A0A087XVW7_POEFO Loading...

Death-associated protein

AlphaFold DB (A0A3B3VLW6), UniProt , Accession A0A087XVW7, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 105 aa.

						>A0A087XVW7_POEFO|A0A087XVW7
MSSPPKEKVETKGGHLPAVKAGGMRIVQKHQPTPAPEPPQKDDDEEEYVSSSPPKAPVIVSGVVTKGDKDFTPAAAQVAHQKPQPGVPKLPPAQHINQHIHQPRK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.5	Very low	55.6	Low	241 Å²	241	143.3 Å²	143.3	100%	1.187	77%	0.766	S	S	*	*				0	113	0	-73	-80.3	101.6	0	0	107
2	S	51.2	Low	55.9	Low	124 Å²	124	147.3 Å²	147.3	87%	0.867	77%	0.771	S	S	*	*	P	Polyproline II helix	trans	-72.4	134.4	-169.1	-177	0	0	0	0	111.7
3	S	47.7	Very low	56.7	Low	103 Å²	103	142.5 Å²	142.5	72%	0.72	78%	0.78	S	S	*	*	P	Polyproline II helix	trans	-58.4	145.1	171.7	-53.9	0	0	0	0	111.4
4	P	61.1	Low	57.5	Low	114 Å²	114	136.4 Å²	136.4	74%	0.74	77%	0.766	S	S	*	*	P	Polyproline II helix	trans	-64.6	145.5	175.3	-18.3	30.8	0	0	0	111.7	K6	P4-K6 PolarHBondContact O-N 2.97Å
5	P	53.2	Low	58.1	Low	103 Å²	103	136.5 Å²	136.5	67%	0.669	76%	0.758	S	S	*	*	P	Polyproline II helix	trans	-67	132.3	-178.5	27.8	-32.4	0	0	0	110.4	E7	P5-E7 HydrophobicContact CB-CG 4.46Å; P5-E7 PolarHBondContact O-N 2.84Å
6	K	57.6	Low	58.7	Low	211 Å²	211	134.3 Å²	134.3	92%	0.917	74%	0.743	S	S	*	*			trans	-75.2	70.4	168.2	-69.5	176.7	-178.9	165.6	0	108.7	P4 K8	P4-K6 PolarHBondContact O-N 2.97Å; K6-K8 PolarHBondContact O-N 3.06Å
7	E	57.3	Low	59.3	Low	159 Å²	159	130.8 Å²	130.8	74%	0.743	73%	0.728	S	S	*	*			trans	-68	131.1	166.2	-76.5	-176.2	168.2	0	0	108.5	P5 V9	P5-E7 HydrophobicContact CB-CG 4.46Å; P5-E7 PolarHBondContact O-N 2.84Å; E7-V9 PolarHBondContact O-N 3.45Å
8	K	56	Low	59.8	Low	204 Å²	204	128.5 Å²	128.5	89%	0.887	73%	0.729	S	S	*	*			trans	-65.1	96.9	-178.2	-53.1	175.5	-170.4	177.3	0	106.9	K6 E10	K6-K8 PolarHBondContact O-N 3.06Å; K8-E10 PolarHBondContact O-N 2.7Å
9	V	59.7	Low	60.6	Low	81 Å²	81	126.6 Å²	126.6	49%	0.491	72%	0.72	S	S	.	*			trans	-60.2	114.7	174.7	-176.2	0	0	0	0	106.7	E7 T11 L16 P17	E7-V9 PolarHBondContact O-N 3.45Å; V9-T11 VanDerWaalsContact C-N 3.33Å; V9-T11 PolarHBondContact O-N 3.05Å; V9-L16 HydrophobicContact CB-CD2 3.82Å; V9-L16 HydrophobicContact CG1-CD2 3.51Å; V9-L16 HydrophobicContact CG2-CD2 4.32Å; V9-P17 VanDerWaalsContact CG1-CD 3.46Å; V9-P17 HydrophobicContact CG1-CG 3.96Å
10	E	60.3	Low	61.1	Low	170 Å²	170	127.2 Å²	127.2	79%	0.794	71%	0.714	S	S	*	*			trans	-58.3	99.2	174.7	-74.2	-175.6	168.9	0	0	108.4	K8	K8-E10 PolarHBondContact O-N 2.7Å
11	T	60.6	Low	61.5	Low	66 Å²	66	123.7 Å²	123.7	41%	0.405	70%	0.701	S	S	.	*			trans	-92.2	104.7	178.1	42	0	0	0	0	107.3	V9 G13 H15 L16	V9-T11 VanDerWaalsContact C-N 3.33Å; V9-T11 PolarHBondContact O-N 3.05Å; T11-G13 PolarHBondContact O-N 2.72Å; T11-H15 VanDerWaalsContact CA-O 3.29Å; T11-H15 WeakPolarHBondContact CA-O 3.33Å; T11-L16 HydrophobicContact CG2-CD2 3.66Å; T11-L16 HydrophobicContact CG2-CG 4.39Å
12	K	59.3	Low	62.6	Low	191 Å²	191	116.6 Å²	116.6	83%	0.83	69%	0.69	S	S	*	*	B	Isolated β-bridge	trans	-70.6	103.5	171.2	-74.1	-173.8	178.5	-178	0	107.6	H15	K12-H15 PolarHBondContact N-O 2.75Å
13	G	65.3	Low	63.6	Low	86 Å²	86	113.5 Å²	113.5	89%	0.887	68%	0.678	S	S	*	*	T	Hydrogen-bonded Turn	trans	68.6	31.2	-179.7	0	0	0	0	0	114.4	T11 H15	T11-G13 PolarHBondContact O-N 2.72Å; G13-H15 VanDerWaalsContact C-N 3.32Å; G13-H15 PolarHBondContact O-N 3.41Å
14	G	68.1	Low	64.9	Low	57 Å²	57	115.5 Å²	115.5	59%	0.588	68%	0.677	S	S	*	*	T	Hydrogen-bonded Turn	trans	84.4	-4.6	177.2	0	0	0	0	0	115.5
