A0A087XRD2_POEFO Loading...

U6 snRNA-associated Sm-like protein LSm3

Binds specifically to the 3'-terminal U-tract of U6 snRNA. Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.

AlphaFold DB (A0A3Q1B2C9), UniProt , Accession A0A087XRD2, Species POEFO (Poecilia formosa, Amazon molly), Gene LSM3, Length 102 aa.

						>A0A087XRD2_POEFO|A0A087XRD2|LSM3
MADEVEQQPTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTVEIDEETYEELYKSTKRNIPMLFVRGDGVVLVAPPLRVG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.3	Very low	52.3	Low	245 Å²	245	149.1 Å²	149.1	100%	1.207	80%	0.804	S	S	*	*				0	107	0	-72.4	170.4	169.1	0	0	104.5
2	A	46.3	Very low	52.8	Low	94 Å²	94	148.8 Å²	148.8	78%	0.777	80%	0.801	S	S	*	*			trans	-77.2	129.1	-178.2	0	0	0	0	0	107.5	E4	A2-E4 PolarHBondContact O-N 2.62Å
3	D	49.1	Very low	53.7	Low	158 Å²	158	142.7 Å²	142.7	85%	0.845	77%	0.773	S	S	*	*			trans	-60.6	105.7	173.1	-72.2	-56.5	0	0	0	109.1	V5	D3-V5 PolarHBondContact O-N 2.86Å
4	E	57.7	Low	54.9	Low	185 Å²	185	137.5 Å²	137.5	86%	0.864	75%	0.748	S	S	*	*			trans	-72.2	99	163.4	-77.4	178	146.4	0	0	107.2	A2 E6	A2-E4 PolarHBondContact O-N 2.62Å; E4-E6 PolarHBondContact O-N 3.19Å
5	V	55.7	Low	56.5	Low	128 Å²	128	138.7 Å²	138.7	78%	0.776	75%	0.746	S	S	*	*			trans	-71.8	99.1	169.1	-174.1	0	0	0	0	107.1	D3 Q7	D3-V5 PolarHBondContact O-N 2.86Å; V5-Q7 PolarHBondContact O-N 2.74Å; V5-Q7 VanDerWaalsContact O-N 3.16Å
6	E	55.1	Low	58.3	Low	167 Å²	167	137.4 Å²	137.4	78%	0.78	73%	0.734	S	S	*	*			trans	-55.4	115.2	173	-72.6	-177.4	145.2	0	0	110	E4 Q8	E4-E6 PolarHBondContact O-N 3.19Å; E6-Q8 PolarHBondContact O-N 2.79Å; E6-Q8 VanDerWaalsContact O-N 3.08Å
7	Q	54.5	Low	59.9	Low	192 Å²	192	136 Å²	136	90%	0.897	73%	0.734	S	S	*	*			trans	-73.6	97.8	169	-72.3	177.4	7.2	0	0	108.2	V5	V5-Q7 PolarHBondContact O-N 2.74Å; V5-Q7 VanDerWaalsContact O-N 3.16Å
8	Q	53.7	Low	61.4	Low	163 Å²	163	131.3 Å²	131.3	76%	0.762	71%	0.709	S	S	*	*			trans	-63.2	136.7	172.3	-71.3	-178.1	-2.4	0	0	110	E6 T10	E6-Q8 PolarHBondContact O-N 2.79Å; E6-Q8 VanDerWaalsContact O-N 3.08Å; Q8-T10 PolarHBondContact O-N 3.06Å
9	P	50	Low	62.6	Low	117 Å²	117	126.5 Å²	126.5	76%	0.76	68%	0.682	S	S	*	*			trans	-64	121.8	176.5	25.9	-30.8	0	0	0	108.5	T11	P9-T11 PolarHBondContact O-N 2.88Å
10	T	54.8	Low	63.5	Low	93 Å²	93	125.1 Å²	125.1	57%	0.571	67%	0.674	S	S	*	*			trans	-64	100.9	177.7	52.3	0	0	0	0	108.7	Q8 N12	Q8-T10 PolarHBondContact O-N 3.06Å; T10-N12 PolarHBondContact O-N 3.43Å
11	T	53.9	Low	64.6	Low	98 Å²	98	120.2 Å²	120.2	60%	0.601	65%	0.647	S	S	*	*			trans	-57	130.6	167.9	45	0	0	0	0	107.6	P9 T13	P9-T11 PolarHBondContact O-N 2.88Å; T11-T13 PolarHBondContact O-N 3.31Å; T11-T13 PolarHBondContact OG1-OG1 2.87Å
12	N	58.8	Low	66.7	Low	145 Å²	145	114.4 Å²	114.4	78%	0.775	61%	0.612	S	S	*	*			trans	-70.3	38.5	172.2	-77.4	-20.6	0	0	0	111.3	T10	T10-N12 PolarHBondContact O-N 3.43Å
13	T	64.4	Low	68.6	Low	70 Å²	70	113.9 Å²	113.9	43%	0.429	60%	0.596	S	S	.	*			trans	-86.3	122.3	172.9	44.3	0	0	0	0	107.1	T11 E15	T11-T13 PolarHBondContact O-N 3.31Å; T11-T13 PolarHBondContact OG1-OG1 2.87Å; T13-E15 PolarHBondContact O-N 3.4Å; T13-E15 PolarHBondContact OG1-OE1 2.83Å
14	V	70.8	Confident	70.6	Confident	70 Å²	70	106.6 Å²	106.6	42%	0.424	56%	0.557	S	S	.	*			trans	-75.8	102.5	171.2	176.7	0	0	0	0	106.4	D19 L20 L23	V14-D19 HydrophobicContact CG1-CB 4.34Å; V14-L20 HydrophobicContact CB-CD2 4.28Å; V14-L20 HydrophobicContact CG1-CD1 4.32Å; V14-L20 HydrophobicContact CG1-CD2 3.6Å; V14-L20 HydrophobicContact CG1-CG 3.55Å; V14-L20 HydrophobicContact CG2-CD2 3.74Å; V14-L20 HydrophobicContact CG2-CG 4.47Å; V14-L23 HydrophobicContact CG2-CD1 3.61Å
15	E	78.7	Confident	72.3	Confident	155 Å²	155	101.1 Å²	101.1	72%	0.724	53%	0.534	S	S	*	.			trans	-104.6	-34.6	179.5	-65.5	-171.8	-171.2	0	0	110.7	T13 D19	T13-E15 PolarHBondContact O-N 3.4Å; T13-E15 PolarHBondContact OG1-OE1 2.83Å; E15-D19 PolarHBondContact N-OD2 2.74Å; E15-D19 VanDerWaalsContact N-OD2 3.15Å
16	E	85.8	Confident	74.1	Confident	119 Å²	119	100.7 Å²	100.7	56%	0.556	53%	0.527	S	S	*	.	S	Bend	trans	-116.6	154.9	177.2	-62.6	-170.4	174.6	0	0	112.7	L18 D19	E16-L18 PolarHBondContact O-N 2.85Å; E16-L18 VanDerWaalsContact O-N 3.14Å; E16-D19 PolarHBondContact N-OD2 2.96Å; E16-D19 VanDerWaalsContact O-CB 3.32Å; E16-D19 WeakPolarHBondContact O-CB 3.34Å; E16-D19 PolarHBondContact O-N 2.94Å
17	P	84.3	Confident	76	Confident	113 Å²	113	96 Å²	96	73%	0.734	51%	0.505	S	S	*	.	H	α-helix	trans	-55.9	-31.3	175.4	-26.1	34.8	0	0	0	113.8	D19 L20	P17-D19 VanDerWaalsContact C-N 3.29Å; P17-D19 PolarHBondContact O-N 2.9Å; P17-L20 WeakPolarHBondContact O-CB 3.46Å; P17-L20 PolarHBondContact O-N 2.85Å
18	L	86.9	Confident	77.9	Confident	52 Å²	52	94.1 Å²	94.1	27%	0.272	49%	0.49	S	S	.	.	H	α-helix	trans	-72.4	-21.9	178	-68.7	178.7	0	0	0	112.9	E16 L20 I21 R22 Y46 L50	E16-L18 PolarHBondContact O-N 2.85Å; E16-L18 VanDerWaalsContact O-N 3.14Å; L18-L20 PolarHBondContact O-N 2.92Å; L18-I21 PolarHBondContact O-N 2.77Å; L18-R22 PolarHBondContact O-N 3.01Å; L18-Y46 HydrophobicContact CB-CE2 4.48Å; L18-Y46 HydrophobicContact CD2-CE2 4.44Å; L18-Y46 PolarHBondContact O-OH 2.83Å; L18-Y46 VanDerWaalsContact O-OH 3.1Å; L18-L50 HydrophobicContact CD2-CD2 3.92Å
19	D	84.1	Confident	79.9	Confident	39 Å²	39	86.6 Å²	86.6	21%	0.209	46%	0.455	C	S	.	.	H	α-helix	trans	-67.1	-29.7	175.2	-63.3	-34.8	0	0	0	111.4	V14 E15 E16 P17 R22 L23	V14-D19 HydrophobicContact CG1-CB 4.34Å; E15-D19 PolarHBondContact N-OD2 2.74Å; E15-D19 VanDerWaalsContact N-OD2 3.15Å; E16-D19 PolarHBondContact N-OD2 2.96Å; E16-D19 VanDerWaalsContact O-CB 3.32Å; E16-D19 WeakPolarHBondContact O-CB 3.34Å; E16-D19 PolarHBondContact O-N 2.94Å; P17-D19 VanDerWaalsContact C-N 3.29Å; P17-D19 PolarHBondContact O-N 2.9Å; D19-R22 VanDerWaalsContact O-CB 3.22Å; D19-R22 WeakPolarHBondContact O-CB 3.22Å; D19-R22 PolarHBondContact O-N 2.91Å; D19-L23 WeakPolarHBondContact O-CG 3.49Å; D19-L23 PolarHBondContact O-N 3.3Å; D19-L23 VanDerWaalsContact O-N 3.09Å
