicContact CG1-CD1 3.93Å; V15-I19 WeakPolarHBondContact O-CG1 3.48Å; V15-I19 PolarHBondContact O-N 3.47Å; K16-I19 PolarHBondContact O-N 3.43Å; I19-L21 VanDerWaalsContact C-N 3.32Å; I19-L21 PolarHBondContact O-N 3.32Å; I19-V22 PolarHBondContact O-N 3.24Å; I19-K23 HydrophobicContact CG2-CD 4.18Å; I19-K23 WeakPolarHBondContact O-CG 3.44Å; I19-K23 PolarHBondContact O-N 3.1Å
20	R	96.7	Very high	95.1	Very high	152 Å²	152	116.6 Å²	116.6	57%	0.574	57%	0.567	S	S	*	*	H	α-helix	trans	-60.9	-42.6	175.9	-178	-176	-73	157.5	-9.9	111.2	K16 D17 S18 K23 R24	K16-R20 PolarHBondContact O-N 3.42Å; D17-R20 WeakPolarHBondContact O-CB 3.47Å; D17-R20 PolarHBondContact O-N 2.78Å; D17-R20 IonicContact OD1-NH1 3.22Å; D17-R20 PolarHBondContact OD1-NH1 3.47Å; S18-R20 VanDerWaalsContact C-N 3.33Å; S18-R20 PolarHBondContact O-N 3.49Å; R20-K23 PolarHBondContact O-N 3.05Å; R20-R24 PolarHBondContact O-N 3.07Å; R20-R24 VanDerWaalsContact O-N 3.1Å
21	L	97.7	Very high	95.3	Very high	117 Å²	117	120.7 Å²	120.7	61%	0.613	58%	0.577	S	S	*	*	H	α-helix	trans	-60.5	-52.6	176.4	178.3	63.9	0	0	0	111.4	D17 S18 I19 K23 R24 C25	D17-L21 PolarHBondContact O-N 3.44Å; S18-L21 WeakPolarHBondContact O-CB 3.37Å; S18-L21 PolarHBondContact O-N 2.96Å; I19-L21 VanDerWaalsContact C-N 3.32Å; I19-L21 PolarHBondContact O-N 3.32Å; L21-K23 PolarHBondContact O-N 3.27Å; L21-R24 WeakPolarHBondContact O-CA 3.32Å; L21-R24 WeakPolarHBondContact O-CB 3.49Å; L21-R24 PolarHBondContact O-N 3.04Å; L21-C25 PolarHBondContact O-N 2.93Å; L21-C25 PolarHBondContact O-SG 3.22Å
22	V	96.5	Very high	95.4	Very high	92 Å²	92	123.1 Å²	123.1	56%	0.558	58%	0.582	S	S	*	*	H	α-helix	trans	-59.1	-35.8	-179.4	174.3	0	0	0	0	112	S18 I19 R24	S18-V22 WeakPolarHBondContact O-CG2 3.42Å; S18-V22 PolarHBondContact O-N 3.04Å; I19-V22 PolarHBondContact O-N 3.24Å; V22-R24 VanDerWaalsContact C-N 3.35Å
23	K	95.6	Very high	95.7	Very high	165 Å²	165	121.9 Å²	121.9	72%	0.717	58%	0.581	S	S	*	*	H	α-helix	trans	-71.3	-26.7	175.1	-73.2	179.8	-179.9	-177	0	113.5	I19 R20 L21	I19-K23 HydrophobicContact CG2-CD 4.18Å; I19-K23 WeakPolarHBondContact O-CG 3.44Å; I19-K23 PolarHBondContact O-N 3.1Å; R20-K23 PolarHBondContact O-N 3.05Å; L21-K23 PolarHBondContact O-N 3.27Å
24	R	96.6	Very high	95.9	Very high	217 Å²	217	124.3 Å²	124.3	82%	0.819	59%	0.592	S	S	*	*	H	α-helix	trans	-82.3	-28.3	178.7	-176	58.6	173	179.1	0.4	112.4	R20 L21 V22	R20-R24 PolarHBondContact O-N 3.07Å; R20-R24 VanDerWaalsContact O-N 3.1Å; L21-R24 WeakPolarHBondContact O-CA 3.32Å; L21-R24 WeakPolarHBondContact O-CB 3.49Å; L21-R24 PolarHBondContact O-N 3.04Å; V22-R24 VanDerWaalsContact C-N 3.35Å
25	C	95.4	Very high	96	Very high	72 Å²	72	125.6 Å²	125.6	49%	0.486	60%	0.598	S	S	.	*	S	Bend	trans	-62.4	141.7	177.4	-65.2	0	0	0	0	112	L21 K27	L21-C25 PolarHBondContact O-N 2.93Å; L21-C25 PolarHBondContact O-SG 3.22Å; C25-K27 PolarHBondContact O-N 3.36Å
26	T	94.6	Very high	96	Very high	142 Å²	142	126.3 Å²	126.3	87%	0.871	60%	0.598	S	S	*	*	P	Polyproline II helix	trans	-72.4	116.8	170.1	48.6	0	0	0	0	109.2
27	K	94.2	Very high	96.1	Very high	166 Å²	166	122.5 Å²	122.5	72%	0.722	59%	0.589	S	S	*	*	P	Polyproline II helix	trans	-78.6	137.7	175.8	-62.2	-179.8	-177.1	-179.6	0	109	C25 D29	C25-K27 PolarHBondContact O-N 3.36Å; K27-D29 PolarHBondContact O-N 3.47Å