15	H	66.9	Low	65.6	Low	138 Å²	138	120.3 Å²	120.3	64%	0.639	68%	0.681	S	S	*	*	B	Isolated β-bridge	trans	-98.1	137.2	172.9	-88.7	-36.9	0	0	0	112.7	T11 K12 G13	T11-H15 VanDerWaalsContact CA-O 3.29Å; T11-H15 WeakPolarHBondContact CA-O 3.33Å; K12-H15 PolarHBondContact N-O 2.75Å; G13-H15 VanDerWaalsContact C-N 3.32Å; G13-H15 PolarHBondContact O-N 3.41Å
16	L	66.9	Low	66.5	Low	100 Å²	100	119.8 Å²	119.8	52%	0.524	67%	0.671	S	S	.	*	P	Polyproline II helix	trans	-66.3	142.7	175.2	-61.9	173	0	0	0	109.8	V9 T11 A18	V9-L16 HydrophobicContact CB-CD2 3.82Å; V9-L16 HydrophobicContact CG1-CD2 3.51Å; V9-L16 HydrophobicContact CG2-CD2 4.32Å; T11-L16 HydrophobicContact CG2-CD2 3.66Å; T11-L16 HydrophobicContact CG2-CG 4.39Å; L16-A18 PolarHBondContact O-N 2.79Å
17	P	68.8	Low	67.3	Low	76 Å²	76	114.8 Å²	114.8	49%	0.494	66%	0.658	S	S	.	*	P	Polyproline II helix	trans	-62.3	137.5	176.4	25.4	-32.2	0	0	0	110.5	V9 V19	V9-P17 VanDerWaalsContact CG1-CD 3.46Å; V9-P17 HydrophobicContact CG1-CG 3.96Å; P17-V19 PolarHBondContact O-N 3.39Å
18	A	69.9	Low	68	Low	89 Å²	89	113.1 Å²	113.1	74%	0.736	65%	0.65	S	S	*	*	P	Polyproline II helix	trans	-60.7	121.3	177	0	0	0	0	0	110.4	L16 K20	L16-A18 PolarHBondContact O-N 2.79Å; A18-K20 PolarHBondContact O-N 2.94Å
19	V	73.9	Confident	68.9	Low	92 Å²	92	111.8 Å²	111.8	56%	0.558	65%	0.645	S	S	*	*	P	Polyproline II helix	trans	-78.1	125.7	-178.2	-173.9	0	0	0	0	109.9	P17 I26	P17-V19 PolarHBondContact O-N 3.39Å; V19-I26 WeakPolarHBondContact O-CB 3.34Å; V19-I26 PolarHBondContact O-N 3.14Å; V19-I26 VanDerWaalsContact O-N 3.13Å
20	K	70.9	Confident	69.1	Low	138 Å²	138	114.8 Å²	114.8	60%	0.6	65%	0.653	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-111.1	112.9	173.5	-172.6	177.5	-176.5	177.6	0	107.9	A18 G23 M24	A18-K20 PolarHBondContact O-N 2.94Å; K20-G23 WeakPolarHBondContact CE-O 3.37Å; K20-G23 PolarHBondContact NZ-O 3.17Å; K20-M24 WeakPolarHBondContact CG-O 3.43Å
21	A	68.5	Low	69.2	Low	55 Å²	55	114.8 Å²	114.8	46%	0.455	65%	0.653	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-115.7	140.3	170.9	0	0	0	0	0	109	G23 M24 I26	A21-G23 VanDerWaalsContact C-N 3.31Å; A21-G23 PolarHBondContact O-N 2.95Å; A21-M24 PolarHBondContact O-N 2.89Å; A21-I26 HydrophobicContact CB-CD1 3.81Å
22	G	71.6	Confident	68.7	Low	91 Å²	91	116.9 Å²	116.9	94%	0.938	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	60.4	33.6	177.3	0	0	0	0	0	115	M24	G22-M24 PolarHBondContact O-N 3.29Å
23	G	71.7	Confident	68.3	Low	60 Å²	60	113.9 Å²	113.9	62%	0.619	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	78.8	-2.5	176.1	0	0	0	0	0	115.6	K20 A21	K20-G23 WeakPolarHBondContact CE-O 3.37Å; K20-G23 PolarHBondContact NZ-O 3.17Å; A21-G23 VanDerWaalsContact C-N 3.31Å; A21-G23 PolarHBondContact O-N 2.95Å
24	M	75.4	Confident	67.8	Low	144 Å²	144	115.4 Å²	115.4	71%	0.709	66%	0.66	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-118.5	139.9	-176.7	-155.9	118.7	80.2	0	0	111.7	K20 A21 G22 I26	K20-M24 WeakPolarHBondContact CG-O 3.43Å; A21-M24 PolarHBondContact O-N 2.89Å; G22-M24 PolarHBondContact O-N 3.29Å; M24-I26 PolarHBondContact O-N 2.83Å
25	R	76.8	Confident	67.3	Low	215 Å²	215	116.9 Å²	116.9	81%	0.811	67%	0.667	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-71.6	125.1	176.8	-70.3	-173.8	-179.4	-173.6	1	109.3
26	I	72.2	Confident	66.8	Low	93 Å²	93	116.2 Å²	116.2	48%	0.477	67%	0.674	S	S	.	*			trans	-94.9	119.5	174.7	-58.1	175.5	0	0	0	108	V19 A21 M24 Q28	V19-I26 WeakPolarHBondContact O-CB 3.34Å; V19-I26 PolarHBondContact O-N 3.14Å; V19-I26 VanDerWaalsContact O-N 3.13Å; A21-I26 HydrophobicContact CB-CD1 3.81Å; M24-I26 PolarHBondContact O-N 2.83Å; I26-Q28 PolarHBondContact O-N 3.28Å