20	L	81.1	Confident	82.1	Confident	99 Å²	99	83.5 Å²	83.5	52%	0.518	43%	0.428	S	S	.	.	H	α-helix	trans	-64.5	-40.2	173.4	-70	173	0	0	0	112.1	V14 P17 L18 R22 L23 S24	V14-L20 HydrophobicContact CB-CD2 4.28Å; V14-L20 HydrophobicContact CG1-CD1 4.32Å; V14-L20 HydrophobicContact CG1-CD2 3.6Å; V14-L20 HydrophobicContact CG1-CG 3.55Å; V14-L20 HydrophobicContact CG2-CD2 3.74Å; V14-L20 HydrophobicContact CG2-CG 4.47Å; P17-L20 WeakPolarHBondContact O-CB 3.46Å; P17-L20 PolarHBondContact O-N 2.85Å; L18-L20 PolarHBondContact O-N 2.92Å; L20-R22 VanDerWaalsContact C-N 3.3Å; L20-L23 PolarHBondContact O-N 2.69Å; L20-S24 PolarHBondContact O-N 2.84Å; L20-S24 PolarHBondContact O-OG 2.92Å
21	I	87	Confident	84.1	Confident	22 Å²	22	79.1 Å²	79.1	11%	0.113	40%	0.401	C	S	.	.	H	α-helix	trans	-66.7	-37	174.1	-85.3	175.1	0	0	0	110.3	L18 L23 S24 L43 Y46 L50 V95	L18-I21 PolarHBondContact O-N 2.77Å; I21-L23 VanDerWaalsContact C-N 3.26Å; I21-L23 PolarHBondContact O-N 2.77Å; I21-S24 WeakPolarHBondContact O-CA 3.2Å; I21-S24 WeakPolarHBondContact O-CB 3.5Å; I21-S24 PolarHBondContact O-N 3.29Å; I21-L43 HydrophobicContact CG2-CD2 3.91Å; I21-Y46 HydrophobicContact CG2-CD1 3.65Å; I21-Y46 HydrophobicContact CG2-CD2 3.72Å; I21-Y46 HydrophobicContact CG2-CE1 3.64Å; I21-Y46 HydrophobicContact CG2-CE2 3.68Å; I21-Y46 HydrophobicContact CG2-CG 3.71Å; I21-L50 HydrophobicContact CD1-CD2 3.71Å; I21-V95 HydrophobicContact CD1-CB 3.91Å; I21-V95 HydrophobicContact CD1-CG1 3.93Å; I21-V95 HydrophobicContact CD1-CG2 3.98Å; I21-V95 HydrophobicContact CG1-CB 4.48Å; I21-V95 HydrophobicContact CG1-CG1 4.07Å
22	R	87.7	Confident	86.2	Confident	124 Å²	124	78.2 Å²	78.2	47%	0.468	39%	0.389	S	S	.	.	H	α-helix	trans	-57.2	-41.1	175.1	-159	177.7	168.6	-176.9	-3.9	112.3	L18 D19 L20 S24 L25 Y46	L18-R22 PolarHBondContact O-N 3.01Å; D19-R22 VanDerWaalsContact O-CB 3.22Å; D19-R22 WeakPolarHBondContact O-CB 3.22Å; D19-R22 PolarHBondContact O-N 2.91Å; L20-R22 VanDerWaalsContact C-N 3.3Å; R22-S24 PolarHBondContact O-N 3.21Å; R22-L25 HydrophobicContact CG-CD1 4.17Å; R22-L25 WeakPolarHBondContact O-CB 3.22Å; R22-L25 WeakPolarHBondContact O-CG 3.44Å; R22-L25 PolarHBondContact O-N 3.47Å; R22-Y46 WeakPolarHBondContact CA-OH 3.25Å; R22-Y46 HydrophobicContact CB-CE1 4.43Å; R22-Y46 WeakPolarHBondContact CB-OH 3.4Å; R22-Y46 PolarHBondContact N-OH 2.86Å
23	L	87.6	Confident	88	Confident	82 Å²	82	72.8 Å²	72.8	43%	0.429	36%	0.359	S	S	.	.	T	Hydrogen-bonded Turn	trans	-67.2	-15.3	176	-66	174.9	0	0	0	113.3	V14 D19 L20 I21	V14-L23 HydrophobicContact CG2-CD1 3.61Å; D19-L23 WeakPolarHBondContact O-CG 3.49Å; D19-L23 PolarHBondContact O-N 3.3Å; D19-L23 VanDerWaalsContact O-N 3.09Å; L20-L23 PolarHBondContact O-N 2.69Å; I21-L23 VanDerWaalsContact C-N 3.26Å; I21-L23 PolarHBondContact O-N 2.77Å
24	S	89.7	Confident	89.5	Confident	6 Å²	6	77 Å²	77	4%	0.042	37%	0.368	C	S	.	.	T	Hydrogen-bonded Turn	trans	-99.2	9.6	179.4	-49.4	0	0	0	0	112.8	L20 I21 R22 E27	L20-S24 PolarHBondContact O-N 2.84Å; L20-S24 PolarHBondContact O-OG 2.92Å; I21-S24 WeakPolarHBondContact O-CA 3.2Å; I21-S24 WeakPolarHBondContact O-CB 3.5Å; I21-S24 PolarHBondContact O-N 3.29Å; R22-S24 PolarHBondContact O-N 3.21Å; S24-E27 WeakPolarHBondContact O-CB 3.47Å; S24-E27 PolarHBondContact O-N 2.83Å; S24-E27 VanDerWaalsContact O-N 3.17Å
25	L	93.4	Very high	90.5	Very high	70 Å²	70	80.1 Å²	80.1	37%	0.366	38%	0.382	S	S	.	.	T	Hydrogen-bonded Turn	trans	-61.6	139.1	172.4	-77.9	170.4	0	0	0	110.6	R22 E27 L43 Y46	R22-L25 HydrophobicContact CG-CD1 4.17Å; R22-L25 WeakPolarHBondContact O-CB 3.22Å; R22-L25 WeakPolarHBondContact O-CG 3.44Å; R22-L25 PolarHBondContact O-N 3.47Å; L25-E27 PolarHBondContact O-N 2.81Å; L25-L43 HydrophobicContact CD2-CD2 4.22Å; L25-L43 HydrophobicContact CD2-CG 4.18Å; L25-Y46 HydrophobicContact CD1-CE1 4.44Å; L25-Y46 HydrophobicContact CD2-CD1 4.11Å; L25-Y46 HydrophobicContact CD2-CE1 4.3Å; L25-Y46 HydrophobicContact CG-CE1 4.36Å
26	D	94.3	Very high	91.2	Very high	119 Å²	119	77.4 Å²	77.4	64%	0.636	37%	0.372	S	S	*	.	T	Hydrogen-bonded Turn	trans	62.4	6.5	-172	-154.8	39.2	0	0	0	115.1	R42 L43	D26-R42 VanDerWaalsContact O-CD 3.26Å; D26-R42 WeakPolarHBondContact O-CD 3.43Å; D26-R42 WeakPolarHBondContact O-CG 3.41Å; D26-R42 VanDerWaalsContact OD1-CD 3.23Å; D26-R42 WeakPolarHBondContact OD1-CD 3.45Å; D26-R42 IonicContact OD1-NE 3.82Å; D26-R42 PolarHBondContact OD1-NE 3.39Å; D26-L43 WeakPolarHBondContact CA-O 3.26Å; D26-L43 PolarHBondContact N-O 2.88Å
27	E	94.5	Very high	91.7	Very high	68 Å²	68	76.1 Å²	76.1	32%	0.318	36%	0.362	S	S	.	.	S	Bend	trans	-98.8	161.1	172.2	-56.3	-167	143	0	0	112.2	S24 L25 R42 L43 P98 R100	S24-E27 WeakPolarHBondContact O-CB 3.47Å; S24-E27 PolarHBondContact O-N 2.83Å; S24-E27 VanDerWaalsContact O-N 3.17Å; L25-E27 PolarHBondContact O-N 2.81Å; E27-R42 WeakPolarHBondContact O-CA 3.48Å; E27-L43 PolarHBondContact O-N 2.8Å; E27-P98 HydrophobicContact CB-CG 3.54Å; E27-P98 HydrophobicContact CG-CG 4.31Å; E27-P98 WeakPolarHBondContact OE2-CD 3.39Å; E27-P98 WeakPolarHBondContact OE2-CG 3.5Å; E27-R100 IonicContact OE2-NH2 3.93Å
28	R	94.8	Very high	92.3	Very high	153 Å²	153	73 Å²	73	58%	0.577	34%	0.338	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.8	116.1	174.4	-73.7	-174.4	103.7	-177.2	6.3	111	G41 P98	R28-G41 CarbonylContact C-O 3.56Å; R28-G41 WeakPolarHBondContact CA-O 3.31Å; R28-P98 WeakPolarHBondContact O-CA 3.43Å; R28-P98 WeakPolarHBondContact O-CB 3.22Å; R28-P98 VanDerWaalsContact O-CG 3.23Å; R28-P98 WeakPolarHBondContact O-CG 3.32Å
29	I	95.6	Very high	92.9	Very high	5 Å²	5	70.7 Å²	70.7	3%	0.026	33%	0.326	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.5	160.1	179.9	63.6	165.4	0	0	0	112	V31 R40 G41 L43 M52 L54 V95	I29-V31 HydrophobicContact CD1-CG2 3.61Å; I29-V31 HydrophobicContact CG1-CG2 4.07Å; I29-R40 WeakPolarHBondContact O-CA 3.37Å; I29-G41 PolarHBondContact N-O 2.84Å; I29-G41 PolarHBondContact O-N 2.88Å; I29-L43 HydrophobicContact CD1-CB 3.94Å; I29-L43 HydrophobicContact CD1-CD1 3.98Å; I29-L43 HydrophobicContact CD1-CD2 4.23Å; I29-L43 HydrophobicContact CD1-CG 4.25Å; I29-L43 HydrophobicContact CG1-CB 4.16Å; I29-L43 HydrophobicContact CG2-CB 4.31Å; I29-M52 HydrophobicContact CD1-SD 4.24Å; I29-L54 HydrophobicContact CD1-CD2 3.95Å; I29-L54 HydrophobicContact CG1-CD2 4.14Å; I29-V95 HydrophobicContact CD1-CG1 3.97Å
