A0A087XYM2_POEFO Loading...

Serine palmitoyltransferase, small subunit A

AlphaFold DB (A0A3P9N3N3), UniProt , Accession A0A087XYM2, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 68 aa.

						>A0A087XYM2_POEFO|A0A087XYM2
MALGDCWKQLSWFYYQYLLVTALYMLEPWERTVFNSLLISVAAMAIYTGYVFMPQHIMAILHYFEVVQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	65.3	Low	89.6	Confident	215 Å²	215	116.5 Å²	116.5	100%	1.059	63%	0.625	S	S	*	*				0	-61.4	0	-72.2	173.7	-151.3	0	0	110.7	L3 G4 D5	M1-L3 PolarHBondContact O-N 2.86Å; M1-L3 VanDerWaalsContact O-N 3.12Å; M1-G4 PolarHBondContact O-N 3.31Å; M1-G4 VanDerWaalsContact O-N 3.11Å; M1-D5 PolarHBondContact O-N 3.36Å
2	A	79.9	Confident	90.3	Very high	74 Å²	74	117.7 Å²	117.7	61%	0.612	61%	0.614	S	S	*	*	H	α-helix	trans	-49.8	-41.7	-176.1	0	0	0	0	0	117.1	G4 D5 C6	A2-G4 VanDerWaalsContact C-N 3.34Å; A2-G4 PolarHBondContact O-N 2.93Å; A2-D5 PolarHBondContact O-N 3.1Å; A2-C6 PolarHBondContact O-N 3.34Å; A2-C6 VanDerWaalsContact O-N 3.11Å; A2-C6 PolarHBondContact O-SG 3.15Å; A2-C6 VanDerWaalsContact O-SG 3.38Å
3	L	86.8	Confident	90.8	Very high	151 Å²	151	117.1 Å²	117.1	79%	0.791	60%	0.604	S	S	*	*	H	α-helix	trans	-68.8	-31.6	-176.5	-158.9	134.9	0	0	0	113.2	M1 W7	M1-L3 PolarHBondContact O-N 2.86Å; M1-L3 VanDerWaalsContact O-N 3.12Å; L3-W7 PolarHBondContact O-N 3.41Å; L3-W7 VanDerWaalsContact O-N 3.13Å
4	G	91.4	Very high	91.1	Very high	47 Å²	47	117.6 Å²	117.6	49%	0.485	60%	0.596	S	S	.	*	H	α-helix	trans	-70.8	-37.7	175.9	0	0	0	0	0	112.2	M1 A2 W7 K8	M1-G4 PolarHBondContact O-N 3.31Å; M1-G4 VanDerWaalsContact O-N 3.11Å; A2-G4 VanDerWaalsContact C-N 3.34Å; A2-G4 PolarHBondContact O-N 2.93Å; G4-W7 PolarHBondContact O-N 3.05Å; G4-K8 PolarHBondContact O-N 3.35Å
5	D	91.5	Very high	91.5	Very high	101 Å²	101	118.9 Å²	118.9	54%	0.54	59%	0.592	S	S	.	*	H	α-helix	trans	-67	-43.8	177.1	-59.6	-44.4	0	0	0	111.2	M1 A2 W7 K8 Q9	M1-D5 PolarHBondContact O-N 3.36Å; A2-D5 PolarHBondContact O-N 3.1Å; D5-W7 VanDerWaalsContact C-N 3.34Å; D5-W7 PolarHBondContact O-N 3.06Å; D5-K8 PolarHBondContact O-N 2.99Å; D5-Q9 PolarHBondContact O-N 3.04Å