28	P	93.2	Very high	96.1	Very high	76 Å²	76	125.5 Å²	125.5	49%	0.494	60%	0.603	S	S	.	*	P	Polyproline II helix	trans	-62.2	137.7	-179.6	26.7	-34.2	0	0	0	109.9
29	D	96.4	Very high	96.1	Very high	100 Å²	100	126.5 Å²	126.5	54%	0.535	61%	0.613	S	S	.	*	P	Polyproline II helix	trans	-74.5	162	170.8	-173.2	31.3	0	0	0	110.3	K27 K31 E32 F33	K27-D29 PolarHBondContact O-N 3.47Å; D29-K31 PolarHBondContact O-N 2.98Å; D29-E32 PolarHBondContact O-N 2.9Å; D29-E32 VanDerWaalsContact O-N 3.08Å; D29-F33 PolarHBondContact O-N 2.82Å
30	R	95.3	Very high	96.1	Very high	217 Å²	217	126.6 Å²	126.6	82%	0.819	62%	0.618	S	S	*	*	H	α-helix	trans	-54.4	-39.3	-178.2	-66.1	-175.1	179.9	-125	2.2	112.5	Q34	R30-Q34 VanDerWaalsContact O-CB 3.31Å; R30-Q34 WeakPolarHBondContact O-CB 3.43Å; R30-Q34 PolarHBondContact O-N 3.37Å
31	K	95.9	Very high	96.2	Very high	167 Å²	167	122.2 Å²	122.2	73%	0.726	61%	0.614	S	S	*	*	H	α-helix	trans	-65.7	-42.4	179	-68.5	-176.2	179	178.7	0	112.3	D29 K35	D29-K31 PolarHBondContact O-N 2.98Å; K31-K35 PolarHBondContact O-N 3.05Å; K31-K35 VanDerWaalsContact O-N 3.1Å
32	E	95.3	Very high	96.2	Very high	110 Å²	110	120.9 Å²	120.9	51%	0.514	61%	0.607	S	S	.	*	H	α-helix	trans	-68	-46.3	178.6	-173.4	179.4	-177.7	0	0	110.8	D29 Q34 K35 I36	D29-E32 PolarHBondContact O-N 2.9Å; D29-E32 VanDerWaalsContact O-N 3.08Å; E32-Q34 VanDerWaalsContact C-N 3.33Å; E32-Q34 PolarHBondContact O-N 3.23Å; E32-K35 PolarHBondContact O-N 3.37Å; E32-I36 HydrophobicContact CG-CD1 4.13Å; E32-I36 WeakPolarHBondContact O-CG1 3.31Å; E32-I36 PolarHBondContact O-N 3.46Å
33	F	96.7	Very high	96.2	Very high	137 Å²	137	118 Å²	118	60%	0.601	60%	0.596	S	S	*	*	H	α-helix	trans	-57.9	-45.4	175.6	-177	-97.2	0	0	0	111.7	D29 K35 I36 A37	D29-F33 PolarHBondContact O-N 2.82Å; F33-K35 PolarHBondContact O-N 3.48Å; F33-I36 PolarHBondContact O-N 3.24Å; F33-A37 HydrophobicContact CE1-CB 4.38Å; F33-A37 WeakPolarHBondContact O-CB 3.49Å; F33-A37 PolarHBondContact O-N 3.18Å
34	Q	96.7	Very high	96.3	Very high	140 Å²	140	118.1 Å²	118.1	65%	0.654	60%	0.597	S	S	*	*	H	α-helix	trans	-63.4	-40.1	179	-173.3	176	-0.8	0	0	112.3	R30 E32 A37 M38	R30-Q34 VanDerWaalsContact O-CB 3.31Å; R30-Q34 WeakPolarHBondContact O-CB 3.43Å; R30-Q34 PolarHBondContact O-N 3.37Å; E32-Q34 VanDerWaalsContact C-N 3.33Å; E32-Q34 PolarHBondContact O-N 3.23Å; Q34-A37 PolarHBondContact O-N 3.03Å; Q34-M38 WeakPolarHBondContact O-CB 3.32Å; Q34-M38 PolarHBondContact O-N 3.28Å
35	K	96.2	Very high	96.3	Very high	170 Å²	170	110.6 Å²	110.6	74%	0.739	58%	0.581	S	S	*	*	H	α-helix	trans	-62.1	-47.4	176.5	-175.2	179.9	180	-178.7	0	111.5	K31 E32 F33 A39	K31-K35 PolarHBondContact O-N 3.05Å; K31-K35 VanDerWaalsContact O-N 3.1Å; E32-K35 PolarHBondContact O-N 3.37Å; F33-K35 PolarHBondContact O-N 3.48Å; K35-A39 PolarHBondContact O-N 3.48Å; K35-A39 VanDerWaalsContact O-N 3.1Å