30	Y	96.4	Very high	93.5	Very high	52 Å²	52	75.1 Å²	75.1	20%	0.204	34%	0.339	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	131.3	166.9	168.7	-95.8	0	0	0	109.5	K32 E38 R40 L94 V95 A96	Y30-K32 HydrophobicContact CE1-CB 3.98Å; Y30-E38 HydrophobicContact CE2-CB 3.92Å; Y30-E38 HydrophobicContact CE2-CG 4.12Å; Y30-E38 PolarHBondContact OH-OE1 3.31Å; Y30-R40 HydrophobicContact CD2-CG 4Å; Y30-L94 HydrophobicContact CD1-CD2 3.98Å; Y30-L94 HydrophobicContact CE1-CD2 3.68Å; Y30-V95 WeakPolarHBondContact O-CA 3.05Å; Y30-A96 HydrophobicContact CD1-CB 4.13Å; Y30-A96 PolarHBondContact N-O 3.18Å; Y30-A96 PolarHBondContact O-N 3.05Å
31	V	96.9	Very high	94.2	Very high	0 Å²	0	70.4 Å²	70.4	0%	0	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.9	119.7	178.1	-173.4	0	0	0	0	108.7	I29 M33 E38 L39 M52 V92 L94 V95	I29-V31 HydrophobicContact CD1-CG2 3.61Å; I29-V31 HydrophobicContact CG1-CG2 4.07Å; V31-M33 HydrophobicContact CG1-CG 4.4Å; V31-M33 HydrophobicContact CG1-SD 3.98Å; V31-E38 CarbonylContact O-C 3.53Å; V31-E38 WeakPolarHBondContact O-CA 3.34Å; V31-L39 HydrophobicContact CB-CB 4.25Å; V31-L39 PolarHBondContact N-O 3.33Å; V31-L39 PolarHBondContact O-N 3.42Å; V31-M52 HydrophobicContact CG2-SD 4.14Å; V31-V92 HydrophobicContact CG1-CG1 3.95Å; V31-V92 HydrophobicContact CG1-CG2 4.22Å; V31-L94 CarbonylContact C-O 3.5Å; V31-L94 WeakPolarHBondContact CA-O 3.36Å; V31-V95 HydrophobicContact CG1-CG2 4.46Å
32	K	96.9	Very high	94.7	Very high	80 Å²	80	73 Å²	73	35%	0.348	32%	0.323	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.4	123.6	169.4	-173.2	159.7	-175.6	159.9	0	109.1	Y30 V93 L94	Y30-K32 HydrophobicContact CE1-CB 3.98Å; K32-V93 WeakPolarHBondContact O-CB 3.41Å; K32-V93 PolarHBondContact O-N 2.89Å; K32-L94 HydrophobicContact CB-CB 4.31Å; K32-L94 HydrophobicContact CB-CD2 3.97Å; K32-L94 PolarHBondContact N-O 2.91Å; K32-L94 PolarHBondContact O-N 2.9Å
33	M	97.4	Very high	95.1	Very high	31 Å²	31	67.2 Å²	67.2	15%	0.153	30%	0.301	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.9	165.9	179.1	-62.1	-71.5	-67.7	0	0	110	V31 R37 L39 V87 G91 V92	V31-M33 HydrophobicContact CG1-CG 4.4Å; V31-M33 HydrophobicContact CG1-SD 3.98Å; M33-R37 WeakPolarHBondContact CA-O 3.35Å; M33-R37 HydrophobicContact CB-CB 3.9Å; M33-R37 WeakPolarHBondContact CB-O 3.44Å; M33-R37 PolarHBondContact N-O 3.15Å; M33-L39 HydrophobicContact CG-CD1 4.15Å; M33-L39 HydrophobicContact CG-CG 4.28Å; M33-L39 HydrophobicContact SD-CD1 4.41Å; M33-V87 HydrophobicContact CE-CG1 3.71Å; M33-V87 HydrophobicContact SD-CG1 3.83Å; M33-G91 CarbonylContact C-O 3.6Å; M33-G91 VanDerWaalsContact CA-O 3.25Å; M33-G91 WeakPolarHBondContact CA-O 3.45Å; M33-V92 HydrophobicContact CE-CG2 4.49Å; M33-V92 HydrophobicContact SD-CB 4.33Å; M33-V92 HydrophobicContact SD-CG2 3.69Å
34	R	95.6	Very high	95.6	Very high	159 Å²	159	66.8 Å²	66.8	60%	0.6	30%	0.297	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.1	159.2	166.5	-62.5	-179.7	-171.8	-130.3	0.6	110.7	D90 G91 V93	R34-D90 PolarHBondContact NE-O 3.19Å; R34-D90 VanDerWaalsContact NE-O 3.1Å; R34-G91 PolarHBondContact N-O 2.85Å; R34-V93 HydrophobicContact CG-CG2 3.66Å
35	N	92.6	Very high	95.9	Very high	135 Å²	135	68.7 Å²	68.7	72%	0.722	31%	0.313	S	S	*	.	T	Hydrogen-bonded Turn	trans	64.9	41	176.8	-48.7	-34.4	0	0	0	114.2	R37	N35-R37 WeakPolarHBondContact O-CG 3.48Å; N35-R37 PolarHBondContact O-N 2.64Å; N35-R37 VanDerWaalsContact O-N 3.15Å
36	D	93.4	Very high	96.1	Very high	98 Å²	98	68.1 Å²	68.1	52%	0.524	31%	0.306	S	S	.	.	T	Hydrogen-bonded Turn	trans	53.8	38.9	174.9	-57.8	-59.9	0	0	0	113.7	T62	D36-T62 PolarHBondContact O-N 2.94Å
37	R	96.1	Very high	96.1	Very high	91 Å²	91	65.2 Å²	65.2	34%	0.343	29%	0.291	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109	141.6	175.9	-69.8	-172.6	-179.1	-121.7	-0.7	111	M33 N35 E59 T60 V61	M33-R37 WeakPolarHBondContact CA-O 3.35Å; M33-R37 HydrophobicContact CB-CB 3.9Å; M33-R37 WeakPolarHBondContact CB-O 3.44Å; M33-R37 PolarHBondContact N-O 3.15Å; N35-R37 WeakPolarHBondContact O-CG 3.48Å; N35-R37 PolarHBondContact O-N 2.64Å; N35-R37 VanDerWaalsContact O-N 3.15Å; R37-E59 IonicContact CZ-OE1 2.77Å; R37-E59 IonicContact NH1-OE1 3.31Å; R37-E59 PolarHBondContact NH1-OE1 2.83Å; R37-E59 IonicContact NH1-OE2 2.69Å; R37-T60 WeakPolarHBondContact CA-O 3.49Å; R37-V61 HydrophobicContact CG-CB 4.45Å; R37-V61 HydrophobicContact CG-CG1 4.1Å; R37-V61 HydrophobicContact CG-CG2 4.07Å
38	E	97.3	Very high	96.1	Very high	47 Å²	47	69.1 Å²	69.1	22%	0.22	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.8	138.7	-179.7	-55.7	-176.4	158.8	0	0	109.6	Y30 V31 E59 T60	Y30-E38 HydrophobicContact CE2-CB 3.92Å; Y30-E38 HydrophobicContact CE2-CG 4.12Å; Y30-E38 PolarHBondContact OH-OE1 3.31Å; V31-E38 CarbonylContact O-C 3.53Å; V31-E38 WeakPolarHBondContact O-CA 3.34Å; E38-E59 CarbonylContact O-C 3.52Å; E38-E59 WeakPolarHBondContact O-CA 3.25Å; E38-T60 PolarHBondContact N-O 2.82Å; E38-T60 PolarHBondContact O-N 3.18Å
39	L	97.6	Very high	96.1	Very high	5 Å²	5	67.1 Å²	67.1	3%	0.026	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.9	137.5	176.3	-55.4	174.1	0	0	0	109.3	V31 M33 L54 V57 E58 E59 L85 V87	V31-L39 HydrophobicContact CB-CB 4.25Å; V31-L39 PolarHBondContact N-O 3.33Å; V31-L39 PolarHBondContact O-N 3.42Å; M33-L39 HydrophobicContact CG-CD1 4.15Å; M33-L39 HydrophobicContact CG-CG 4.28Å; M33-L39 HydrophobicContact SD-CD1 4.41Å; L39-L54 HydrophobicContact CB-CD1 4.28Å; L39-L54 HydrophobicContact CD1-CD1 4.1Å; L39-V57 HydrophobicContact CB-CG1 4.27Å; L39-V57 HydrophobicContact CD2-CG1 4.03Å; L39-E58 WeakPolarHBondContact CA-O 3.46Å; L39-E59 HydrophobicContact CD2-CB 3.53Å; L39-E59 HydrophobicContact CD2-CG 3.68Å; L39-L85 HydrophobicContact CD1-CD2 4.14Å; L39-L85 HydrophobicContact CD2-CD2 4.16Å; L39-V87 HydrophobicContact CD1-CG1 4.27Å; L39-V87 HydrophobicContact CD1-CG2 3.62Å
40	R	96.9	Very high	96.1	Very high	131 Å²	131	69.3 Å²	69.3	49%	0.494	32%	0.318	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.7	119	168	-67	179.7	-178.8	-175.5	-1.2	108.4	I29 Y30 V57 E58	I29-R40 WeakPolarHBondContact O-CA 3.37Å; Y30-R40 HydrophobicContact CD2-CG 4Å; R40-V57 CarbonylContact O-C 3.6Å; R40-V57 WeakPolarHBondContact O-CA 3.49Å; R40-E58 PolarHBondContact N-O 2.87Å; R40-E58 PolarHBondContact O-N 3.17Å