6	C	94.4	Very high	91.9	Very high	83 Å²	83	116.8 Å²	116.8	56%	0.561	58%	0.58	S	S	*	*	H	α-helix	trans	-59.5	-43	173.8	-69	0	0	0	0	112.2	A2 Q9 L10	A2-C6 PolarHBondContact O-N 3.34Å; A2-C6 VanDerWaalsContact O-N 3.11Å; A2-C6 PolarHBondContact O-SG 3.15Å; A2-C6 VanDerWaalsContact O-SG 3.38Å; C6-Q9 PolarHBondContact O-N 2.95Å; C6-L10 WeakPolarHBondContact O-CB 3.38Å; C6-L10 PolarHBondContact O-N 3.24Å
7	W	94.8	Very high	92.1	Very high	175 Å²	175	113.9 Å²	113.9	66%	0.663	56%	0.561	S	S	*	*	H	α-helix	trans	-64.4	-41.7	178.7	-171.7	-97.1	0	0	0	112.3	L3 G4 D5 Q9 L10 S11	L3-W7 PolarHBondContact O-N 3.41Å; L3-W7 VanDerWaalsContact O-N 3.13Å; G4-W7 PolarHBondContact O-N 3.05Å; D5-W7 VanDerWaalsContact C-N 3.34Å; D5-W7 PolarHBondContact O-N 3.06Å; W7-Q9 VanDerWaalsContact C-N 3.31Å; W7-Q9 PolarHBondContact O-N 3.12Å; W7-L10 PolarHBondContact O-N 2.89Å; W7-S11 VanDerWaalsContact O-CB 3.31Å; W7-S11 WeakPolarHBondContact O-CB 3.43Å; W7-S11 PolarHBondContact O-N 2.63Å; W7-S11 PolarHBondContact O-OG 2.93Å
8	K	95.4	Very high	92.4	Very high	159 Å²	159	108.5 Å²	108.5	69%	0.691	54%	0.535	S	S	*	.	H	α-helix	trans	-60.6	-43.8	175.4	-177.1	179.4	176.9	-178	0	110.9	G4 D5 S11 W12	G4-K8 PolarHBondContact O-N 3.35Å; D5-K8 PolarHBondContact O-N 2.99Å; K8-S11 PolarHBondContact O-N 3.38Å; K8-W12 WeakPolarHBondContact O-CB 3.27Å; K8-W12 PolarHBondContact O-N 3.09Å
9	Q	95.6	Very high	92.6	Very high	116 Å²	116	106.4 Å²	106.4	54%	0.542	53%	0.525	S	S	.	.	H	α-helix	trans	-66.8	-43.9	179.3	-164.8	174.1	-13.3	0	0	111.9	D5 C6 W7 S11 W12 F13	D5-Q9 PolarHBondContact O-N 3.04Å; C6-Q9 PolarHBondContact O-N 2.95Å; W7-Q9 VanDerWaalsContact C-N 3.31Å; W7-Q9 PolarHBondContact O-N 3.12Å; Q9-S11 PolarHBondContact O-N 3.09Å; Q9-W12 WeakPolarHBondContact O-CB 3.44Å; Q9-W12 PolarHBondContact O-N 3.44Å; Q9-F13 HydrophobicContact CG-CD2 4.19Å; Q9-F13 HydrophobicContact CG-CE2 3.66Å; Q9-F13 HydrophobicContact CG-CZ 4.41Å; Q9-F13 WeakPolarHBondContact O-CD2 3.48Å; Q9-F13 PolarHBondContact O-N 3.21Å
10	L	95.5	Very high	92.9	Very high	108 Å²	108	107.3 Å²	107.3	57%	0.565	54%	0.537	S	S	*	.	H	α-helix	trans	-61.9	-43.1	175.5	-175.7	63.7	0	0	0	111.9	C6 W7 W12 F13 Y14	C6-L10 WeakPolarHBondContact O-CB 3.38Å; C6-L10 PolarHBondContact O-N 3.24Å; W7-L10 PolarHBondContact O-N 2.89Å; L10-W12 VanDerWaalsContact C-N 3.29Å; L10-W12 PolarHBondContact O-N 3.1Å; L10-F13 PolarHBondContact O-N 3.29Å; L10-Y14 PolarHBondContact O-N 3.28Å