36	I	96.6	Very high	96.4	Very high	95 Å²	95	111.4 Å²	111.4	49%	0.487	58%	0.58	S	S	.	*	H	α-helix	trans	-64.9	-47.5	178.1	-64.2	168.9	0	0	0	110.1	E32 F33 M38 A39 T40	E32-I36 HydrophobicContact CG-CD1 4.13Å; E32-I36 WeakPolarHBondContact O-CG1 3.31Å; E32-I36 PolarHBondContact O-N 3.46Å; F33-I36 PolarHBondContact O-N 3.24Å; I36-M38 VanDerWaalsContact C-N 3.33Å; I36-M38 PolarHBondContact O-N 3.4Å; I36-A39 PolarHBondContact O-N 2.93Å; I36-T40 WeakPolarHBondContact O-CB 3.2Å; I36-T40 PolarHBondContact O-N 3.08Å; I36-T40 PolarHBondContact O-OG1 2.92Å
37	A	97.4	Very high	96.5	Very high	42 Å²	42	111.1 Å²	111.1	35%	0.347	57%	0.57	S	S	.	*	H	α-helix	trans	-58.8	-42.7	179.7	0	0	0	0	0	112.2	F33 Q34 T40 A41	F33-A37 HydrophobicContact CE1-CB 4.38Å; F33-A37 WeakPolarHBondContact O-CB 3.49Å; F33-A37 PolarHBondContact O-N 3.18Å; Q34-A37 PolarHBondContact O-N 3.03Å; A37-T40 PolarHBondContact O-N 3.31Å; A37-A41 VanDerWaalsContact O-CB 3.26Å; A37-A41 WeakPolarHBondContact O-CB 3.29Å; A37-A41 PolarHBondContact O-N 3.1Å
38	M	97	Very high	96.6	Very high	127 Å²	127	105.2 Å²	105.2	63%	0.626	56%	0.556	S	S	*	*	H	α-helix	trans	-64.3	-45.7	176.4	-177	175.6	-179.5	0	0	111.8	Q34 I36 T40 A41 I42	Q34-M38 WeakPolarHBondContact O-CB 3.32Å; Q34-M38 PolarHBondContact O-N 3.28Å; I36-M38 VanDerWaalsContact C-N 3.33Å; I36-M38 PolarHBondContact O-N 3.4Å; M38-T40 PolarHBondContact O-N 3.01Å; M38-A41 PolarHBondContact O-N 3.42Å; M38-I42 HydrophobicContact CE-CD1 4.19Å; M38-I42 HydrophobicContact CG-CD1 4.04Å; M38-I42 VanDerWaalsContact O-CG1 3.31Å; M38-I42 WeakPolarHBondContact O-CG1 3.31Å; M38-I42 PolarHBondContact O-N 3.49Å
39	A	97.4	Very high	96.7	Very high	63 Å²	63	107.7 Å²	107.7	52%	0.521	56%	0.56	S	S	.	*	H	α-helix	trans	-60.8	-45.2	177.2	0	0	0	0	0	111.8	K35 I36 I42 G43	K35-A39 PolarHBondContact O-N 3.48Å; K35-A39 VanDerWaalsContact O-N 3.1Å; I36-A39 PolarHBondContact O-N 2.93Å; A39-I42 PolarHBondContact O-N 3.1Å; A39-G43 PolarHBondContact O-N 2.86Å
40	T	97.7	Very high	96.7	Very high	92 Å²	92	107.3 Å²	107.3	56%	0.564	56%	0.557	S	S	*	*	H	α-helix	trans	-63.5	-42.1	176.4	-55.1	0	0	0	0	111.8	I36 A37 M38 I42 G43 F44	I36-T40 WeakPolarHBondContact O-CB 3.2Å; I36-T40 PolarHBondContact O-N 3.08Å; I36-T40 PolarHBondContact O-OG1 2.92Å; A37-T40 PolarHBondContact O-N 3.31Å; M38-T40 PolarHBondContact O-N 3.01Å; T40-I42 PolarHBondContact O-N 2.95Å; T40-G43 PolarHBondContact O-N 3.49Å; T40-F44 WeakPolarHBondContact O-CB 3.39Å; T40-F44 PolarHBondContact O-N 3Å
41	A	97.7	Very high	96.7	Very high	59 Å²	59	99 Å²	99	49%	0.488	54%	0.538	S	S	.	.	H	α-helix	trans	-63.1	-41.4	178.5	0	0	0	0	0	112.2	A37 M38 F44 A45	A37-A41 VanDerWaalsContact O-CB 3.26Å; A37-A41 WeakPolarHBondContact O-CB 3.29Å; A37-A41 PolarHBondContact O-N 3.1Å; M38-A41 PolarHBondContact O-N 3.42Å; A41-F44 PolarHBondContact O-N 3.47Å; A41-A45 WeakPolarHBondContact O-CB 3.43Å; A41-A45 PolarHBondContact O-N 2.92Å
42	I	97.7	Very high	96.7	Very high	89 Å²	89	96.7 Å²	96.7	46%	0.456	53%	0.528	S	S	.	.	H	α-helix	trans	-63.7	-45.5	174.8	-66.5	165.2	0	0	0	110.3	M38 A39 T40 F44 A45 I46	M38-I42 HydrophobicContact CE-CD1 4.19Å; M38-I42 HydrophobicContact CG-CD1 4.04Å; M38-I42 VanDerWaalsContact O-CG1 3.31Å; M38-I42 WeakPolarHBondContact O-CG1 3.31Å; M38-I42 PolarHBondContact O-N 3.49Å; A39-I42 PolarHBondContact O-N 3.1Å; T40-I42 PolarHBondContact O-N 2.95Å; I42-F44 PolarHBondContact O-N 3.09Å; I42-A45 PolarHBondContact O-N 3.36Å; I42-I46 HydrophobicContact CG2-CD1 3.89Å; I42-I46 HydrophobicContact CG2-CG1 4.5Å; I42-I46 WeakPolarHBondContact O-CG1 3.26Å; I42-I46 PolarHBondContact O-N 3.36Å