41	G	96.9	Very high	96.1	Very high	0 Å²	0	68.1 Å²	68.1	0%	0	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-165.1	167.7	-174.1	0	0	0	0	0	112.2	R28 I29 G55	R28-G41 CarbonylContact C-O 3.56Å; R28-G41 WeakPolarHBondContact CA-O 3.31Å; I29-G41 PolarHBondContact N-O 2.84Å; I29-G41 PolarHBondContact O-N 2.88Å; G41-G55 CarbonylContact C-O 3.58Å; G41-G55 WeakPolarHBondContact CA-O 3.42Å
42	R	96.9	Very high	96.1	Very high	78 Å²	78	68.3 Å²	68.3	29%	0.294	32%	0.316	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.8	125.3	175.4	-171.8	164.2	69.9	-104.8	-6.1	109.9	D26 E27 H44 L54 G55 D56	D26-R42 VanDerWaalsContact O-CD 3.26Å; D26-R42 WeakPolarHBondContact O-CD 3.43Å; D26-R42 WeakPolarHBondContact O-CG 3.41Å; D26-R42 VanDerWaalsContact OD1-CD 3.23Å; D26-R42 WeakPolarHBondContact OD1-CD 3.45Å; D26-R42 IonicContact OD1-NE 3.82Å; D26-R42 PolarHBondContact OD1-NE 3.39Å; E27-R42 WeakPolarHBondContact O-CA 3.48Å; R42-H44 PolarHBondContact NE-NE2 3.27Å; R42-H44 PolarHBondContact NH2-NE2 2.85Å; R42-H44 PolarHBondContact O-CD2 2.84Å; R42-H44 PolarHBondContact O-N 3.49Å; R42-L54 CarbonylContact O-C 3.6Å; R42-L54 VanDerWaalsContact O-CA 3.31Å; R42-L54 WeakPolarHBondContact O-CA 3.42Å; R42-G55 PolarHBondContact N-O 2.79Å; R42-G55 PolarHBondContact O-N 2.94Å; R42-D56 IonicContact CZ-OD2 3.16Å; R42-D56 IonicContact NH1-OD2 2.73Å; R42-D56 PolarHBondContact NH1-OD2 3.19Å; R42-D56 IonicContact NH2-OD2 3.6Å; R42-D56 PolarHBondContact NH2-OD2 2.79Å
43	L	97.2	Very high	96.2	Very high	1 Å²	1	67.1 Å²	67.1	1%	0.005	31%	0.313	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.9	112.3	-179.8	-177.2	66.1	0	0	0	111.1	I21 L25 D26 E27 I29 A45 Y46 M52 L54	I21-L43 HydrophobicContact CG2-CD2 3.91Å; L25-L43 HydrophobicContact CD2-CD2 4.22Å; L25-L43 HydrophobicContact CD2-CG 4.18Å; D26-L43 WeakPolarHBondContact CA-O 3.26Å; D26-L43 PolarHBondContact N-O 2.88Å; E27-L43 PolarHBondContact O-N 2.8Å; I29-L43 HydrophobicContact CD1-CB 3.94Å; I29-L43 HydrophobicContact CD1-CD1 3.98Å; I29-L43 HydrophobicContact CD1-CD2 4.23Å; I29-L43 HydrophobicContact CD1-CG 4.25Å; I29-L43 HydrophobicContact CG1-CB 4.16Å; I29-L43 HydrophobicContact CG2-CB 4.31Å; L43-A45 WeakPolarHBondContact CD1-O 3.49Å; L43-Y46 HydrophobicContact CD2-CD1 4.28Å; L43-M52 HydrophobicContact CD1-CB 4.11Å; L43-M52 HydrophobicContact CD1-CG 4.09Å; L43-M52 HydrophobicContact CD1-SD 4.23Å; L43-L54 HydrophobicContact CB-CD2 4.29Å; L43-L54 HydrophobicContact CD1-CD2 3.81Å
44	H	97.1	Very high	96.2	Very high	74 Å²	74	65.7 Å²	65.7	34%	0.343	31%	0.305	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94	-38.8	179	-71.1	-159.6	0	0	0	112.1	R42 I53	R42-H44 PolarHBondContact NE-NE2 3.27Å; R42-H44 PolarHBondContact NH2-NE2 2.85Å; R42-H44 PolarHBondContact O-CD2 2.84Å; R42-H44 PolarHBondContact O-N 3.49Å; H44-I53 HydrophobicContact CB-CB 4.28Å; H44-I53 HydrophobicContact CB-CG2 4.03Å; H44-I53 PolarHBondContact N-O 2.92Å
45	A	96.8	Very high	96.3	Very high	45 Å²	45	58.1 Å²	58.1	37%	0.372	28%	0.277	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-156.7	155.9	-179.6	0	0	0	0	0	111	L43 M52 I53	L43-A45 WeakPolarHBondContact CD1-O 3.49Å; A45-M52 WeakPolarHBondContact O-CA 3.34Å; A45-I53 HydrophobicContact CB-CB 4.22Å; A45-I53 HydrophobicContact CB-CG1 4.23Å; A45-I53 PolarHBondContact N-O 2.73Å; A45-I53 PolarHBondContact O-N 3.1Å
46	Y	96.4	Very high	96.6	Very high	58 Å²	58	55.7 Å²	55.7	23%	0.227	26%	0.264	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.8	168.7	170	73.4	-74.5	0	0	0	111.4	L18 I21 R22 L25 L43 N51	L18-Y46 HydrophobicContact CB-CE2 4.48Å; L18-Y46 HydrophobicContact CD2-CE2 4.44Å; L18-Y46 PolarHBondContact O-OH 2.83Å; L18-Y46 VanDerWaalsContact O-OH 3.1Å; I21-Y46 HydrophobicContact CG2-CD1 3.65Å; I21-Y46 HydrophobicContact CG2-CD2 3.72Å; I21-Y46 HydrophobicContact CG2-CE1 3.64Å; I21-Y46 HydrophobicContact CG2-CE2 3.68Å; I21-Y46 HydrophobicContact CG2-CG 3.71Å; R22-Y46 WeakPolarHBondContact CA-OH 3.25Å; R22-Y46 HydrophobicContact CB-CE1 4.43Å; R22-Y46 WeakPolarHBondContact CB-OH 3.4Å; R22-Y46 PolarHBondContact N-OH 2.86Å; L25-Y46 HydrophobicContact CD1-CE1 4.44Å; L25-Y46 HydrophobicContact CD2-CD1 4.11Å; L25-Y46 HydrophobicContact CD2-CE1 4.3Å; L25-Y46 HydrophobicContact CG-CE1 4.36Å; L43-Y46 HydrophobicContact CD2-CD1 4.28Å; Y46-N51 CarbonylContact C-O 3.58Å; Y46-N51 WeakPolarHBondContact CA-O 3.23Å; Y46-N51 WeakPolarHBondContact CB-O 3.26Å
47	D	95	Very high	96.8	Very high	58 Å²	58	51 Å²	51	31%	0.31	24%	0.239	S	C	.	.			trans	-129.3	-179.5	172.1	70.4	13.7	0	0	0	112.5	H49 L50 N51	D47-H49 PolarHBondContact O-N 3.44Å; D47-H49 VanDerWaalsContact O-N 3.15Å; D47-H49 WeakPolarHBondContact OD1-CA 3.33Å; D47-H49 WeakPolarHBondContact OD1-CB 3.33Å; D47-H49 PolarHBondContact OD1-N 3.39Å; D47-L50 PolarHBondContact O-N 2.88Å; D47-L50 PolarHBondContact OD1-N 3.22Å; D47-N51 PolarHBondContact N-O 2.88Å; D47-N51 WeakPolarHBondContact OD1-CB 3.43Å; D47-N51 PolarHBondContact OD1-N 2.88Å; D47-N51 PolarHBondContact OD1-ND2 2.94Å; D47-N51 PolarHBondContact OD2-ND2 2.8Å
48	Q	93.4	Very high	96.9	Very high	151 Å²	151	48.8 Å²	48.8	71%	0.706	23%	0.233	S	C	*	.	T	Hydrogen-bonded Turn	trans	-60.2	-19.7	178	70.8	-147.9	3	0	0	114.7	L50	Q48-L50 VanDerWaalsContact C-N 3.32Å
49	H	95.3	Very high	96.9	Very high	111 Å²	111	47.5 Å²	47.5	51%	0.514	23%	0.227	S	C	.	.	T	Hydrogen-bonded Turn	trans	-91	-0.7	177.5	-59.3	-63.9	0	0	0	111.8	D47 N51 G89	D47-H49 PolarHBondContact O-N 3.44Å; D47-H49 VanDerWaalsContact O-N 3.15Å; D47-H49 WeakPolarHBondContact OD1-CA 3.33Å; D47-H49 WeakPolarHBondContact OD1-CB 3.33Å; D47-H49 PolarHBondContact OD1-N 3.39Å; H49-N51 PolarHBondContact O-N 2.83Å; H49-G89 VanDerWaalsContact O-CA 3.28Å; H49-G89 WeakPolarHBondContact O-CA 3.43Å