27	V	74.1	Confident	66.2	Low	106 Å²	106	120.1 Å²	120.1	64%	0.642	69%	0.69	S	S	*	*			trans	-80	104.1	173.6	178.8	0	0	0	0	107.8	K29	V27-K29 HydrophobicContact CG1-CD 4.21Å; V27-K29 PolarHBondContact O-N 2.94Å; V27-K29 VanDerWaalsContact O-N 3.13Å
28	Q	71.2	Confident	65.7	Low	123 Å²	123	122 Å²	122	58%	0.575	70%	0.703	S	S	*	*			trans	-69.8	107	170.6	-170.6	173	3.5	0	0	108.4	I26 H30	I26-Q28 PolarHBondContact O-N 3.28Å; Q28-H30 PolarHBondContact O-N 3.2Å
29	K	73.9	Confident	64.8	Low	177 Å²	177	123.7 Å²	123.7	77%	0.77	71%	0.706	S	S	*	*	P	Polyproline II helix	trans	-73.1	118.5	169.8	-62	-65.2	-176.6	175.7	0	107.2	V27 Q31	V27-K29 HydrophobicContact CG1-CD 4.21Å; V27-K29 PolarHBondContact O-N 2.94Å; V27-K29 VanDerWaalsContact O-N 3.13Å; K29-Q31 PolarHBondContact O-N 2.9Å
30	H	64.4	Low	63.6	Low	144 Å²	144	127.8 Å²	127.8	67%	0.667	72%	0.719	S	S	*	*	P	Polyproline II helix	trans	-63.3	133.1	170.4	-70.3	-81.9	0	0	0	108.5	Q28	Q28-H30 PolarHBondContact O-N 3.2Å
31	Q	61.9	Low	62.7	Low	170 Å²	170	130.7 Å²	130.7	79%	0.794	73%	0.731	S	S	*	*	P	Polyproline II helix	trans	-54.2	134.6	163.7	-79.4	-76.4	-6.5	0	0	107.6	K29 T33	K29-Q31 PolarHBondContact O-N 2.9Å; Q31-T33 PolarHBondContact O-N 2.69Å
32	P	51.3	Low	61.5	Low	110 Å²	110	134.7 Å²	134.7	71%	0.714	75%	0.745	S	S	*	*			trans	-62.4	114.4	176.5	25.9	-31.6	0	0	0	108.2
33	T	51.5	Low	60.6	Low	127 Å²	127	137.5 Å²	137.5	78%	0.779	74%	0.739	S	S	*	*	P	Polyproline II helix	trans	-56.6	130.7	168.1	-22.2	0	0	0	0	107.7	Q31 A35	Q31-T33 PolarHBondContact O-N 2.69Å; T33-A35 PolarHBondContact O-N 2.75Å
34	P	53.8	Low	59.5	Low	118 Å²	118	140.3 Å²	140.3	77%	0.766	74%	0.74	S	S	*	*	P	Polyproline II helix	trans	-58	133.2	172.2	23.6	-31.5	0	0	0	109.1
35	A	56.7	Low	58.5	Low	89 Å²	89	142.5 Å²	142.5	74%	0.736	75%	0.748	S	S	*	*	P	Polyproline II helix	trans	-57.1	131.2	-172.1	0	0	0	0	0	111.5	T33	T33-A35 PolarHBondContact O-N 2.75Å
36	P	56.7	Low	57.4	Low	123 Å²	123	139.6 Å²	139.6	80%	0.799	74%	0.744	S	S	*	*	P	Polyproline II helix	trans	-66.5	139.2	160.9	27.7	-30.2	0	0	0	109.2
37	E	55.9	Low	56.6	Low	182 Å²	182	143.1 Å²	143.1	85%	0.85	76%	0.758	S	S	*	*	P	Polyproline II helix	trans	-49	143.9	178.5	-69	179.1	154.2	0	0	112	P39	E37-P39 WeakPolarHBondContact O-CD 3.47Å
38	P	56.3	Low	55.5	Low	117 Å²	117	147.8 Å²	147.8	76%	0.76	77%	0.766	S	S	*	*	P	Polyproline II helix	trans	-66.5	125.7	-178.9	27.6	-32.8	0	0	0	109.7	Q40	P38-Q40 PolarHBondContact O-N 2.7Å
39	P	52.6	Low	54.7	Low	123 Å²	123	147.2 Å²	147.2	80%	0.799	77%	0.77	S	S	*	*	P	Polyproline II helix	trans	-60.6	141	165.7	25.1	-30.6	0	0	0	109.2	E37	E37-P39 WeakPolarHBondContact O-CD 3.47Å
40	Q	49.1	Very low	53.9	Low	179 Å²	179	142.4 Å²	142.4	84%	0.836	76%	0.759	S	S	*	*	P	Polyproline II helix	trans	-53.3	150.1	-179.2	-68.7	171.6	-82.6	0	0	111	P38 D42	P38-Q40 PolarHBondContact O-N 2.7Å; Q40-D42 PolarHBondContact O-N 3.41Å
41	K	52	Low	53.8	Low	198 Å²	198	140.8 Å²	140.8	86%	0.861	76%	0.764	S	S	*	*			trans	-59.9	106.7	174.9	-60.8	174.6	-178.9	178.7	0	108.8
42	D	43.3	Very low	53.9	Low	140 Å²	140	135.8 Å²	135.8	75%	0.749	75%	0.748	S	S	*	*			trans	-84.8	106.9	158.2	-68.9	-34	0	0	0	106.3	Q40 D44	Q40-D42 PolarHBondContact O-N 3.41Å; D42-D44 PolarHBondContact O-N 3.14Å
43	D	51.9	Low	54.8	Low	150 Å²	150	135.4 Å²	135.4	80%	0.802	75%	0.745	S	S	*	*			trans	-65.5	78.4	163.2	-86.3	-57	0	0	0	108.1
44	D	48.3	Very low	55.7	Low	119 Å²	119	135.3 Å²	135.3	64%	0.636	75%	0.747	S	S	*	*			trans	-112.8	77.9	162	-78.2	-38.1	0	0	0	107.1	D42 E46	D42-D44 PolarHBondContact O-N 3.14Å; D44-E46 HydrophobicContact CB-CG 4.12Å; D44-E46 PolarHBondContact O-N 3.22Å