43	G	97.1	Very high	96.6	Very high	32 Å²	32	95.7 Å²	95.7	33%	0.33	52%	0.522	S	S	.	.	H	α-helix	trans	-59.5	-45	176.3	0	0	0	0	0	112.6	A39 T40 A45 I46 M47	A39-G43 PolarHBondContact O-N 2.86Å; T40-G43 PolarHBondContact O-N 3.49Å; G43-A45 VanDerWaalsContact C-N 3.35Å; G43-A45 PolarHBondContact O-N 3.36Å; G43-I46 PolarHBondContact O-N 3.46Å; G43-M47 VanDerWaalsContact O-CG 3.29Å; G43-M47 WeakPolarHBondContact O-CG 3.31Å; G43-M47 PolarHBondContact O-N 3.42Å
44	F	97.7	Very high	96.6	Very high	168 Å²	168	92.6 Å²	92.6	74%	0.737	52%	0.515	S	S	*	.	H	α-helix	trans	-61.3	-42.6	175.6	-174.4	-95.7	0	0	0	111.9	T40 A41 I42 G48	T40-F44 WeakPolarHBondContact O-CB 3.39Å; T40-F44 PolarHBondContact O-N 3Å; A41-F44 PolarHBondContact O-N 3.47Å; I42-F44 PolarHBondContact O-N 3.09Å; F44-G48 PolarHBondContact O-N 2.85Å
45	A	97	Very high	96.4	Very high	59 Å²	59	93.1 Å²	93.1	49%	0.488	52%	0.515	S	S	.	.	H	α-helix	trans	-63	-44.3	177.3	0	0	0	0	0	112.2	A41 I42 G43 G48 F49	A41-A45 WeakPolarHBondContact O-CB 3.43Å; A41-A45 PolarHBondContact O-N 2.92Å; I42-A45 PolarHBondContact O-N 3.36Å; G43-A45 VanDerWaalsContact C-N 3.35Å; G43-A45 PolarHBondContact O-N 3.36Å; A45-G48 PolarHBondContact O-N 3.49Å; A45-F49 WeakPolarHBondContact O-CB 3.38Å; A45-F49 PolarHBondContact O-N 3.46Å
46	I	96.9	Very high	96.4	Very high	89 Å²	89	88.7 Å²	88.7	46%	0.456	50%	0.498	S	S	.	.	H	α-helix	trans	-63.6	-49.2	178	-67.4	168.2	0	0	0	110.7	I42 G43 G48 F49 I50	I42-I46 HydrophobicContact CG2-CD1 3.89Å; I42-I46 HydrophobicContact CG2-CG1 4.5Å; I42-I46 WeakPolarHBondContact O-CG1 3.26Å; I42-I46 PolarHBondContact O-N 3.36Å; G43-I46 PolarHBondContact O-N 3.46Å; I46-G48 VanDerWaalsContact C-N 3.34Å; I46-G48 PolarHBondContact O-N 2.87Å; I46-F49 PolarHBondContact O-N 2.96Å; I46-I50 HydrophobicContact CG2-CD1 3.86Å; I46-I50 VanDerWaalsContact O-CG1 3.31Å; I46-I50 WeakPolarHBondContact O-CG1 3.32Å; I46-I50 PolarHBondContact O-N 3.33Å
47	M	96.2	Very high	96.2	Very high	136 Å²	136	88.8 Å²	88.8	67%	0.67	50%	0.499	S	S	*	.	H	α-helix	trans	-64	-40.5	-179.8	-65.2	-62.5	156.9	0	0	111.7	G43 G51	G43-M47 VanDerWaalsContact O-CG 3.29Å; G43-M47 WeakPolarHBondContact O-CG 3.31Å; G43-M47 PolarHBondContact O-N 3.42Å; M47-G51 PolarHBondContact O-N 3.13Å; M47-G51 VanDerWaalsContact O-N 3.09Å
48	G	95.6	Very high	96	Very high	42 Å²	42	92 Å²	92	43%	0.433	51%	0.506	S	S	.	.	H	α-helix	trans	-64.6	-42.2	174.7	0	0	0	0	0	112.8	F44 A45 I46 G51 F52	F44-G48 PolarHBondContact O-N 2.85Å; A45-G48 PolarHBondContact O-N 3.49Å; I46-G48 VanDerWaalsContact C-N 3.34Å; I46-G48 PolarHBondContact O-N 2.87Å; G48-G51 PolarHBondContact O-N 3Å; G48-F52 WeakPolarHBondContact O-CB 3.49Å; G48-F52 PolarHBondContact O-N 2.84Å