50	L	95.4	Very high	96.9	Very high	51 Å²	51	48 Å²	48	27%	0.267	23%	0.23	S	C	.	.			trans	62.9	26.8	-170.6	-62	158.4	0	0	0	112.7	L18 I21 D47 Q48 M52 G89	L18-L50 HydrophobicContact CD2-CD2 3.92Å; I21-L50 HydrophobicContact CD1-CD2 3.71Å; D47-L50 PolarHBondContact O-N 2.88Å; D47-L50 PolarHBondContact OD1-N 3.22Å; Q48-L50 VanDerWaalsContact C-N 3.32Å; L50-M52 HydrophobicContact CB-CE 4.02Å; L50-M52 HydrophobicContact CD2-CE 4.01Å; L50-G89 VanDerWaalsContact C-CA 3.47Å; L50-G89 WeakPolarHBondContact O-CA 3.31Å
51	N	97.3	Very high	96.8	Very high	27 Å²	27	42.7 Å²	42.7	14%	0.144	21%	0.212	C	C	.	.			trans	-65.9	140.8	159.7	-58.8	-49.9	0	0	0	108	Y46 D47 H49 F86 V87 R88 G89	Y46-N51 CarbonylContact C-O 3.58Å; Y46-N51 WeakPolarHBondContact CA-O 3.23Å; Y46-N51 WeakPolarHBondContact CB-O 3.26Å; D47-N51 PolarHBondContact N-O 2.88Å; D47-N51 WeakPolarHBondContact OD1-CB 3.43Å; D47-N51 PolarHBondContact OD1-N 2.88Å; D47-N51 PolarHBondContact OD1-ND2 2.94Å; D47-N51 PolarHBondContact OD2-ND2 2.8Å; H49-N51 PolarHBondContact O-N 2.83Å; N51-F86 HydrophobicContact CB-CE2 4.05Å; N51-F86 HydrophobicContact CB-CZ 4.24Å; N51-V87 CarbonylContact C-O 3.53Å; N51-V87 VanDerWaalsContact CA-O 3.26Å; N51-V87 WeakPolarHBondContact CA-O 3.46Å; N51-R88 WeakPolarHBondContact OD1-CA 3.41Å; N51-G89 PolarHBondContact OD1-N 3.03Å
52	M	97.4	Very high	96.6	Very high	3 Å²	3	44.8 Å²	44.8	2%	0.015	23%	0.225	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-135.6	148.8	-174.5	-59.6	174.1	-158.5	0	0	112.2	I29 V31 L43 A45 L50 L54 F86 V87 V92 V95	I29-M52 HydrophobicContact CD1-SD 4.24Å; V31-M52 HydrophobicContact CG2-SD 4.14Å; L43-M52 HydrophobicContact CD1-CB 4.11Å; L43-M52 HydrophobicContact CD1-CG 4.09Å; L43-M52 HydrophobicContact CD1-SD 4.23Å; A45-M52 WeakPolarHBondContact O-CA 3.34Å; L50-M52 HydrophobicContact CB-CE 4.02Å; L50-M52 HydrophobicContact CD2-CE 4.01Å; M52-L54 HydrophobicContact CB-CD2 4.48Å; M52-L54 HydrophobicContact CB-CG 4.33Å; M52-F86 WeakPolarHBondContact O-CA 3.38Å; M52-V87 HydrophobicContact CB-CB 4.33Å; M52-V87 PolarHBondContact N-O 2.89Å; M52-V87 PolarHBondContact O-N 3.14Å; M52-V92 HydrophobicContact CE-CG1 4.14Å; M52-V92 HydrophobicContact CE-CG2 4.09Å; M52-V95 HydrophobicContact CE-CG2 3.5Å; M52-V95 VanDerWaalsContact CE-CG2 3.5Å
53	I	98.1	Very high	96.4	Very high	56 Å²	56	44.1 Å²	44.1	29%	0.287	23%	0.23	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-107.1	117.6	162.6	-57.7	-67.8	0	0	0	107.3	H44 A45 M84 F86	H44-I53 HydrophobicContact CB-CB 4.28Å; H44-I53 HydrophobicContact CB-CG2 4.03Å; H44-I53 PolarHBondContact N-O 2.92Å; A45-I53 HydrophobicContact CB-CB 4.22Å; A45-I53 HydrophobicContact CB-CG1 4.23Å; A45-I53 PolarHBondContact N-O 2.73Å; A45-I53 PolarHBondContact O-N 3.1Å; I53-M84 HydrophobicContact CG2-CE 3.35Å; I53-F86 HydrophobicContact CD1-CB 4.01Å; I53-F86 HydrophobicContact CD1-CD2 3.68Å; I53-F86 HydrophobicContact CD1-CG 4.34Å
54	L	98.1	Very high	96.1	Very high	0 Å²	0	47.5 Å²	47.5	0%	0	25%	0.25	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.7	133.9	178.7	-60.7	176.2	0	0	0	110.3	I29 L39 R42 L43 M52 V57 M84 L85 V87	I29-L54 HydrophobicContact CD1-CD2 3.95Å; I29-L54 HydrophobicContact CG1-CD2 4.14Å; L39-L54 HydrophobicContact CB-CD1 4.28Å; L39-L54 HydrophobicContact CD1-CD1 4.1Å; R42-L54 CarbonylContact O-C 3.6Å; R42-L54 VanDerWaalsContact O-CA 3.31Å; R42-L54 WeakPolarHBondContact O-CA 3.42Å; L43-L54 HydrophobicContact CB-CD2 4.29Å; L43-L54 HydrophobicContact CD1-CD2 3.81Å; M52-L54 HydrophobicContact CB-CD2 4.48Å; M52-L54 HydrophobicContact CB-CG 4.33Å; L54-V57 HydrophobicContact CB-CG2 3.38Å; L54-V57 WeakPolarHBondContact O-CG2 3.26Å; L54-M84 CarbonylContact O-C 3.57Å; L54-M84 WeakPolarHBondContact O-CA 3.4Å; L54-L85 PolarHBondContact N-O 3.49Å; L54-L85 PolarHBondContact O-N 2.76Å; L54-V87 HydrophobicContact CD1-CG2 3.94Å; L54-V87 HydrophobicContact CG-CG2 4.44Å
55	G	98.1	Very high	95.6	Very high	1 Å²	1	48 Å²	48	1%	0.01	25%	0.252	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104	156.7	170.8	0	0	0	0	0	112.4	G41 R42 V57 P83 M84	G41-G55 CarbonylContact C-O 3.58Å; G41-G55 WeakPolarHBondContact CA-O 3.42Å; R42-G55 PolarHBondContact N-O 2.79Å; R42-G55 PolarHBondContact O-N 2.94Å; G55-V57 VanDerWaalsContact C-N 3.29Å; G55-V57 PolarHBondContact O-N 2.95Å; G55-P83 CarbonylContact C-O 3.56Å; G55-P83 WeakPolarHBondContact CA-O 3.37Å; G55-M84 VanDerWaalsContact CA-SD 3.54Å
56	D	97.6	Very high	95.3	Very high	83 Å²	83	50.7 Å²	50.7	44%	0.444	26%	0.26	S	S	.	.	E	Extended strand (participates in β ladder)	trans	49.5	49.5	176.8	-57.5	-46.2	0	0	0	112.7	R42 P83	R42-D56 IonicContact CZ-OD2 3.16Å; R42-D56 IonicContact NH1-OD2 2.73Å; R42-D56 PolarHBondContact NH1-OD2 3.19Å; R42-D56 IonicContact NH2-OD2 3.6Å; R42-D56 PolarHBondContact NH2-OD2 2.79Å; D56-P83 PolarHBondContact N-O 3.38Å
57	V	98	Very high	94.8	Very high	0 Å²	0	50.9 Å²	50.9	0%	0	27%	0.265	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.5	134.8	-168.9	-173.1	0	0	0	0	110.9	L39 R40 L54 G55 N81 I82 L85	L39-V57 HydrophobicContact CB-CG1 4.27Å; L39-V57 HydrophobicContact CD2-CG1 4.03Å; R40-V57 CarbonylContact O-C 3.6Å; R40-V57 WeakPolarHBondContact O-CA 3.49Å; L54-V57 HydrophobicContact CB-CG2 3.38Å; L54-V57 WeakPolarHBondContact O-CG2 3.26Å; G55-V57 VanDerWaalsContact C-N 3.29Å; G55-V57 PolarHBondContact O-N 2.95Å; V57-N81 CarbonylContact O-C 3.58Å; V57-N81 VanDerWaalsContact O-CA 3.22Å; V57-N81 WeakPolarHBondContact O-CA 3.4Å; V57-I82 HydrophobicContact CB-CB 4.41Å; V57-I82 PolarHBondContact N-O 3.41Å; V57-I82 PolarHBondContact O-N 3.2Å; V57-L85 HydrophobicContact CG1-CD2 4.1Å; V57-L85 HydrophobicContact CG2-CB 4Å
58	E	97.9	Very high	94.5	Very high	44 Å²	44	56.5 Å²	56.5	21%	0.206	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.1	114.5	161.2	-177	177.9	124.5	0	0	108.4	L39 R40 K79 R80	L39-E58 WeakPolarHBondContact CA-O 3.46Å; R40-E58 PolarHBondContact N-O 2.87Å; R40-E58 PolarHBondContact O-N 3.17Å; E58-K79 WeakPolarHBondContact OE1-CE 3.49Å; E58-K79 IonicContact OE1-NZ 3.9Å; E58-K79 PolarHBondContact OE1-NZ 3.04Å; E58-R80 WeakPolarHBondContact CA-O 3.49Å