45	E	54.4	Low	56.4	Low	190 Å²	190	138.7 Å²	138.7	89%	0.888	75%	0.749	S	S	*	*			trans	-63.2	64.3	146.5	-81.1	-179.8	159.7	0	0	108	E47	E45-E47 PolarHBondContact O-N 3.32Å
46	E	53.5	Low	57.3	Low	154 Å²	154	138 Å²	138	72%	0.72	74%	0.744	S	S	*	*			trans	-69.1	87.9	158.2	-76.3	-70	159.7	0	0	105.1	D44 Y48	D44-E46 HydrophobicContact CB-CG 4.12Å; D44-E46 PolarHBondContact O-N 3.22Å; E46-Y48 PolarHBondContact O-N 3Å
47	E	56.2	Low	58	Low	167 Å²	167	136.3 Å²	136.3	78%	0.78	73%	0.733	S	S	*	*			trans	-45.9	86.9	161.3	-165	175	-145.2	0	0	107	E45 V49	E45-E47 PolarHBondContact O-N 3.32Å; E47-V49 HydrophobicContact CG-CG2 4.2Å; E47-V49 PolarHBondContact O-N 3Å
48	Y	50	Low	59.2	Low	204 Å²	204	132 Å²	132	80%	0.8	72%	0.719	S	S	*	*			trans	-67.4	84.9	174.1	-172.1	-97.1	0	0	0	105.9	E46 S50	E46-Y48 PolarHBondContact O-N 3Å; Y48-S50 PolarHBondContact O-N 3.03Å
49	V	54.9	Low	60.3	Low	111 Å²	111	131.6 Å²	131.6	67%	0.673	71%	0.709	S	S	*	*			trans	-65.4	85.5	165.9	-178.8	0	0	0	0	104.9	E47 S51	E47-V49 HydrophobicContact CG-CG2 4.2Å; E47-V49 PolarHBondContact O-N 3Å; V49-S51 PolarHBondContact O-N 3.23Å
50	S	57.8	Low	61.6	Low	76 Å²	76	129 Å²	129	53%	0.531	69%	0.691	S	S	.	*			trans	-61.4	93.6	164.8	-172.1	0	0	0	0	105.4	Y48 S52	Y48-S50 PolarHBondContact O-N 3.03Å; S50-S52 PolarHBondContact O-N 2.98Å
51	S	61.9	Low	63.3	Low	110 Å²	110	126.5 Å²	126.5	77%	0.769	69%	0.693	S	S	*	*			trans	-69.7	64.9	162.9	64.2	0	0	0	0	107.4	V49 P53	V49-S51 PolarHBondContact O-N 3.23Å; S51-P53 WeakPolarHBondContact O-CD 3.34Å
52	S	64.3	Low	64.9	Low	65 Å²	65	120.4 Å²	120.4	46%	0.455	69%	0.687	S	S	.	*	P	Polyproline II helix	trans	-60.5	121.5	172.4	-177.8	0	0	0	0	106	S50	S50-S52 PolarHBondContact O-N 2.98Å
53	P	69.4	Low	66.8	Low	101 Å²	101	118.3 Å²	118.3	66%	0.656	68%	0.679	S	S	*	*	P	Polyproline II helix	trans	-51.9	141.1	170.7	19.1	-29.6	0	0	0	108.3	S51 K55	S51-P53 WeakPolarHBondContact O-CD 3.34Å; P53-K55 PolarHBondContact O-N 3.3Å
54	P	71.2	Confident	68.4	Low	126 Å²	126	115.2 Å²	115.2	82%	0.818	67%	0.665	S	S	*	*	P	Polyproline II helix	trans	-49	117.3	-174.6	17.9	-31.2	0	0	0	108.9	A56	P54-A56 PolarHBondContact O-N 3.07Å
55	K	68	Low	70.1	Confident	188 Å²	188	110.5 Å²	110.5	82%	0.817	64%	0.641	S	S	*	*			trans	-53.4	110.2	-174.3	-70	179.2	-178.1	173.3	0	107.7	P53	P53-K55 PolarHBondContact O-N 3.3Å
56	A	74.6	Confident	71.6	Confident	76 Å²	76	108.9 Å²	108.9	63%	0.628	63%	0.63	S	S	*	*			trans	-56.5	139.9	178.6	0	0	0	0	0	108.7	P54 V58	P54-A56 PolarHBondContact O-N 3.07Å; A56-V58 PolarHBondContact O-N 3.22Å
57	P	72.7	Confident	73	Confident	87 Å²	87	103.1 Å²	103.1	57%	0.565	61%	0.612	S	S	*	*			trans	-56.5	115.3	-179.9	20	-30.1	0	0	0	109.5	I59 V64	P57-I59 PolarHBondContact O-N 3.39Å; P57-V64 HydrophobicContact CB-CG1 3.54Å; P57-V64 HydrophobicContact CB-CG2 4.4Å
58	V	80.3	Confident	74.2	Confident	92 Å²	92	101.8 Å²	101.8	56%	0.558	61%	0.611	S	S	*	*			trans	-74.6	118	178.2	-180	0	0	0	0	107.3	A56 V60 T65	A56-V58 PolarHBondContact O-N 3.22Å; V58-V60 HydrophobicContact CG1-CG2 4.07Å; V58-T65 WeakPolarHBondContact O-CB 3.36Å; V58-T65 WeakPolarHBondContact O-CG2 3.34Å; V58-T65 PolarHBondContact O-N 3.44Å; V58-T65 PolarHBondContact O-OG1 2.99Å
59	I	80.2	Confident	75.7	Confident	108 Å²	108	100.3 Å²	100.3	55%	0.554	61%	0.609	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-95.3	118.2	179.1	-58	176	0	0	0	108.3	P57 G62 V63 V64	P57-I59 PolarHBondContact O-N 3.39Å; I59-G62 VanDerWaalsContact CG2-C 3.48Å; I59-V63 VanDerWaalsContact CA-O 3.32Å; I59-V63 WeakPolarHBondContact CA-O 3.32Å; I59-V64 HydrophobicContact CG1-CG2 4.12Å