11	S	95.1	Very high	93	Very high	52 Å²	52	104.9 Å²	104.9	36%	0.364	53%	0.528	S	S	.	.	H	α-helix	trans	-62.7	-37.7	176.8	-59.5	0	0	0	0	111.6	W7 K8 Q9 Y14 Y15	W7-S11 VanDerWaalsContact O-CB 3.31Å; W7-S11 WeakPolarHBondContact O-CB 3.43Å; W7-S11 PolarHBondContact O-N 2.63Å; W7-S11 PolarHBondContact O-OG 2.93Å; K8-S11 PolarHBondContact O-N 3.38Å; Q9-S11 PolarHBondContact O-N 3.09Å; S11-Y14 PolarHBondContact O-N 2.87Å; S11-Y15 WeakPolarHBondContact O-CB 3.49Å; S11-Y15 PolarHBondContact O-N 3.4Å
12	W	97.5	Very high	94.4	Very high	131 Å²	131	97 Å²	97	50%	0.496	50%	0.497	S	S	.	.	H	α-helix	trans	-65.2	-44.2	175.6	-178.8	83.7	0	0	0	112.2	K8 Q9 L10 Y14 Y15 Q16	K8-W12 WeakPolarHBondContact O-CB 3.27Å; K8-W12 PolarHBondContact O-N 3.09Å; Q9-W12 WeakPolarHBondContact O-CB 3.44Å; Q9-W12 PolarHBondContact O-N 3.44Å; L10-W12 VanDerWaalsContact C-N 3.29Å; L10-W12 PolarHBondContact O-N 3.1Å; W12-Y14 VanDerWaalsContact C-N 3.33Å; W12-Y14 PolarHBondContact O-N 3.4Å; W12-Y15 PolarHBondContact O-N 3.19Å; W12-Q16 HydrophobicContact CD2-CG 4.05Å; W12-Q16 HydrophobicContact CE3-CG 4.21Å; W12-Q16 HydrophobicContact CH2-CG 3.92Å; W12-Q16 VanDerWaalsContact CZ2-CD 3.44Å; W12-Q16 HydrophobicContact CZ2-CG 3.74Å; W12-Q16 HydrophobicContact CZ3-CG 4.15Å; W12-Q16 WeakPolarHBondContact O-CG 3.43Å; W12-Q16 PolarHBondContact O-N 2.81Å
13	F	97.6	Very high	95.2	Very high	110 Å²	110	93.6 Å²	93.6	48%	0.482	47%	0.468	S	S	.	.	H	α-helix	trans	-61.7	-41.6	174.8	-73.3	-59.1	0	0	0	112.3	Q9 L10 Y15 Q16 Y17	Q9-F13 HydrophobicContact CG-CD2 4.19Å; Q9-F13 HydrophobicContact CG-CE2 3.66Å; Q9-F13 HydrophobicContact CG-CZ 4.41Å; Q9-F13 WeakPolarHBondContact O-CD2 3.48Å; Q9-F13 PolarHBondContact O-N 3.21Å; L10-F13 PolarHBondContact O-N 3.29Å; F13-Y15 VanDerWaalsContact C-N 3.3Å; F13-Y15 PolarHBondContact O-N 3.01Å; F13-Q16 PolarHBondContact O-N 3.09Å; F13-Y17 WeakPolarHBondContact O-CB 3.31Å; F13-Y17 PolarHBondContact O-N 2.96Å
14	Y	95.3	Very high	95.6	Very high	125 Å²	125	92.4 Å²	92.4	49%	0.49	45%	0.454	S	S	.	.	H	α-helix	trans	-63.3	-36.9	175.8	-176.8	-114.3	0	0	0	112.6	L10 S11 W12 Y17 L18 R31	L10-Y14 PolarHBondContact O-N 3.28Å; S11-Y14 PolarHBondContact O-N 2.87Å; W12-Y14 VanDerWaalsContact C-N 3.33Å; W12-Y14 PolarHBondContact O-N 3.4Å; Y14-Y17 WeakPolarHBondContact O-CB 3.28Å; Y14-L18 HydrophobicContact CD1-CD1 4.43Å; Y14-L18 HydrophobicContact CE1-CD1 4.36Å; Y14-L18 PolarHBondContact O-N 3.28Å; Y14-L18 VanDerWaalsContact O-N 3.09Å; Y14-R31 PolarHBondContact OH-NH1 3.48Å; Y14-R31 PolarHBondContact OH-NH2 3.37Å