49	F	95.9	Very high	95.8	Very high	128 Å²	128	90.8 Å²	90.8	56%	0.561	50%	0.502	S	S	*	.	H	α-helix	trans	-63.5	-48.1	177.6	-168.2	-94.8	0	0	0	111.1	A45 I46 G51 F52 F53	A45-F49 WeakPolarHBondContact O-CB 3.38Å; A45-F49 PolarHBondContact O-N 3.46Å; I46-F49 PolarHBondContact O-N 2.96Å; F49-G51 VanDerWaalsContact C-N 3.31Å; F49-G51 PolarHBondContact O-N 3.28Å; F49-F52 WeakPolarHBondContact O-CB 3.2Å; F49-F52 PolarHBondContact O-N 3.23Å; F49-F52 VanDerWaalsContact O-N 3.13Å; F49-F53 AromaticContact CD1-CD2 3.63Å; F49-F53 HydrophobicContact CD1-CD2 3.63Å; F49-F53 AromaticContact CD1-CE2 3.78Å; F49-F53 HydrophobicContact CD1-CE2 3.78Å; F49-F53 HydrophobicContact CD2-CD2 4.17Å; F49-F53 AromaticContact CD2-CE2 3.7Å; F49-F53 HydrophobicContact CD2-CE2 3.7Å; F49-F53 AromaticContact CE1-CD2 3.46Å; F49-F53 HydrophobicContact CE1-CD2 3.46Å; F49-F53 VanDerWaalsContact CE1-CD2 3.46Å; F49-F53 AromaticContact CE1-CE2 3.27Å; F49-F53 HydrophobicContact CE1-CE2 3.27Å; F49-F53 HydrophobicContact CE1-CG 4.34Å; F49-F53 AromaticContact CE1-CZ 3.94Å; F49-F53 HydrophobicContact CE1-CZ 3.94Å; F49-F53 HydrophobicContact CE2-CD2 4.06Å; F49-F53 AromaticContact CE2-CE2 3.22Å; F49-F53 HydrophobicContact CE2-CE2 3.22Å; F49-F53 AromaticContact CE2-CZ 3.93Å; F49-F53 HydrophobicContact CE2-CZ 3.93Å; F49-F53 AromaticContact CG-CD2 4Å; F49-F53 HydrophobicContact CG-CD2 4Å; F49-F53 AromaticContact CG-CE2 3.99Å; F49-F53 HydrophobicContact CG-CE2 3.99Å; F49-F53 AromaticContact CZ-CD2 3.71Å; F49-F53 HydrophobicContact CZ-CD2 3.71Å; F49-F53 AromaticContact CZ-CE2 2.98Å; F49-F53 HydrophobicContact CZ-CE2 2.98Å; F49-F53 AromaticContact CZ-CZ 3.45Å; F49-F53 HydrophobicContact CZ-CZ 3.45Å; F49-F53 VanDerWaalsContact CZ-CZ 3.45Å; F49-F53 WeakPolarHBondContact O-CD2 3.4Å; F49-F53 PolarHBondContact O-N 2.93Å
50	I	96.1	Very high	95.6	Very high	92 Å²	92	91 Å²	91	47%	0.472	50%	0.497	S	S	.	.	H	α-helix	trans	-55.9	-48.7	175.9	-66.5	165.9	0	0	0	110.2	I46 F52 F53 V54	I46-I50 HydrophobicContact CG2-CD1 3.86Å; I46-I50 VanDerWaalsContact O-CG1 3.31Å; I46-I50 WeakPolarHBondContact O-CG1 3.32Å; I46-I50 PolarHBondContact O-N 3.33Å; I50-F52 VanDerWaalsContact C-N 3.32Å; I50-F52 PolarHBondContact O-N 3.36Å; I50-F53 PolarHBondContact O-N 2.95Å; I50-V54 HydrophobicContact CG2-CG2 4.18Å; I50-V54 WeakPolarHBondContact O-CB 3.38Å; I50-V54 WeakPolarHBondContact O-CG2 3.34Å; I50-V54 PolarHBondContact O-N 2.94Å
51	G	95.5	Very high	95.4	Very high	41 Å²	41	90.1 Å²	90.1	42%	0.423	49%	0.489	S	S	.	.	H	α-helix	trans	-59.8	-39.1	177.8	0	0	0	0	0	113.7	M47 G48 F49 K55	M47-G51 PolarHBondContact O-N 3.13Å; M47-G51 VanDerWaalsContact O-N 3.09Å; G48-G51 PolarHBondContact O-N 3Å; F49-G51 VanDerWaalsContact C-N 3.31Å; F49-G51 PolarHBondContact O-N 3.28Å; G51-K55 WeakPolarHBondContact O-CB 3.35Å; G51-K55 PolarHBondContact O-N 3.26Å
52	F	96.5	Very high	95.2	Very high	120 Å²	120	92.1 Å²	92.1	53%	0.526	49%	0.491	S	S	.	.	H	α-helix	trans	-64.1	-48.2	176.9	-179.4	-107.2	0	0	0	112	G48 F49 I50 K55 L56	G48-F52 WeakPolarHBondContact O-CB 3.49Å; G48-F52 PolarHBondContact O-N 2.84Å; F49-F52 WeakPolarHBondContact O-CB 3.2Å; F49-F52 PolarHBondContact O-N 3.23Å; F49-F52 VanDerWaalsContact O-N 3.13Å; I50-F52 VanDerWaalsContact C-N 3.32Å; I50-F52 PolarHBondContact O-N 3.36Å; F52-K55 PolarHBondContact O-N 3.06Å; F52-L56 HydrophobicContact CD1-CD1 3.73Å; F52-L56 HydrophobicContact CD1-CG 4.29Å; F52-L56 HydrophobicContact CE1-CD1 3.21Å; F52-L56 HydrophobicContact CE1-CG 4Å; F52-L56 HydrophobicContact CE2-CD1 4.29Å; F52-L56 HydrophobicContact CE2-CD2 4.41Å; F52-L56 HydrophobicContact CE2-CG 4.25Å; F52-L56 HydrophobicContact CG-CD1 4.47Å; F52-L56 HydrophobicContact CZ-CD1 3.54Å; F52-L56 HydrophobicContact CZ-CD2 4.19Å; F52-L56 HydrophobicContact CZ-CG 3.97Å; F52-L56 WeakPolarHBondContact O-CB 3.21Å; F52-L56 WeakPolarHBondContact O-CG 3.28Å; F52-L56 PolarHBondContact O-N 3.43Å