60	V	80.4	Confident	77	Confident	68 Å²	68	98.6 Å²	98.6	41%	0.412	60%	0.596	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-116.1	121.8	176	-178.9	0	0	0	0	108.1	V58 G62 V63 T65 F71	V58-V60 HydrophobicContact CG1-CG2 4.07Å; V60-G62 PolarHBondContact O-N 3.49Å; V60-V63 PolarHBondContact N-O 3.39Å; V60-V63 PolarHBondContact O-N 3.5Å; V60-V63 VanDerWaalsContact O-N 3.14Å; V60-T65 HydrophobicContact CB-CG2 3.79Å; V60-T65 HydrophobicContact CG2-CG2 3.76Å; V60-F71 HydrophobicContact CB-CZ 3.97Å; V60-F71 HydrophobicContact CG1-CZ 4.17Å; V60-F71 HydrophobicContact CG2-CE2 4.16Å; V60-F71 HydrophobicContact CG2-CZ 3.64Å
61	S	83.2	Confident	78.2	Confident	127 Å²	127	99.9 Å²	99.9	89%	0.888	59%	0.592	S	S	*	*	T	Hydrogen-bonded Turn	trans	52.1	38.9	-176.2	-153.5	0	0	0	0	113.7	V63	S61-V63 VanDerWaalsContact C-N 3.32Å; S61-V63 PolarHBondContact O-N 3.02Å
62	G	86.4	Confident	79.4	Confident	70 Å²	70	97.6 Å²	97.6	72%	0.722	57%	0.573	S	S	*	*	T	Hydrogen-bonded Turn	trans	82.2	-1.4	177.8	0	0	0	0	0	115.8	I59 V60	I59-G62 VanDerWaalsContact CG2-C 3.48Å; V60-G62 PolarHBondContact O-N 3.49Å
63	V	82.8	Confident	80.3	Confident	96 Å²	96	99.2 Å²	99.2	58%	0.582	58%	0.582	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-107.1	133.6	178.2	-176.5	0	0	0	0	110.7	I59 V60 S61 T65	I59-V63 VanDerWaalsContact CA-O 3.32Å; I59-V63 WeakPolarHBondContact CA-O 3.32Å; V60-V63 PolarHBondContact N-O 3.39Å; V60-V63 PolarHBondContact O-N 3.5Å; V60-V63 VanDerWaalsContact O-N 3.14Å; S61-V63 VanDerWaalsContact C-N 3.32Å; S61-V63 PolarHBondContact O-N 3.02Å; V63-T65 PolarHBondContact O-N 3.34Å
64	V	84.9	Confident	80.9	Confident	84 Å²	84	97.2 Å²	97.2	51%	0.509	57%	0.574	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-68.8	121	172.1	172.3	0	0	0	0	109.4	P57 I59	P57-V64 HydrophobicContact CB-CG1 3.54Å; P57-V64 HydrophobicContact CB-CG2 4.4Å; I59-V64 HydrophobicContact CG1-CG2 4.12Å
65	T	84.3	Confident	81.5	Confident	21 Å²	21	93.6 Å²	93.6	13%	0.129	56%	0.555	C	S	.	*			trans	-91.8	144.6	-174.6	67.3	0	0	0	0	111.9	V58 V60 V63 G67 D70 F71	V58-T65 WeakPolarHBondContact O-CB 3.36Å; V58-T65 WeakPolarHBondContact O-CG2 3.34Å; V58-T65 PolarHBondContact O-N 3.44Å; V58-T65 PolarHBondContact O-OG1 2.99Å; V60-T65 HydrophobicContact CB-CG2 3.79Å; V60-T65 HydrophobicContact CG2-CG2 3.76Å; V63-T65 PolarHBondContact O-N 3.34Å; T65-G67 PolarHBondContact O-N 3.23Å; T65-D70 WeakPolarHBondContact CA-OD2 3.42Å; T65-F71 HydrophobicContact CG2-CE2 3.5Å; T65-F71 HydrophobicContact CG2-CZ 3.74Å
66	K	85.6	Confident	82.2	Confident	155 Å²	155	87.7 Å²	87.7	67%	0.674	54%	0.541	S	S	*	.			trans	-90.6	21.2	-179.5	-62.6	174	-176.6	169.9	0	112.3	D68 K69 D70	K66-D68 PolarHBondContact O-N 2.68Å; K66-K69 HydrophobicContact CB-CB 4.03Å; K66-K69 HydrophobicContact CB-CD 4.33Å; K66-D70 PolarHBondContact N-OD2 3.09Å
67	G	83.4	Confident	82.7	Confident	33 Å²	33	90 Å²	90	34%	0.34	54%	0.539	S	S	.	.	G	3₁₀ helix	trans	65.4	-125.6	-176.8	0	0	0	0	0	112.1	T65 K69 D70 F71	T65-G67 PolarHBondContact O-N 3.23Å; G67-K69 PolarHBondContact O-N 2.92Å; G67-D70 PolarHBondContact O-N 2.84Å; G67-F71 PolarHBondContact O-N 3.15Å
68	D	81.1	Confident	83.1	Confident	140 Å²	140	90.2 Å²	90.2	75%	0.749	54%	0.539	S	S	*	.	G	3₁₀ helix	trans	-61.4	-19.9	-172.2	-60.8	-20.9	0	0	0	114.5	K66	K66-D68 PolarHBondContact O-N 2.68Å
69	K	81.6	Confident	83.1	Confident	173 Å²	173	90.1 Å²	90.1	75%	0.752	55%	0.547	S	S	*	.	G	3₁₀ helix	trans	-67.4	-35.7	173.4	-71.2	-179.3	178.8	173	0	112.6	K66 G67	K66-K69 HydrophobicContact CB-CB 4.03Å; K66-K69 HydrophobicContact CB-CD 4.33Å; G67-K69 PolarHBondContact O-N 2.92Å