15	Y	96.3	Very high	95.8	Very high	136 Å²	136	96.8 Å²	96.8	53%	0.533	46%	0.464	S	S	.	.	H	α-helix	trans	-69.5	-40.6	175.3	-174.1	-107.4	0	0	0	112.5	S11 W12 F13 L18 L19	S11-Y15 WeakPolarHBondContact O-CB 3.49Å; S11-Y15 PolarHBondContact O-N 3.4Å; W12-Y15 PolarHBondContact O-N 3.19Å; F13-Y15 VanDerWaalsContact C-N 3.3Å; F13-Y15 PolarHBondContact O-N 3.01Å; Y15-L18 WeakPolarHBondContact O-CB 3.46Å; Y15-L18 PolarHBondContact O-N 3.47Å; Y15-L19 HydrophobicContact CD1-CD1 3.9Å; Y15-L19 HydrophobicContact CD1-CG 4.42Å; Y15-L19 HydrophobicContact CE1-CD1 3.32Å; Y15-L19 HydrophobicContact CE1-CG 4.03Å; Y15-L19 HydrophobicContact CE2-CG 4.46Å; Y15-L19 WeakPolarHBondContact O-CG 3.49Å; Y15-L19 PolarHBondContact O-N 3.36Å; Y15-L19 VanDerWaalsContact O-N 3.09Å
16	Q	97.8	Very high	96	Very high	86 Å²	86	95.2 Å²	95.2	40%	0.402	46%	0.455	S	S	.	.	H	α-helix	trans	-60.2	-46	172.6	-72.2	-109.9	-49.8	0	0	111.4	W12 F13 L18 L19 V20	W12-Q16 HydrophobicContact CD2-CG 4.05Å; W12-Q16 HydrophobicContact CE3-CG 4.21Å; W12-Q16 HydrophobicContact CH2-CG 3.92Å; W12-Q16 VanDerWaalsContact CZ2-CD 3.44Å; W12-Q16 HydrophobicContact CZ2-CG 3.74Å; W12-Q16 HydrophobicContact CZ3-CG 4.15Å; W12-Q16 WeakPolarHBondContact O-CG 3.43Å; W12-Q16 PolarHBondContact O-N 2.81Å; F13-Q16 PolarHBondContact O-N 3.09Å; Q16-L18 VanDerWaalsContact C-N 3.3Å; Q16-L18 PolarHBondContact O-N 2.91Å; Q16-L19 PolarHBondContact O-N 3.42Å; Q16-V20 WeakPolarHBondContact O-CB 3.48Å; Q16-V20 VanDerWaalsContact O-CG2 3.29Å; Q16-V20 WeakPolarHBondContact O-CG2 3.31Å; Q16-V20 PolarHBondContact O-N 2.98Å
17	Y	96.3	Very high	96.2	Very high	67 Å²	67	96.5 Å²	96.5	26%	0.263	45%	0.453	S	S	.	.	