53	F	94.1	Very high	94.9	Very high	88 Å²	88	93.5 Å²	93.5	39%	0.386	50%	0.5	S	S	.	.	H	α-helix	trans	-68.6	-40	179.7	-82.9	-92.8	0	0	0	112.7	F49 I50 K55 L56 I57	F49-F53 AromaticContact CD1-CD2 3.63Å; F49-F53 HydrophobicContact CD1-CD2 3.63Å; F49-F53 AromaticContact CD1-CE2 3.78Å; F49-F53 HydrophobicContact CD1-CE2 3.78Å; F49-F53 HydrophobicContact CD2-CD2 4.17Å; F49-F53 AromaticContact CD2-CE2 3.7Å; F49-F53 HydrophobicContact CD2-CE2 3.7Å; F49-F53 AromaticContact CE1-CD2 3.46Å; F49-F53 HydrophobicContact CE1-CD2 3.46Å; F49-F53 VanDerWaalsContact CE1-CD2 3.46Å; F49-F53 AromaticContact CE1-CE2 3.27Å; F49-F53 HydrophobicContact CE1-CE2 3.27Å; F49-F53 HydrophobicContact CE1-CG 4.34Å; F49-F53 AromaticContact CE1-CZ 3.94Å; F49-F53 HydrophobicContact CE1-CZ 3.94Å; F49-F53 HydrophobicContact CE2-CD2 4.06Å; F49-F53 AromaticContact CE2-CE2 3.22Å; F49-F53 HydrophobicContact CE2-CE2 3.22Å; F49-F53 AromaticContact CE2-CZ 3.93Å; F49-F53 HydrophobicContact CE2-CZ 3.93Å; F49-F53 AromaticContact CG-CD2 4Å; F49-F53 HydrophobicContact CG-CD2 4Å; F49-F53 AromaticContact CG-CE2 3.99Å; F49-F53 HydrophobicContact CG-CE2 3.99Å; F49-F53 AromaticContact CZ-CD2 3.71Å; F49-F53 HydrophobicContact CZ-CD2 3.71Å; F49-F53 AromaticContact CZ-CE2 2.98Å; F49-F53 HydrophobicContact CZ-CE2 2.98Å; F49-F53 AromaticContact CZ-CZ 3.45Å; F49-F53 HydrophobicContact CZ-CZ 3.45Å; F49-F53 VanDerWaalsContact CZ-CZ 3.45Å; F49-F53 WeakPolarHBondContact O-CD2 3.4Å; F49-F53 PolarHBondContact O-N 2.93Å; I50-F53 PolarHBondContact O-N 2.95Å; F53-K55 VanDerWaalsContact C-N 3.32Å; F53-K55 PolarHBondContact O-N 3.41Å; F53-L56 PolarHBondContact O-N 3.29Å; F53-I57 WeakPolarHBondContact O-CG1 3.31Å; F53-I57 PolarHBondContact O-N 3.24Å
54	V	95.2	Very high	94.6	Very high	73 Å²	73	97.9 Å²	97.9	44%	0.442	51%	0.514	S	S	.	.	H	α-helix	trans	-56	-51.1	172.2	171.1	0	0	0	0	109.1	I50 L56 I57 H58	I50-V54 HydrophobicContact CG2-CG2 4.18Å; I50-V54 WeakPolarHBondContact O-CB 3.38Å; I50-V54 WeakPolarHBondContact O-CG2 3.34Å; I50-V54 PolarHBondContact O-N 2.94Å; V54-L56 PolarHBondContact O-N 3.44Å; V54-I57 PolarHBondContact O-N 2.71Å; V54-H58 PolarHBondContact O-N 3.45Å; V54-H58 PolarHBondContact O-ND1 2.99Å
55	K	93.8	Very high	94.3	Very high	151 Å²	151	95.4 Å²	95.4	66%	0.657	51%	0.508	S	S	*	.	H	α-helix	trans	-62	-42.7	178.9	-171.1	170.9	-176.3	175.7	0	112.5	G51 F52 F53 I57 H58 I59	G51-K55 WeakPolarHBondContact O-CB 3.35Å; G51-K55 PolarHBondContact O-N 3.26Å; F52-K55 PolarHBondContact O-N 3.06Å; F53-K55 VanDerWaalsContact C-N 3.32Å; F53-K55 PolarHBondContact O-N 3.41Å; K55-I57 VanDerWaalsContact C-N 3.32Å; K55-I57 PolarHBondContact O-N 3.16Å; K55-H58 PolarHBondContact O-N 3.31Å; K55-I59 HydrophobicContact CG-CD1 4.44Å; K55-I59 WeakPolarHBondContact O-CG1 3.35Å; K55-I59 PolarHBondContact O-N 3.3Å; K55-I59 VanDerWaalsContact O-N 3.16Å