70	D	82.6	Confident	83.4	Confident	75 Å²	75	93 Å²	93	40%	0.401	56%	0.558	S	S	.	*	T	Hydrogen-bonded Turn	trans	-96.7	-25.3	-178	-61.1	-22.6	0	0	0	111.3	T65 K66 G67	T65-D70 WeakPolarHBondContact CA-OD2 3.42Å; K66-D70 PolarHBondContact N-OD2 3.09Å; G67-D70 PolarHBondContact O-N 2.84Å
71	F	82.4	Confident	83.7	Confident	102 Å²	102	96.5 Å²	96.5	45%	0.447	57%	0.57	S	S	.	*	S	Bend	trans	-123.2	73.3	179.9	-55.9	-72.1	0	0	0	111.7	V60 T65 G67	V60-F71 HydrophobicContact CB-CZ 3.97Å; V60-F71 HydrophobicContact CG1-CZ 4.17Å; V60-F71 HydrophobicContact CG2-CE2 4.16Å; V60-F71 HydrophobicContact CG2-CZ 3.64Å; T65-F71 HydrophobicContact CG2-CE2 3.5Å; T65-F71 HydrophobicContact CG2-CZ 3.74Å; G67-F71 PolarHBondContact O-N 3.15Å
72	T	87.4	Confident	83.9	Confident	62 Å²	62	99 Å²	99	38%	0.38	57%	0.565	S	S	.	*			trans	-65.1	153.5	174.1	64.9	0	0	0	0	111.2	A74 A75 A76	T72-A74 PolarHBondContact O-N 2.97Å; T72-A74 VanDerWaalsContact O-N 3.14Å; T72-A75 WeakPolarHBondContact O-CA 3.47Å; T72-A75 WeakPolarHBondContact O-CB 3.5Å; T72-A75 PolarHBondContact O-N 3.07Å; T72-A75 PolarHBondContact OG1-N 2.97Å; T72-A76 PolarHBondContact O-N 3.33Å
73	P	83.2	Confident	83.9	Confident	99 Å²	99	101.6 Å²	101.6	64%	0.643	57%	0.569	S	S	*	*	H	α-helix	trans	-54.8	-33.3	173.8	-27	34.7	0	0	0	112.9	A76 Q77	P73-A76 PolarHBondContact O-N 3.15Å; P73-Q77 WeakPolarHBondContact O-CG 3.29Å; P73-Q77 PolarHBondContact O-N 2.89Å; P73-Q77 VanDerWaalsContact O-N 3.07Å
74	A	82.7	Confident	84	Confident	60 Å²	60	104.7 Å²	104.7	50%	0.496	58%	0.577	S	S	.	*	H	α-helix	trans	-63.4	-39.5	174.1	0	0	0	0	0	112.2	T72 A76 Q77 V78	T72-A74 PolarHBondContact O-N 2.97Å; T72-A74 VanDerWaalsContact O-N 3.14Å; A74-A76 VanDerWaalsContact C-N 3.35Å; A74-Q77 WeakPolarHBondContact O-CB 3.44Å; A74-Q77 PolarHBondContact O-N 2.67Å; A74-V78 PolarHBondContact O-N 3.03Å
75	A	82.8	Confident	84.1	Confident	49 Å²	49	106 Å²	106	41%	0.405	59%	0.588	S	S	.	*	H	α-helix	trans	-64.2	-39.1	174.9	0	0	0	0	0	111.8	T72 Q77 V78	T72-A75 WeakPolarHBondContact O-CA 3.47Å; T72-A75 WeakPolarHBondContact O-CB 3.5Å; T72-A75 PolarHBondContact O-N 3.07Å; T72-A75 PolarHBondContact OG1-N 2.97Å; A75-Q77 VanDerWaalsContact C-N 3.27Å; A75-Q77 PolarHBondContact O-N 2.88Å; A75-V78 WeakPolarHBondContact O-CB 2.83Å; A75-V78 PolarHBondContact O-N 3.46Å
76	A	83	Confident	84.1	Confident	65 Å²	65	108.9 Å²	108.9	54%	0.537	62%	0.621	S	S	.	*	H	α-helix	trans	-65.2	-30.4	174	0	0	0	0	0	112.7	T72 P73 A74 V78 A79	T72-A76 PolarHBondContact O-N 3.33Å; P73-A76 PolarHBondContact O-N 3.15Å; A74-A76 VanDerWaalsContact C-N 3.35Å; A76-V78 VanDerWaalsContact C-N 3.33Å; A76-A79 PolarHBondContact O-N 2.76Å
77	Q	85.2	Confident	84	Confident	124 Å²	124	106.9 Å²	106.9	58%	0.579	62%	0.622	S	S	*	*	H	α-helix	trans	-70.8	-25.9	175.8	-70.8	173.1	16.7	0	0	113.1	P73 A74 A75 A79 H80	P73-Q77 WeakPolarHBondContact O-CG 3.29Å; P73-Q77 PolarHBondContact O-N 2.89Å; P73-Q77 VanDerWaalsContact O-N 3.07Å; A74-Q77 WeakPolarHBondContact O-CB 3.44Å; A74-Q77 PolarHBondContact O-N 2.67Å; A75-Q77 VanDerWaalsContact C-N 3.27Å; A75-Q77 PolarHBondContact O-N 2.88Å; Q77-A79 PolarHBondContact O-N 3.13Å; Q77-H80 PolarHBondContact O-N 3.38Å
78	V	82.3	Confident	83.9	Confident	92 Å²	92	110.5 Å²	110.5	56%	0.558	64%	0.639	S	S	*	*	H	α-helix	trans	-58.8	-32.8	176.9	178.2	0	0	0	0	111.5	A74 A75 A76 H80 Q81	A74-V78 PolarHBondContact O-N 3.03Å; A75-V78 WeakPolarHBondContact O-CB 2.83Å; A75-V78 PolarHBondContact O-N 3.46Å; A76-V78 VanDerWaalsContact C-N 3.33Å; V78-H80 PolarHBondContact O-N 3.13Å; V78-H80 VanDerWaalsContact O-N 3.15Å; V78-Q81 PolarHBondContact O-N 3.41Å