H	α-helix	trans	-53.6	-47.8	174.7	167.1	-108.2	0	0	0	111.7	F13 Y14 L19 T21 L23 N35	F13-Y17 WeakPolarHBondContact O-CB 3.31Å; F13-Y17 PolarHBondContact O-N 2.96Å; Y14-Y17 WeakPolarHBondContact O-CB 3.28Å; Y17-L19 PolarHBondContact O-N 3.13Å; Y17-T21 HydrophobicContact CD2-CG2 3.93Å; Y17-T21 HydrophobicContact CE2-CG2 3.73Å; Y17-T21 WeakPolarHBondContact O-CB 3.49Å; Y17-T21 WeakPolarHBondContact O-CG2 3.29Å; Y17-T21 PolarHBondContact O-N 3.45Å; Y17-T21 VanDerWaalsContact O-N 3.09Å; Y17-T21 PolarHBondContact O-OG1 2.6Å; Y17-L23 HydrophobicContact CE1-CD1 3.62Å; Y17-L23 HydrophobicContact CE2-CD1 4.45Å; Y17-L23 VanDerWaalsContact OH-CD1 3.31Å; Y17-L23 WeakPolarHBondContact OH-CD1 3.34Å; Y17-N35 PolarHBondContact OH-OD1 3.42Å
18	L	96	Very high	96.2	Very high	17 Å²	17	93.3 Å²	93.3	9%	0.089	46%	0.455	C	S	.	.	H	α-helix	trans	-57.6	-45	177.6	-88.4	175.3	0	0	0	114.2	Y14 Y15 Q16 A22 L23 Y24 R31	Y14-L18 HydrophobicContact CD1-CD1 4.43Å; Y14-L18 HydrophobicContact CE1-CD1 4.36Å; Y14-L18 PolarHBondContact O-N 3.28Å; Y14-L18 VanDerWaalsContact O-N 3.09Å; Y15-L18 WeakPolarHBondContact O-CB 3.46Å; Y15-L18 PolarHBondContact O-N 3.47Å; Q16-L18 VanDerWaalsContact C-N 3.3Å; Q16-L18 PolarHBondContact O-N 2.91Å; L18-A22 CarbonylContact O-C 3.48Å; L18-A22 PolarHBondContact O-N 2.89Å; L18-L23 HydrophobicContact CD2-CB 3.58Å; L18-L23 PolarHBondContact O-N 3.09Å; L18-Y24 PolarHBondContact O-N 3.44Å; L18-R31 VanDerWaalsContact CD1-NH2 3.34Å; L18-R31 VanDerWaalsContact CG-CZ 3.46Å
19	L	97.4	Very high	96.2	Very high	68 Å²	68	93.2 Å²	93.2	36%	0.356	45%	0.45	S	S	.	.	H	α-helix	trans	-72	-47.7	-177.7	-69.8	-178.6	0	0	0	111.3	Y15 Q16 Y17 T21 A22 Y24	Y15-L19 HydrophobicContact CD1-CD1 3.9Å; Y15-L19 HydrophobicContact CD1-CG 4.42Å; Y15-L19 HydrophobicContact CE1-CD1 3.32Å; Y15-L19 HydrophobicContact CE1-CG 4.03Å; Y15-L19 HydrophobicContact CE2-CG 4.46Å; Y15-L19 WeakPolarHBondContact O-CG 3.49Å; Y15-L19 PolarHBondContact O-N 3.36Å; Y15-L19 VanDerWaalsContact O-N 3.09Å; Q16-L19 PolarHBondContact O-N 3.42Å; Y17-L19 PolarHBondContact O-N 3.13Å; L19-T21 VanDerWaalsContact C-N 3.31Å; L19-T21 PolarHBondContact O-N 3.25Å; L19-A22 PolarHBondContact O-N 3.19Å; L19-A22 VanDerWaalsContact O-N 3.1Å; L19-Y24 HydrophobicContact CD2-CD1 3.73Å; L19-Y24 HydrophobicContact CD2-CD2 4.49Å; L19-Y24 HydrophobicContact CD2-CE1 4.09Å; L19-Y24 HydrophobicContact CD2-CG 3.93Å
20	V	97.5	Very high	96.3	Very high	124 Å²	124	91.2 Å²	91.2	75%	0.752	44%	0.441	S	S	*	.	H	α-helix	trans	-64.2	-36.9	-176.3	172.3	0	0	0	0	111.7	Q16 A22	Q16-V20 WeakPolarHBondContact O-CB 3.48Å; Q16-V20 VanDerWaalsContact O-CG2 3.29Å; Q16-V20 WeakPolarHBondContact O-CG2 3.31Å; Q16-V20 PolarHBondContact O-N 2.98Å; V20-A22 VanDerWaalsContact C-N 3.31Å