59	E	97.3	Very high	94.3	Very high	20 Å²	20	57.8 Å²	57.8	9%	0.093	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.9	131.6	169.7	177.1	-175.8	-132.6	0	0	109.1	R37 E38 L39 V61 K79 R80	R37-E59 IonicContact CZ-OE1 2.77Å; R37-E59 IonicContact NH1-OE1 3.31Å; R37-E59 PolarHBondContact NH1-OE1 2.83Å; R37-E59 IonicContact NH1-OE2 2.69Å; E38-E59 CarbonylContact O-C 3.52Å; E38-E59 WeakPolarHBondContact O-CA 3.25Å; L39-E59 HydrophobicContact CD2-CB 3.53Å; L39-E59 HydrophobicContact CD2-CG 3.68Å; E59-V61 HydrophobicContact CG-CG2 3.98Å; E59-K79 CarbonylContact O-C 3.58Å; E59-K79 VanDerWaalsContact O-CA 3.26Å; E59-K79 WeakPolarHBondContact O-CA 3.12Å; E59-R80 HydrophobicContact CB-CG 3.78Å; E59-R80 HydrophobicContact CG-CG 4.43Å; E59-R80 PolarHBondContact N-O 3.22Å; E59-R80 PolarHBondContact O-N 3.03Å; E59-R80 WeakPolarHBondContact OE2-CD 3.19Å; E59-R80 IonicContact OE2-CZ 3.53Å; E59-R80 IonicContact OE2-NE 3.19Å; E59-R80 PolarHBondContact OE2-NE 3.15Å; E59-R80 IonicContact OE2-NH1 3.65Å
60	T	96.9	Very high	94.1	Very high	16 Å²	16	56.2 Å²	56.2	10%	0.098	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.3	126.3	168.4	-57.4	0	0	0	0	108.8	R37 E38 T78 K79	R37-T60 WeakPolarHBondContact CA-O 3.49Å; E38-T60 PolarHBondContact N-O 2.82Å; E38-T60 PolarHBondContact O-N 3.18Å; T60-T78 WeakPolarHBondContact CA-O 3.48Å; T60-K79 HydrophobicContact CG2-CG 4.3Å
61	V	95.9	Very high	93.8	Very high	19 Å²	19	62.6 Å²	62.6	12%	0.115	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.2	121.3	174.2	-173.1	0	0	0	0	108	R37 E59 T63 S77 T78	R37-V61 HydrophobicContact CG-CB 4.45Å; R37-V61 HydrophobicContact CG-CG1 4.1Å; R37-V61 HydrophobicContact CG-CG2 4.07Å; E59-V61 HydrophobicContact CG-CG2 3.98Å; V61-T63 HydrophobicContact CG1-CG2 4.47Å; V61-S77 WeakPolarHBondContact O-CA 3.46Å; V61-T78 PolarHBondContact N-O 3.45Å; V61-T78 PolarHBondContact O-N 3.1Å
62	T	93.4	Very high	93.5	Very high	45 Å²	45	67.6 Å²	67.6	28%	0.276	34%	0.338	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101	129.8	176.5	-57.5	0	0	0	0	109.5	D36 Y75 K76	D36-T62 PolarHBondContact O-N 2.94Å; T62-Y75 HydrophobicContact CG2-CD1 4.39Å; T62-K76 CarbonylContact C-O 3.5Å; T62-K76 WeakPolarHBondContact CA-O 3.48Å
63	T	91.8	Very high	93.1	Very high	64 Å²	64	72.7 Å²	72.7	39%	0.393	36%	0.362	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.7	136.4	176.5	54.4	0	0	0	0	109.4	V61 K76	V61-T63 HydrophobicContact CG1-CG2 4.47Å; T63-K76 PolarHBondContact N-O 3.37Å; T63-K76 PolarHBondContact O-N 3.45Å
64	V	90.6	Very high	92.7	Very high	71 Å²	71	74.2 Å²	74.2	43%	0.43	37%	0.37	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.9	117.2	173.1	-174.4	0	0	0	0	107.7	I66 E73 Y75	V64-I66 HydrophobicContact CG1-CG1 4.44Å; V64-E73 HydrophobicContact CG1-CB 4.02Å; V64-E73 HydrophobicContact CG1-CG 4.1Å; V64-Y75 HydrophobicContact CG2-CD1 3.91Å; V64-Y75 HydrophobicContact CG2-CE1 3.7Å
65	E	87.5	Confident	92.3	Very high	84 Å²	84	81.5 Å²	81.5	39%	0.393	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.9	134	167.5	-68.9	-179.7	-163.3	0	0	108	L74 K76	E65-L74 HydrophobicContact CB-CB 4.4Å; E65-L74 PolarHBondContact N-O 3.5Å; E65-L74 PolarHBondContact O-N 2.91Å; E65-K76 WeakPolarHBondContact OE1-CD 3.23Å; E65-K76 WeakPolarHBondContact OE1-CE 3.19Å; E65-K76 IonicContact OE1-NZ 2.86Å; E65-K76 PolarHBondContact OE1-NZ 3.09Å; E65-K76 VanDerWaalsContact OE2-CE 3.22Å; E65-K76 WeakPolarHBondContact OE2-CE 3.34Å; E65-K76 IonicContact OE2-NZ 2.62Å; E65-K76 PolarHBondContact OE2-NZ 3.16Å
66	I	89.1	Confident	92.1	Very high	103 Å²	103	86.2 Å²	86.2	53%	0.528	42%	0.418	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.4	125.4	176.7	-57.9	174.6	0	0	0	107	V64 E68 E73	V64-I66 HydrophobicContact CG1-CG1 4.44Å; I66-E68 PolarHBondContact O-N 3.17Å; I66-E73 HydrophobicContact CG1-CG 4.48Å
67	D	86.7	Confident	91.8	Very high	61 Å²	61	86.1 Å²	86.1	33%	0.326	43%	0.425	S	S	.	.			trans	-68.9	124.2	172.9	-176.5	-81.9	0	0	0	109.8	E69 T70 Y71 E72	D67-E69 VanDerWaalsContact C-N 3.25Å; D67-E69 PolarHBondContact O-N 3.42Å; D67-E69 PolarHBondContact OD1-N 2.97Å; D67-T70 VanDerWaalsContact CB-OG1 3.25Å; D67-T70 WeakPolarHBondContact CB-OG1 3.47Å; D67-T70 WeakPolarHBondContact OD1-CB 3.28Å; D67-T70 PolarHBondContact OD1-N 2.89Å; D67-T70 PolarHBondContact OD1-OG1 3.2Å; D67-Y71 WeakPolarHBondContact O-CA 3.38Å; D67-Y71 PolarHBondContact O-N 2.9Å; D67-E72 PolarHBondContact N-O 3.26Å
68	E	88.8	Confident	91.7	Very high	177 Å²	177	90.2 Å²	90.2	83%	0.827	45%	0.45	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.9	-21.3	-171.9	-63.6	-176	172.6	0	0	113.4	I66	I66-E68 PolarHBondContact O-N 3.17Å
69	E	90.1	Very high	91.6	Very high	177 Å²	177	93.8 Å²	93.8	83%	0.827	46%	0.464	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95.3	-41.7	-177.7	-63.7	-171.7	170.6	0	0	111.8	D67	D67-E69 VanDerWaalsContact C-N 3.25Å; D67-E69 PolarHBondContact O-N 3.42Å; D67-E69 PolarHBondContact OD1-N 2.97Å
70	T	90.9	Very high	91.5	Very high	78 Å²	78	98.9 Å²	98.9	48%	0.479	48%	0.483	S	S	.	.	T	Hydrogen-bonded Turn	trans	-99.7	-13.9	-173.8	60.9	0	0	0	0	113.4	D67 E72	D67-T70 VanDerWaalsContact CB-OG1 3.25Å; D67-T70 WeakPolarHBondContact CB-OG1 3.47Å; D67-T70 WeakPolarHBondContact OD1-CB 3.28Å; D67-T70 PolarHBondContact OD1-N 2.89Å; D67-T70 PolarHBondContact OD1-OG1 3.2Å; T70-E72 PolarHBondContact O-N 3.28Å
71	Y	87.9	Confident	91.6	Very high	186 Å²	186	103.9 Å²	103.9	73%	0.729	51%	0.509	S	S	*	.			trans	57.5	19.9	-173	-59.2	-88.1	0	0	0	113.8	D67	D67-Y71 WeakPolarHBondContact O-CA 3.38Å; D67-Y71 PolarHBondContact O-N 2.9Å
72	E	91.2	Very high	91.7	Very high	131 Å²	131	105 Å²	105	61%	0.612	51%	0.514	S	S	*	.			trans	-77.1	138.7	176.4	-69.2	-172.3	170.4	0	0	111.1	D67 T70	D67-E72 PolarHBondContact N-O 3.26Å; T70-E72 PolarHBondContact O-N 3.28Å
73	E	90.1	Very high	91.9	Very high	111 Å²	111	107.6 Å²	107.6	52%	0.519	53%	0.531	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.6	115.8	176.8	-67.9	-176.2	171.1	0	0	111.1	V64 I66 Y75	V64-E73 HydrophobicContact CG1-CB 4.02Å; V64-E73 HydrophobicContact CG1-CG 4.1Å; I66-E73 HydrophobicContact CG1-CG 4.48Å; E73-Y75 HydrophobicContact CB-CE2 3.87Å; E73-Y75 PolarHBondContact OE2-OH 3.34Å
74	L	89.1	Confident	92.1	Very high	88 Å²	88	109.2 Å²	109.2	46%	0.461	54%	0.536	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.9	112.8	174.9	-71.5	164.5	0	0	0	110.3	E65	E65-L74 HydrophobicContact CB-CB 4.4Å; E65-L74 PolarHBondContact N-O 3.5Å; E65-L74 PolarHBondContact O-N 2.91Å