79	A	80.6	Confident	83.9	Confident	89 Å²	89	113.7 Å²	113.7	74%	0.736	65%	0.646	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.6	-22.2	176.4	0	0	0	0	0	113.8	A76 Q77	A76-A79 PolarHBondContact O-N 2.76Å; Q77-A79 PolarHBondContact O-N 3.13Å
80	H	85.9	Confident	83.9	Confident	169 Å²	169	112.3 Å²	112.3	78%	0.782	65%	0.646	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.2	-6.7	177.2	-60.2	91.8	0	0	0	112.8	Q77 V78	Q77-H80 PolarHBondContact O-N 3.38Å; V78-H80 PolarHBondContact O-N 3.13Å; V78-H80 VanDerWaalsContact O-N 3.15Å
81	Q	86.9	Confident	83.9	Confident	142 Å²	142	113.9 Å²	113.9	66%	0.664	66%	0.661	S	S	*	*	S	Bend	trans	-87.5	135.9	174.3	-63.3	-160.4	8.9	0	0	110.6	V78	V78-Q81 PolarHBondContact O-N 3.41Å
82	K	87.3	Confident	83.7	Confident	180 Å²	180	114.3 Å²	114.3	78%	0.783	67%	0.674	S	S	*	*	P	Polyproline II helix	trans	-65.8	134	174.6	-66	-175.5	-178.4	-178.2	0	109.4	Q84	K82-Q84 PolarHBondContact O-N 3.03Å; K82-Q84 PolarHBondContact O-NE2 3.28Å
83	P	86.6	Confident	83.1	Confident	124 Å²	124	115 Å²	115	81%	0.805	69%	0.686	S	S	*	*	P	Polyproline II helix	trans	-60.9	131.5	178.1	24.4	-32.4	0	0	0	109.9
84	Q	84.4	Confident	82.6	Confident	160 Å²	160	118.3 Å²	118.3	75%	0.748	69%	0.693	S	S	*	*	P	Polyproline II helix	trans	-81.5	143	175.1	-63.2	-59	-47	0	0	109.8	K82 G86	K82-Q84 PolarHBondContact O-N 3.03Å; K82-Q84 PolarHBondContact O-NE2 3.28Å; Q84-G86 PolarHBondContact O-N 3.44Å
85	P	86.6	Confident	81.8	Confident	113 Å²	113	123.5 Å²	123.5	73%	0.734	71%	0.706	S	S	*	*	P	Polyproline II helix	trans	-57.3	123.8	172.8	-21.9	32.5	0	0	0	110.8	V87	P85-V87 VanDerWaalsContact C-N 3.26Å; P85-V87 PolarHBondContact O-N 3.13Å
86	G	83.7	Confident	81.2	Confident	81 Å²	81	126.3 Å²	126.3	84%	0.835	71%	0.713	S	S	*	*	S	Bend	trans	-79.3	-3.7	-178.8	0	0	0	0	0	114.9	Q84	Q84-G86 PolarHBondContact O-N 3.44Å
87	V	84.1	Confident	80.4	Confident	112 Å²	112	129.7 Å²	129.7	68%	0.679	72%	0.722	S	S	*	*	S	Bend	trans	-109	126	-178.6	-174	0	0	0	0	108.8	P85	P85-V87 VanDerWaalsContact C-N 3.26Å; P85-V87 PolarHBondContact O-N 3.13Å
88	P	81.9	Confident	79.7	Confident	109 Å²	109	130.7 Å²	130.7	71%	0.708	73%	0.727	S	S	*	*			trans	-60.1	141.6	174.3	25.7	-33.1	0	0	0	109.6	L90	P88-L90 PolarHBondContact O-N 3.2Å
89	K	80.8	Confident	79.2	Confident	208 Å²	208	133.7 Å²	133.7	90%	0.904	74%	0.735	S	S	*	*			trans	-59.1	115.6	178.6	-168.3	170	-177.3	177.3	0	108.5
90	L	80.9	Confident	79	Confident	143 Å²	143	135.1 Å²	135.1	75%	0.749	73%	0.729	S	S	*	*	P	Polyproline II helix	trans	-55.3	142.2	176.3	-66.6	173.8	0	0	0	109	P88	P88-L90 PolarHBondContact O-N 3.2Å
91	P	82.9	Confident	78.7	Confident	108 Å²	108	135.7 Å²	135.7	70%	0.701	73%	0.731	S	S	*	*	P	Polyproline II helix	trans	-54.6	142.9	173.8	24	-32.6	0	0	0	108.9	A93	P91-A93 PolarHBondContact O-N 3.5Å; P91-A93 VanDerWaalsContact O-N 3.09Å
92	P	78.7	Confident	78.5	Confident	111 Å²	111	135.9 Å²	135.9	72%	0.721	73%	0.732	S	S	*	*	P	Polyproline II helix	trans	-54.2	124.9	176	23.1	-31.6	0	0	0	107.6	Q94	P92-Q94 PolarHBondContact O-N 3.47Å
93	A	74.9	Confident	78.2	Confident	77 Å²	77	133 Å²	133	64%	0.636	73%	0.732	S	S	*	*			trans	-52.5	114.7	174.1	0	0	0	0	0	106.2	P91 H95	P91-A93 PolarHBondContact O-N 3.5Å; P91-A93 VanDerWaalsContact O-N 3.09Å; A93-H95 PolarHBondContact O-N 3.48Å
94	Q	71.6	Confident	77.8	Confident	169 Å²	169	138.8 Å²	138.8	79%	0.79	74%	0.738	S	S	*	*			trans	-57	110.7	173.9	-71	179.8	-35.6	0	0	104.9	P92 I96	P92-Q94 PolarHBondContact O-N 3.47Å; Q94-I96 HydrophobicContact CB-CG1 4.19Å; Q94-I96 PolarHBondContact O-N 3.27Å