56	L	94.6	Very high	93.8	Very high	76 Å²	76	97.7 Å²	97.7	40%	0.398	52%	0.515	S	S	.	.	H	α-helix	trans	-60.2	-39	178	-79.3	-176.5	0	0	0	113.1	F52 F53 V54 P60	F52-L56 HydrophobicContact CD1-CD1 3.73Å; F52-L56 HydrophobicContact CD1-CG 4.29Å; F52-L56 HydrophobicContact CE1-CD1 3.21Å; F52-L56 HydrophobicContact CE1-CG 4Å; F52-L56 HydrophobicContact CE2-CD1 4.29Å; F52-L56 HydrophobicContact CE2-CD2 4.41Å; F52-L56 HydrophobicContact CE2-CG 4.25Å; F52-L56 HydrophobicContact CG-CD1 4.47Å; F52-L56 HydrophobicContact CZ-CD1 3.54Å; F52-L56 HydrophobicContact CZ-CD2 4.19Å; F52-L56 HydrophobicContact CZ-CG 3.97Å; F52-L56 WeakPolarHBondContact O-CB 3.21Å; F52-L56 WeakPolarHBondContact O-CG 3.28Å; F52-L56 PolarHBondContact O-N 3.43Å; F53-L56 PolarHBondContact O-N 3.29Å; V54-L56 PolarHBondContact O-N 3.44Å; L56-P60 WeakPolarHBondContact O-CD 3.45Å
57	I	93.8	Very high	92.9	Very high	97 Å²	97	96.7 Å²	96.7	50%	0.497	53%	0.527	S	S	.	.	H	α-helix	trans	-73.8	-35.1	178.1	-67.6	166.6	0	0	0	111	F53 V54 K55 I59 P60 I61	F53-I57 WeakPolarHBondContact O-CG1 3.31Å; F53-I57 PolarHBondContact O-N 3.24Å; V54-I57 PolarHBondContact O-N 2.71Å; K55-I57 VanDerWaalsContact C-N 3.32Å; K55-I57 PolarHBondContact O-N 3.16Å; I57-I59 PolarHBondContact O-N 2.86Å; I57-P60 VanDerWaalsContact O-CD 3.24Å; I57-P60 WeakPolarHBondContact O-CD 3.46Å; I57-P60 VanDerWaalsContact O-CG 3.31Å; I57-P60 WeakPolarHBondContact O-CG 3.33Å; I57-I61 HydrophobicContact CG2-CD1 3.52Å; I57-I61 HydrophobicContact CG2-CG1 4.41Å; I57-I61 WeakPolarHBondContact O-CD1 3.35Å; I57-I61 WeakPolarHBondContact O-CG1 3.23Å; I57-I61 PolarHBondContact O-N 2.97Å
58	H	92.8	Very high	91.4	Very high	109 Å²	109	95.8 Å²	95.8	51%	0.505	55%	0.553	S	S	.	*	H	α-helix	trans	-71.2	-27.8	179.8	-75.6	82.7	0	0	0	113.5	V54 K55 I61 N62	V54-H58 PolarHBondContact O-N 3.45Å; V54-H58 PolarHBondContact O-ND1 2.99Å; K55-H58 PolarHBondContact O-N 3.31Å; H58-I61 PolarHBondContact O-N 2.93Å; H58-N62 VanDerWaalsContact O-CB 3.23Å; H58-N62 WeakPolarHBondContact O-CB 3.21Å; H58-N62 PolarHBondContact O-N 3.03Å
59	I	92.5	Very high	91.2	Very high	103 Å²	103	98.5 Å²	98.5	53%	0.528	56%	0.559	S	S	.	*	H	α-helix	trans	-58.8	-56.6	177.2	-68.2	161.9	0	0	0	112.7	K55 I57 N62 N63	K55-I59 HydrophobicContact CG-CD1 4.44Å; K55-I59 WeakPolarHBondContact O-CG1 3.35Å; K55-I59 PolarHBondContact O-N 3.3Å; K55-I59 VanDerWaalsContact O-N 3.16Å; I57-I59 PolarHBondContact O-N 2.86Å; I59-N62 PolarHBondContact O-N 2.84Å; I59-N63 PolarHBondContact O-N 3.41Å
60	P	92.6	Very high	90.9	Very high	66 Å²	66	96.9 Å²	96.9	43%	0.429	56%	0.558	S	S	.	*	H	α-helix	trans	-66.9	-36.9	178.2	26.5	-33.9	0	0	0	111.7	L56 I57 N62 N63 I64	L56-P60 WeakPolarHBondContact O-CD 3.45Å; I57-P60 VanDerWaalsContact O-CD 3.24Å; I57-P60 WeakPolarHBondContact O-CD 3.46Å; I57-P60 VanDerWaalsContact O-CG 3.31Å; I57-P60 WeakPolarHBondContact O-CG 3.33Å; P60-N62 PolarHBondContact O-N 3.47Å; P60-N63 PolarHBondContact O-N 3.49Å; P60-I64 VanDerWaalsContact O-CG1 3.25Å; P60-I64 WeakPolarHBondContact O-CG1 2.91Å; P60-I64 PolarHBondContact O-N 3.48Å