75	Y	90.2	Very high	92.5	Very high	152 Å²	152	108 Å²	108	60%	0.596	53%	0.527	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86.6	111.7	177.3	-65.6	-96.4	0	0	0	110.1	T62 V64 E73	T62-Y75 HydrophobicContact CG2-CD1 4.39Å; V64-Y75 HydrophobicContact CG2-CD1 3.91Å; V64-Y75 HydrophobicContact CG2-CE1 3.7Å; E73-Y75 HydrophobicContact CB-CE2 3.87Å; E73-Y75 PolarHBondContact OE2-OH 3.34Å
76	K	92.4	Very high	93	Very high	100 Å²	100	110.3 Å²	110.3	44%	0.435	54%	0.536	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.6	138.2	172.2	-68.5	-174.9	-172.3	165.6	0	110.2	T62 T63 E65	T62-K76 CarbonylContact C-O 3.5Å; T62-K76 WeakPolarHBondContact CA-O 3.48Å; T63-K76 PolarHBondContact N-O 3.37Å; T63-K76 PolarHBondContact O-N 3.45Å; E65-K76 WeakPolarHBondContact OE1-CD 3.23Å; E65-K76 WeakPolarHBondContact OE1-CE 3.19Å; E65-K76 IonicContact OE1-NZ 2.86Å; E65-K76 PolarHBondContact OE1-NZ 3.09Å; E65-K76 VanDerWaalsContact OE2-CE 3.22Å; E65-K76 WeakPolarHBondContact OE2-CE 3.34Å; E65-K76 IonicContact OE2-NZ 2.62Å; E65-K76 PolarHBondContact OE2-NZ 3.16Å
77	S	93	Very high	93.4	Very high	82 Å²	82	105.9 Å²	105.9	57%	0.573	51%	0.513	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-119	130.2	173.2	63.1	0	0	0	0	110.3	V61	V61-S77 WeakPolarHBondContact O-CA 3.46Å
78	T	94.9	Very high	93.9	Very high	86 Å²	86	110.3 Å²	110.3	53%	0.528	53%	0.525	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.6	134.6	172.9	-59	0	0	0	0	109	T60 V61	T60-T78 WeakPolarHBondContact CA-O 3.48Å; V61-T78 PolarHBondContact N-O 3.45Å; V61-T78 PolarHBondContact O-N 3.1Å
79	K	96	Very high	94.3	Very high	118 Å²	118	102.2 Å²	102.2	51%	0.513	49%	0.489	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.8	144.8	178.9	-65.2	-170.3	170.6	-158.2	0	111.9	E58 E59 T60	E58-K79 WeakPolarHBondContact OE1-CE 3.49Å; E58-K79 IonicContact OE1-NZ 3.9Å; E58-K79 PolarHBondContact OE1-NZ 3.04Å; E59-K79 CarbonylContact O-C 3.58Å; E59-K79 VanDerWaalsContact O-CA 3.26Å; E59-K79 WeakPolarHBondContact O-CA 3.12Å; T60-K79 HydrophobicContact CG2-CG 4.3Å
80	R	96.1	Very high	94.7	Very high	128 Å²	128	98.2 Å²	98.2	48%	0.483	47%	0.474	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.8	148.5	170.2	64.7	-179.8	75.4	172.5	-4.6	111.1	E58 E59 I82	E58-R80 WeakPolarHBondContact CA-O 3.49Å; E59-R80 HydrophobicContact CB-CG 3.78Å; E59-R80 HydrophobicContact CG-CG 4.43Å; E59-R80 PolarHBondContact N-O 3.22Å; E59-R80 PolarHBondContact O-N 3.03Å; E59-R80 WeakPolarHBondContact OE2-CD 3.19Å; E59-R80 IonicContact OE2-CZ 3.53Å; E59-R80 IonicContact OE2-NE 3.19Å; E59-R80 PolarHBondContact OE2-NE 3.15Å; E59-R80 IonicContact OE2-NH1 3.65Å; R80-I82 HydrophobicContact CG-CD1 4.39Å
81	N	97.3	Very high	94.9	Very high	120 Å²	120	95.3 Å²	95.3	64%	0.642	46%	0.459	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.3	135.1	177.4	-63.3	81.2	0	0	0	110.2	V57	V57-N81 CarbonylContact O-C 3.58Å; V57-N81 VanDerWaalsContact O-CA 3.22Å; V57-N81 WeakPolarHBondContact O-CA 3.4Å
82	I	97.8	Very high	95.3	Very high	43 Å²	43	87.4 Å²	87.4	22%	0.221	43%	0.43	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	122.2	-175.5	-55.3	170.5	0	0	0	107.8	V57 R80 M84 L85	V57-I82 HydrophobicContact CB-CB 4.41Å; V57-I82 PolarHBondContact N-O 3.41Å; V57-I82 PolarHBondContact O-N 3.2Å; R80-I82 HydrophobicContact CG-CD1 4.39Å; I82-M84 VanDerWaalsContact CG2-O 3.31Å; I82-M84 WeakPolarHBondContact CG2-O 3.44Å; I82-M84 PolarHBondContact O-N 2.97Å; I82-L85 HydrophobicContact CD1-CD1 4.26Å; I82-L85 HydrophobicContact CD1-CD2 4.31Å; I82-L85 HydrophobicContact CG2-CB 4.21Å
83	P	97.7	Very high	95.6	Very high	99 Å²	99	85.7 Å²	85.7	64%	0.643	43%	0.428	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-60.4	-41.9	-177.5	-26.2	34.7	0	0	0	113.6	G55 D56	G55-P83 CarbonylContact C-O 3.56Å; G55-P83 WeakPolarHBondContact CA-O 3.37Å; D56-P83 PolarHBondContact N-O 3.38Å
84	M	97.7	Very high	95.8	Very high	99 Å²	99	84.5 Å²	84.5	49%	0.488	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-144.9	133.4	178.3	-75.8	-64.5	-70.6	0	0	109.8	I53 L54 G55 I82	I53-M84 HydrophobicContact CG2-CE 3.35Å; L54-M84 CarbonylContact O-C 3.57Å; L54-M84 WeakPolarHBondContact O-CA 3.4Å; G55-M84 VanDerWaalsContact CA-SD 3.54Å; I82-M84 VanDerWaalsContact CG2-O 3.31Å; I82-M84 WeakPolarHBondContact CG2-O 3.44Å; I82-M84 PolarHBondContact O-N 2.97Å
85	L	97.8	Very high	96.1	Very high	45 Å²	45	82 Å²	82	24%	0.236	41%	0.414	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.6	128.6	-176.6	-177.1	65.2	0	0	0	110.6	L39 L54 V57 I82 V87	L39-L85 HydrophobicContact CD1-CD2 4.14Å; L39-L85 HydrophobicContact CD2-CD2 4.16Å; L54-L85 PolarHBondContact N-O 3.49Å; L54-L85 PolarHBondContact O-N 2.76Å; V57-L85 HydrophobicContact CG1-CD2 4.1Å; V57-L85 HydrophobicContact CG2-CB 4Å; I82-L85 HydrophobicContact CD1-CD1 4.26Å; I82-L85 HydrophobicContact CD1-CD2 4.31Å; I82-L85 HydrophobicContact CG2-CB 4.21Å; L85-V87 HydrophobicContact CD2-CG2 3.91Å; L85-V87 HydrophobicContact CG-CG2 3.99Å
86	F	98.1	Very high	96.2	Very high	133 Å²	133	76.2 Å²	76.2	58%	0.583	40%	0.397	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86.8	131	162.5	170.7	-98.7	0	0	0	109.5	N51 M52 I53 R88	N51-F86 HydrophobicContact CB-CE2 4.05Å; N51-F86 HydrophobicContact CB-CZ 4.24Å; M52-F86 WeakPolarHBondContact O-CA 3.38Å; I53-F86 HydrophobicContact CD1-CB 4.01Å; I53-F86 HydrophobicContact CD1-CD2 3.68Å; I53-F86 HydrophobicContact CD1-CG 4.34Å; F86-R88 HydrophobicContact CE1-CB 4.46Å
87	V	97.8	Very high	95.7	Very high	9 Å²	9	75.1 Å²	75.1	6%	0.055	40%	0.4	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118	131.4	179.2	-177.2	0	0	0	0	109	M33 L39 N51 M52 L54 L85 V92	M33-V87 HydrophobicContact CE-CG1 3.71Å; M33-V87 HydrophobicContact SD-CG1 3.83Å; L39-V87 HydrophobicContact CD1-CG1 4.27Å; L39-V87 HydrophobicContact CD1-CG2 3.62Å; N51-V87 CarbonylContact C-O 3.53Å; N51-V87 VanDerWaalsContact CA-O 3.26Å; N51-V87 WeakPolarHBondContact CA-O 3.46Å; M52-V87 HydrophobicContact CB-CB 4.33Å; M52-V87 PolarHBondContact N-O 2.89Å; M52-V87 PolarHBondContact O-N 3.14Å; L54-V87 HydrophobicContact CD1-CG2 3.94Å; L54-V87 HydrophobicContact CG-CG2 4.44Å; L85-V87 HydrophobicContact CD2-CG2 3.91Å; L85-V87 HydrophobicContact CG-CG2 3.99Å; V87-V92 HydrophobicContact CG1-CG2 4.27Å