95	H	67.1	Low	77.1	Confident	169 Å²	169	144.4 Å²	144.4	78%	0.782	76%	0.76	S	S	*	*			trans	-68.5	70.1	169	-30.5	-86.1	0	0	0	105.7	A93 N97	A93-H95 PolarHBondContact O-N 3.48Å; H95-N97 VanDerWaalsContact C-N 3.34Å; H95-N97 PolarHBondContact O-N 3.27Å
96	I	69.3	Low	76.7	Confident	107 Å²	107	146 Å²	146	55%	0.549	76%	0.761	S	S	.	*			trans	-57.3	112.1	161.9	-70.7	171.1	0	0	0	102	Q94 Q98	Q94-I96 HydrophobicContact CB-CG1 4.19Å; Q94-I96 PolarHBondContact O-N 3.27Å; I96-Q98 HydrophobicContact CG2-CG 4.24Å; I96-Q98 PolarHBondContact O-N 3.35Å
97	N	66.5	Low	76.3	Confident	136 Å²	136	149.4 Å²	149.4	73%	0.727	76%	0.757	S	S	*	*			trans	-58.6	84.8	163.7	-97.6	-79.2	0	0	0	105.3	H95 H99	H95-N97 VanDerWaalsContact C-N 3.34Å; H95-N97 PolarHBondContact O-N 3.27Å; N97-H99 VanDerWaalsContact C-N 3.29Å; N97-H99 PolarHBondContact O-N 3.49Å; N97-H99 PolarHBondContact O-ND1 2.82Å; N97-H99 VanDerWaalsContact O-ND1 3.15Å
98	Q	70	Confident	75.9	Confident	145 Å²	145	151.4 Å²	151.4	68%	0.678	76%	0.762	S	S	*	*			trans	-60.7	104	169.2	-65.7	-82.5	78.3	0	0	102.6	I96 I100	I96-Q98 HydrophobicContact CG2-CG 4.24Å; I96-Q98 PolarHBondContact O-N 3.35Å; Q98-I100 HydrophobicContact CB-CG1 4.22Å; Q98-I100 WeakPolarHBondContact O-CG1 3.36Å; Q98-I100 PolarHBondContact O-N 2.88Å
99	H	72.4	Confident	75.5	Confident	155 Å²	155	153.9 Å²	153.9	72%	0.718	77%	0.765	S	S	*	*			trans	-66.8	88.7	171.3	-74.7	80.8	0	0	0	105.1	N97 H101	N97-H99 VanDerWaalsContact C-N 3.29Å; N97-H99 PolarHBondContact O-N 3.49Å; N97-H99 PolarHBondContact O-ND1 2.82Å; N97-H99 VanDerWaalsContact O-ND1 3.15Å; H99-H101 PolarHBondContact O-CD2 2.91Å; H99-H101 PolarHBondContact O-N 3.23Å
100	I	76.6	Confident	75.2	Confident	120 Å²	120	150.6 Å²	150.6	62%	0.615	76%	0.756	S	S	*	*			trans	-70.2	101.3	179.7	-64.1	171.7	0	0	0	105.5	Q98 Q102	Q98-I100 HydrophobicContact CB-CG1 4.22Å; Q98-I100 WeakPolarHBondContact O-CG1 3.36Å; Q98-I100 PolarHBondContact O-N 2.88Å; I100-Q102 HydrophobicContact CG2-CB 3.87Å; I100-Q102 VanDerWaalsContact CG2-CD 3.45Å; I100-Q102 HydrophobicContact CG2-CG 3.39Å; I100-Q102 PolarHBondContact O-N 3.02Å
101	H	79.1	Confident	74.8	Confident	180 Å²	180	151.1 Å²	151.1	83%	0.833	76%	0.757	S	S	*	*			trans	-74.8	50.2	172.9	-68.2	-92.6	0	0	0	110.8	H99	H99-H101 PolarHBondContact O-CD2 2.91Å; H99-H101 PolarHBondContact O-N 3.23Å
102	Q	83.5	Confident	74.2	Confident	146 Å²	146	154.1 Å²	154.1	68%	0.682	76%	0.76	S	S	*	*	P	Polyproline II helix	trans	-74.7	137.1	171.7	-84.7	172.7	6.5	0	0	109.4	I100 R104	I100-Q102 HydrophobicContact CG2-CB 3.87Å; I100-Q102 VanDerWaalsContact CG2-CD 3.45Å; I100-Q102 HydrophobicContact CG2-CG 3.39Å; I100-Q102 PolarHBondContact O-N 3.02Å; Q102-R104 PolarHBondContact O-N 3.46Å; Q102-R104 VanDerWaalsContact O-N 3.13Å
103	P	80.8	Confident	73.9	Confident	121 Å²	121	157.5 Å²	157.5	79%	0.786	76%	0.764	S	S	*	*	P	Polyproline II helix	trans	-63.9	116.3	173.2	25.6	-31.1	0	0	0	108.5	K105	P103-K105 PolarHBondContact O-N 3.5Å
104	R	77.9	Confident	73.8	Confident	244 Å²	244	164.2 Å²	164.2	92%	0.921	77%	0.774	S	S	*	*	P	Polyproline II helix	trans	-73.7	124.7	169.6	-63.4	-176.4	-174.5	168.2	1.8	107.4	Q102	Q102-R104 PolarHBondContact O-N 3.46Å; Q102-R104 VanDerWaalsContact O-N 3.13Å
105	K	71	Confident	74	Confident	278 Å²	278	163.7 Å²	163.7	100%	1.209	77%	0.773	S	S	*	*			trans	-81.3	0	167.6	-74.1	-164	177.4	-172.1	0	110.3	P103	P103-K105 PolarHBondContact O-N 3.5Å

Retrieved 105 of 105 residues in 172.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).