21	T	95	Very high	96.4	Very high	58 Å²	58	87.9 Å²	87.9	36%	0.356	42%	0.421	S	S	.	.	T	Hydrogen-bonded Turn	trans	-88.7	3	178.1	59.6	0	0	0	0	113.5	Y17 L19 L23	Y17-T21 HydrophobicContact CD2-CG2 3.93Å; Y17-T21 HydrophobicContact CE2-CG2 3.73Å; Y17-T21 WeakPolarHBondContact O-CB 3.49Å; Y17-T21 WeakPolarHBondContact O-CG2 3.29Å; Y17-T21 PolarHBondContact O-N 3.45Å; Y17-T21 VanDerWaalsContact O-N 3.09Å; Y17-T21 PolarHBondContact O-OG1 2.6Å; L19-T21 VanDerWaalsContact C-N 3.31Å; L19-T21 PolarHBondContact O-N 3.25Å; T21-L23 PolarHBondContact O-N 2.94Å; T21-L23 VanDerWaalsContact OG1-CD1 3.28Å; T21-L23 WeakPolarHBondContact OG1-CD1 3.46Å; T21-L23 VanDerWaalsContact OG1-CG 3.27Å; T21-L23 WeakPolarHBondContact OG1-CG 3.44Å
22	A	95.9	Very high	96.4	Very high	48 Å²	48	89.9 Å²	89.9	40%	0.397	43%	0.431	S	S	.	.	T	Hydrogen-bonded Turn	trans	55.8	13.4	-172.3	0	0	0	0	0	115.1	L18 L19 V20 Y24 M25	L18-A22 CarbonylContact O-C 3.48Å; L18-A22 PolarHBondContact O-N 2.89Å; L19-A22 PolarHBondContact O-N 3.19Å; L19-A22 VanDerWaalsContact O-N 3.1Å; V20-A22 VanDerWaalsContact C-N 3.31Å; A22-Y24 PolarHBondContact O-N 3.36Å; A22-Y24 VanDerWaalsContact O-N 3.1Å; A22-M25 PolarHBondContact O-N 3.28Å
23	L	95.6	Very high	96.4	Very high	4 Å²	4	87.4 Å²	87.4	2%	0.021	43%	0.43	C	S	.	.	G	3₁₀ helix	trans	-64.8	-13.8	178.6	-77	174.9	0	0	0	114.1	Y17 L18 T21 M25 L26 F34	Y17-L23 HydrophobicContact CE1-CD1 3.62Å; Y17-L23 HydrophobicContact CE2-CD1 4.45Å; Y17-L23 VanDerWaalsContact OH-CD1 3.31Å; Y17-L23 WeakPolarHBondContact OH-CD1 3.34Å; L18-L23 HydrophobicContact CD2-CB 3.58Å; L18-L23 PolarHBondContact O-N 3.09Å; T21-L23 PolarHBondContact O-N 2.94Å; T21-L23 VanDerWaalsContact OG1-CD1 3.28Å; T21-L23 WeakPolarHBondContact OG1-CD1 3.46Å; T21-L23 VanDerWaalsContact OG1-CG 3.27Å; T21-L23 WeakPolarHBondContact OG1-CG 3.44Å; L23-M25 PolarHBondContact O-N 3.21Å; L23-L26 HydrophobicContact CD2-CD1 4.5Å; L23-L26 HydrophobicContact CD2-CD2 4Å; L23-L26 PolarHBondContact O-N 2.97Å; L23-F34 HydrophobicContact CD1-CD1 3.87Å; L23-F34 HydrophobicContact CD1-CE1 4.12Å; L23-F34 HydrophobicContact CD2-CB 4.08Å; L23-F34 HydrophobicContact CD2-CD1 3.53Å; L23-F34 HydrophobicContact CD2-CE1 4.06Å; L23-F34 HydrophobicContact CD2-CG 3.8Å; L23-F34 HydrophobicContact CG-CD1 4.22Å; L23-F34 HydrophobicContact CG-CE1 4.42Å