88	R	97.9	Very high	95	Very high	154 Å²	154	72.8 Å²	72.8	58%	0.581	38%	0.383	S	S	*	.			trans	-85.1	134.2	174.1	-174.9	179.6	173.6	85.1	7.8	110.7	N51 F86 D90 G91	N51-R88 WeakPolarHBondContact OD1-CA 3.41Å; F86-R88 HydrophobicContact CE1-CB 4.46Å; R88-D90 IonicContact CZ-OD2 2.74Å; R88-D90 IonicContact NE-OD2 2.76Å; R88-D90 PolarHBondContact NE-OD2 3.16Å; R88-D90 IonicContact NH2-OD1 3.4Å; R88-D90 IonicContact NH2-OD2 3.3Å; R88-D90 PolarHBondContact NH2-OD2 2.79Å; R88-D90 PolarHBondContact O-N 3.39Å; R88-G91 PolarHBondContact O-N 3.22Å
89	G	97.1	Very high	93.8	Very high	7 Å²	7	76.6 Å²	76.6	7%	0.072	40%	0.399	C	S	.	.	G	3₁₀ helix	trans	-67	-28.4	-172.8	0	0	0	0	0	116.2	H49 L50 N51 G91 V92	H49-G89 VanDerWaalsContact O-CA 3.28Å; H49-G89 WeakPolarHBondContact O-CA 3.43Å; L50-G89 VanDerWaalsContact C-CA 3.47Å; L50-G89 WeakPolarHBondContact O-CA 3.31Å; N51-G89 PolarHBondContact OD1-N 3.03Å; G89-G91 PolarHBondContact O-N 3.08Å; G89-V92 WeakPolarHBondContact O-CB 3.2Å; G89-V92 PolarHBondContact O-N 3.15Å
90	D	97.3	Very high	92.4	Very high	93 Å²	93	79.7 Å²	79.7	50%	0.497	41%	0.408	S	S	.	.	G	3₁₀ helix	trans	-56.4	-28.3	178.7	-58	-10.7	0	0	0	113.5	R34 R88	R34-D90 PolarHBondContact NE-O 3.19Å; R34-D90 VanDerWaalsContact NE-O 3.1Å; R88-D90 IonicContact CZ-OD2 2.74Å; R88-D90 IonicContact NE-OD2 2.76Å; R88-D90 PolarHBondContact NE-OD2 3.16Å; R88-D90 IonicContact NH2-OD1 3.4Å; R88-D90 IonicContact NH2-OD2 3.3Å; R88-D90 PolarHBondContact NH2-OD2 2.79Å; R88-D90 PolarHBondContact O-N 3.39Å
91	G	95.4	Very high	90.6	Very high	17 Å²	17	80.2 Å²	80.2	18%	0.175	43%	0.425	C	S	.	.	G	3₁₀ helix	trans	-87.8	-11.1	179.7	0	0	0	0	0	114.5	M33 R34 R88 G89	M33-G91 CarbonylContact C-O 3.6Å; M33-G91 VanDerWaalsContact CA-O 3.25Å; M33-G91 WeakPolarHBondContact CA-O 3.45Å; R34-G91 PolarHBondContact N-O 2.85Å; R88-G91 PolarHBondContact O-N 3.22Å; G89-G91 PolarHBondContact O-N 3.08Å
92	V	96.9	Very high	88.1	Confident	20 Å²	20	81.3 Å²	81.3	12%	0.121	47%	0.465	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.3	129.4	-179.3	178.9	0	0	0	0	109	V31 M33 M52 V87 G89 V95	V31-V92 HydrophobicContact CG1-CG1 3.95Å; V31-V92 HydrophobicContact CG1-CG2 4.22Å; M33-V92 HydrophobicContact CE-CG2 4.49Å; M33-V92 HydrophobicContact SD-CB 4.33Å; M33-V92 HydrophobicContact SD-CG2 3.69Å; M52-V92 HydrophobicContact CE-CG1 4.14Å; M52-V92 HydrophobicContact CE-CG2 4.09Å; V87-V92 HydrophobicContact CG1-CG2 4.27Å; G89-V92 WeakPolarHBondContact O-CB 3.2Å; G89-V92 PolarHBondContact O-N 3.15Å; V92-V95 HydrophobicContact CG1-CG2 3.84Å
93	V	96.6	Very high	87.7	Confident	95 Å²	95	83.3 Å²	83.3	58%	0.576	48%	0.477	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-106.3	-42	176.7	180	0	0	0	0	110.5	K32 R34	K32-V93 WeakPolarHBondContact O-CB 3.41Å; K32-V93 PolarHBondContact O-N 2.89Å; R34-V93 HydrophobicContact CG-CG2 3.66Å
94	L	95.4	Very high	87.1	Confident	86 Å²	86	82.4 Å²	82.4	45%	0.45	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.6	141.8	-178.4	159	130.5	0	0	0	110.2	Y30 V31 K32	Y30-L94 HydrophobicContact CD1-CD2 3.98Å; Y30-L94 HydrophobicContact CE1-CD2 3.68Å; V31-L94 CarbonylContact C-O 3.5Å; V31-L94 WeakPolarHBondContact CA-O 3.36Å; K32-L94 HydrophobicContact CB-CB 4.31Å; K32-L94 HydrophobicContact CB-CD2 3.97Å; K32-L94 PolarHBondContact N-O 2.91Å; K32-L94 PolarHBondContact O-N 2.9Å
95	V	94.8	Very high	86.5	Confident	37 Å²	37	81.5 Å²	81.5	22%	0.224	47%	0.467	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117	133.4	166.9	-176	0	0	0	0	108.4	I21 I29 Y30 V31 M52 V92	I21-V95 HydrophobicContact CD1-CB 3.91Å; I21-V95 HydrophobicContact CD1-CG1 3.93Å; I21-V95 HydrophobicContact CD1-CG2 3.98Å; I21-V95 HydrophobicContact CG1-CB 4.48Å; I21-V95 HydrophobicContact CG1-CG1 4.07Å; I29-V95 HydrophobicContact CD1-CG1 3.97Å; Y30-V95 WeakPolarHBondContact O-CA 3.05Å; V31-V95 HydrophobicContact CG1-CG2 4.46Å; M52-V95 HydrophobicContact CE-CG2 3.5Å; M52-V95 VanDerWaalsContact CE-CG2 3.5Å; V92-V95 HydrophobicContact CG1-CG2 3.84Å
96	A	92.5	Very high	85.9	Confident	30 Å²	30	83.6 Å²	83.6	25%	0.248	48%	0.481	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	137.1	172.5	0	0	0	0	0	110.3	Y30	Y30-A96 HydrophobicContact CD1-CB 4.13Å; Y30-A96 PolarHBondContact N-O 3.18Å; Y30-A96 PolarHBondContact O-N 3.05Å
97	P	82.3	Confident	85.1	Confident	77 Å²	77	80.6 Å²	80.6	50%	0.5	48%	0.475	S	S	.	.			trans	-65.9	170.9	176.2	30.5	-35.8	0	0	0	111
98	P	77	Confident	84.3	Confident	33 Å²	33	85.3 Å²	85.3	21%	0.214	50%	0.503	C	S	.	.			trans	-58.7	147	174.9	-10.6	21.3	0	0	0	110.5	E27 R28 R100	E27-P98 HydrophobicContact CB-CG 3.54Å; E27-P98 HydrophobicContact CG-CG 4.31Å; E27-P98 WeakPolarHBondContact OE2-CD 3.39Å; E27-P98 WeakPolarHBondContact OE2-CG 3.5Å; R28-P98 WeakPolarHBondContact O-CA 3.43Å; R28-P98 WeakPolarHBondContact O-CB 3.22Å; R28-P98 VanDerWaalsContact O-CG 3.23Å; R28-P98 WeakPolarHBondContact O-CG 3.32Å; P98-R100 PolarHBondContact O-N 2.99Å
99	L	70.5	Confident	83.3	Confident	165 Å²	165	80.4 Å²	80.4	86%	0.864	50%	0.497	S	S	*	.			trans	-63.6	101.5	167	-71.5	165.3	0	0	0	107.9	V101	L99-V101 VanDerWaalsContact C-N 3.26Å; L99-V101 PolarHBondContact O-N 3.04Å
100	R	67.5	Low	82.2	Confident	184 Å²	184	86.1 Å²	86.1	69%	0.694	53%	0.53	S	S	*	.			trans	-70.4	91.1	166.7	-69.9	-175.3	178	122.8	6.5	107	E27 P98 G102	E27-R100 IonicContact OE2-NH2 3.93Å; P98-R100 PolarHBondContact O-N 2.99Å; R100-G102 PolarHBondContact O-N 3.01Å
101	V	56.9	Low	81	Confident	138 Å²	138	85.5 Å²	85.5	84%	0.836	53%	0.532	S	S	*	.			trans	-71.7	107.1	168.2	-157.6	0	0	0	0	105.5	L99	L99-V101 VanDerWaalsContact C-N 3.26Å; L99-V101 PolarHBondContact O-N 3.04Å
102	G	46.1	Very low	79.7	Confident	144 Å²	144	91.7 Å²	91.7	100%	1.485	57%	0.565	S	S	*	*			trans	-72.8	0	173.7	0	0	0	0	0	112.3	R100	R100-G102 PolarHBondContact O-N 3.01Å

Retrieved 102 of 102 residues in 162.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).