61	I	94.1	Very high	90.6	Very high	74 Å²	74	97.2 Å²	97.2	38%	0.379	56%	0.563	S	S	.	*	H	α-helix	trans	-59.6	-47.3	176	-68.5	173.5	0	0	0	110.6	I57 H58 N63 I64 I65	I57-I61 HydrophobicContact CG2-CD1 3.52Å; I57-I61 HydrophobicContact CG2-CG1 4.41Å; I57-I61 WeakPolarHBondContact O-CD1 3.35Å; I57-I61 WeakPolarHBondContact O-CG1 3.23Å; I57-I61 PolarHBondContact O-N 2.97Å; H58-I61 PolarHBondContact O-N 2.93Å; I61-N63 VanDerWaalsContact C-N 3.32Å; I61-N63 PolarHBondContact O-N 2.94Å; I61-I64 PolarHBondContact O-N 3.45Å; I61-I65 HydrophobicContact CG2-CD1 3.55Å; I61-I65 HydrophobicContact CG2-CG1 4.36Å; I61-I65 VanDerWaalsContact O-CG1 3.28Å; I61-I65 WeakPolarHBondContact O-CG1 3.25Å; I61-I65 PolarHBondContact O-N 3.22Å
62	N	92.7	Very high	90.3	Very high	101 Å²	101	100.5 Å²	100.5	54%	0.54	57%	0.571	S	S	.	*	H	α-helix	trans	-64.8	-36.9	177.7	-173.2	78	0	0	0	111.9	H58 I59 P60 I64 I65 V66	H58-N62 VanDerWaalsContact O-CB 3.23Å; H58-N62 WeakPolarHBondContact O-CB 3.21Å; H58-N62 PolarHBondContact O-N 3.03Å; I59-N62 PolarHBondContact O-N 2.84Å; P60-N62 PolarHBondContact O-N 3.47Å; N62-I64 VanDerWaalsContact C-N 3.35Å; N62-I65 PolarHBondContact O-N 3.18Å; N62-V66 WeakPolarHBondContact O-CB 3.31Å; N62-V66 VanDerWaalsContact O-CG2 3.31Å; N62-V66 WeakPolarHBondContact O-CG2 3.43Å; N62-V66 PolarHBondContact O-N 2.89Å
63	N	92	Very high	90	Very high	119 Å²	119	99.3 Å²	99.3	64%	0.636	57%	0.574	S	S	*	*	H	α-helix	trans	-65.8	-37.1	175.3	-166.5	59.4	0	0	0	112.4	I59 P60 I61 G67	I59-N63 PolarHBondContact O-N 3.41Å; P60-N63 PolarHBondContact O-N 3.49Å; I61-N63 VanDerWaalsContact C-N 3.32Å; I61-N63 PolarHBondContact O-N 2.94Å; N63-G67 WeakPolarHBondContact O-CA 3.24Å; N63-G67 PolarHBondContact O-N 3.42Å
64	I	91.7	Very high	89.7	Confident	123 Å²	123	100.1 Å²	100.1	63%	0.631	59%	0.587	S	S	*	*	H	α-helix	trans	-69.7	-40.9	176	-67.4	162.9	0	0	0	111.1	P60 I61 N62 G68	P60-I64 VanDerWaalsContact O-CG1 3.25Å; P60-I64 WeakPolarHBondContact O-CG1 2.91Å; P60-I64 PolarHBondContact O-N 3.48Å; I61-I64 PolarHBondContact O-N 3.45Å; N62-I64 VanDerWaalsContact C-N 3.35Å; I64-G68 PolarHBondContact O-N 3.01Å
65	I	90.1	Very high	89.3	Confident	117 Å²	117	102 Å²	102	60%	0.6	60%	0.597	S	S	*	*	H	α-helix	trans	-76	-35.3	-177.1	-66.6	170.5	0	0	0	112.5	I61 N62	I61-I65 HydrophobicContact CG2-CD1 3.55Å; I61-I65 HydrophobicContact CG2-CG1 4.36Å; I61-I65 VanDerWaalsContact O-CG1 3.28Å; I61-I65 WeakPolarHBondContact O-CG1 3.25Å; I61-I65 PolarHBondContact O-N 3.22Å; N62-I65 PolarHBondContact O-N 3.18Å
66	V	87.8	Confident	88.9	Confident	106 Å²	106	98.2 Å²	98.2	64%	0.642	59%	0.593	S	S	*	*	H	α-helix	trans	-89.3	-30.6	-178.4	178.5	0	0	0	0	112	N62	N62-V66 WeakPolarHBondContact O-CB 3.31Å; N62-V66 VanDerWaalsContact O-CG2 3.31Å; N62-V66 WeakPolarHBondContact O-CG2 3.43Å; N62-V66 PolarHBondContact O-N 2.89Å
67	G	76.9	Confident	88.5	Confident	69 Å²	69	100.1 Å²	100.1	71%	0.711	61%	0.609	S	S	*	*	H	α-helix	trans	-93.2	-12.9	-177.7	0	0	0	0	0	115.3	N63	N63-G67 WeakPolarHBondContact O-CA 3.24Å; N63-G67 PolarHBondContact O-N 3.42Å
68	G	64.7	Low	88	Confident	117 Å²	117	100.4 Å²	100.4	100%	1.206	62%	0.619	S	S	*	*			trans	-98.1	0	169.6	0	0	0	0	0	110.8	I64	I64-G68 PolarHBondContact O-N 3.01Å

Retrieved 68 of 68 residues in 41.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).