24	Y	95.1	Very high	96.4	Very high	126 Å²	126	86.6 Å²	86.6	49%	0.494	43%	0.426	S	S	.	.	G	3₁₀ helix	trans	-68.4	-20	179.1	82.5	-88.4	0	0	0	113.2	L18 L19 A22	L18-Y24 PolarHBondContact O-N 3.44Å; L19-Y24 HydrophobicContact CD2-CD1 3.73Å; L19-Y24 HydrophobicContact CD2-CD2 4.49Å; L19-Y24 HydrophobicContact CD2-CE1 4.09Å; L19-Y24 HydrophobicContact CD2-CG 3.93Å; A22-Y24 PolarHBondContact O-N 3.36Å; A22-Y24 VanDerWaalsContact O-N 3.1Å
25	M	96.7	Very high	96.4	Very high	139 Å²	139	82 Å²	82	69%	0.685	41%	0.411	S	S	*	.	G	3₁₀ helix	trans	-82.3	-17.2	179	-63.6	-172.6	176.8	0	0	113.2	A22 L23	A22-M25 PolarHBondContact O-N 3.28Å; L23-M25 PolarHBondContact O-N 3.21Å
26	L	95.9	Very high	96.5	Very high	67 Å²	67	78.8 Å²	78.8	35%	0.351	41%	0.408	S	S	.	.	S	Bend	trans	-82.9	153.3	-175.4	-81.2	73.3	0	0	0	111.2	L23 E30 R31	L23-L26 HydrophobicContact CD2-CD1 4.5Å; L23-L26 HydrophobicContact CD2-CD2 4Å; L23-L26 PolarHBondContact O-N 2.97Å; L26-E30 HydrophobicContact CB-CB 4.16Å; L26-E30 HydrophobicContact CD2-CB 4.02Å; L26-E30 HydrophobicContact CG-CB 4.4Å; L26-R31 HydrophobicContact CB-CB 4.43Å
27	E	97.1	Very high	96.5	Very high	110 Å²	110	79.5 Å²	79.5	51%	0.514	41%	0.414	S	S	.	.			trans	-64.9	154.9	171.8	-63.4	-171	121.6	0	0	111	W29 E30 R31	E27-W29 PolarHBondContact O-N 2.87Å; E27-W29 VanDerWaalsContact O-N 3.12Å; E27-W29 PolarHBondContact OE2-NE1 2.92Å; E27-E30 HydrophobicContact CB-CG 4.1Å; E27-E30 PolarHBondContact N-OE2 3.42Å; E27-E30 PolarHBondContact O-N 3.25Å; E27-E30 VanDerWaalsContact O-N 3.15Å; E27-R31 WeakPolarHBondContact O-CB 3.32Å; E27-R31 PolarHBondContact O-N 2.96Å
28	P	94.9	Very high	96.5	Very high	109 Å²	109	80 Å²	80	71%	0.708	42%	0.42	S	S	*	.	H	α-helix	trans	-55.8	-35	-176.7	-27.2	35.1	0	0	0	114.2	T32	P28-T32 PolarHBondContact O-N 2.88Å; P28-T32 PolarHBondContact O-OG1 2.95Å
29	W	97.2	Very high	96.6	Very high	157 Å²	157	84.6 Å²	84.6	60%	0.595	44%	0.444	S	S	*	.	H	α-helix	trans	-75.2	-43.2	179.5	81.3	-91.9	0	0	0	111.5	E27 R31 T32 V33	E27-W29 PolarHBondContact O-N 2.87Å; E27-W29 VanDerWaalsContact O-N 3.12Å; E27-W29 PolarHBondContact OE2-NE1 2.92Å; W29-R31 VanDerWaalsContact C-N 3.3Å; W29-R31 PolarHBondContact O-N 3.47Å; W29-T32 WeakPolarHBondContact O-CB 3.4Å; W29-T32 PolarHBondContact O-N 2.92Å; W29-V33 HydrophobicContact CE3-CG2 3.96Å; W29-V33 HydrophobicContact CZ3-CG2 4Å; W29-V33 PolarHBondContact O-N 2.88Å
30	E	97.5	Very high	96.6	Very high	74 Å²	74	84.2 Å²	84.2	35%	0.346	45%	0.447	S	S	.	.	H	α-helix	trans	-60.2	-44.1	177.7	-62.6	179.2	134.8	0	0	110.7	L26 E27 T32 V33 F34	L26-E30 HydrophobicContact CB-CB 4.16Å; L26-E30 HydrophobicContact CD2-CB 4.02Å; L26-E30 HydrophobicContact CG-CB 4.4Å; E27-E30 HydrophobicContact CB-CG 4.1Å; E27-E30 PolarHBondContact N-OE2 3.42Å; E27-E30 PolarHBondContact O-N 3.25Å; E27-E30 VanDerWaalsContact O-N 3.15Å; E30-T32 VanDerWaalsContact C-N 3.27Å; E30-T32 PolarHBondContact O-N 3.27Å; E30-V33 PolarHBondContact O-N 3Å; E30-F34 PolarHBondContact O-N 3.48Å
31	R	96.4	Very high	96.7	Very high	37 Å²	37	82.6 Å²	82.6	14%	0.14	44%	0.438	C	S	.	.	H	α-helix	trans	-59.3	-38.9	175.1	-178.9	-174.4	171.1	-174.6	8.1	112.2	Y14 L18 L26 E27 W29 F34 N35	Y14-R31 PolarHBondContact OH-NH1 3.48Å; Y14-R31 PolarHBondContact OH-NH2 3.37Å; L18-R31 VanDerWaalsContact CD1-NH2 3.34Å; L18-R31 VanDerWaalsContact CG-CZ 3.46Å; L26-R31 HydrophobicContact CB-CB 4.43Å; E27-R31 WeakPolarHBondContact O-CB 3.32Å; E27-R31 PolarHBondContact O-N 2.96Å; W29-R31 VanDerWaalsContact C-N 3.3Å; W29-R31 PolarHBondContact O-N 3.47Å; R31-F34 PolarHBondContact O-N 3.42Å; R31-N35 WeakPolarHBondContact O-CB 3.42Å; R31-N35 VanDerWaalsContact O-CG 3.27Å; R31-N35 PolarHBondContact O-N 3.32Å; R31-N35 PolarHBondContact O-ND2 3.28Å; R31-N35 VanDerWaalsContact O-ND2 3.13Å
32	T	95.9	Very high	96.8	Very high	94 Å²	94	81.9 Å²	81.9	58%	0.577	44%	0.438	S	S	*	.	H	α-helix	trans	-66.5	-40.8	177.9	-57.3	0	0	0	0	111	P28 W29 E30 S36	P28-T32 PolarHBondContact O-N 2.88Å; P28-T32 PolarHBondContact O-OG1 2.95Å; W29-T32 WeakPolarHBondContact O-CB 3.4Å; W29-T32 PolarHBondContact O-N 2.92Å; E30-T32 VanDerWaalsContact C-N 3.27Å; E30-T32 PolarHBondContact O-N 3.27Å; T32-S36 WeakPolarHBondContact O-CB 3.48Å; T32-S36 PolarHBondContact O-N 2.83Å; T32-S36 PolarHBondContact O-OG 2.97Å
33	V	97.8	Very high	96.9	Very high	80 Å²	80	81.8 Å²	81.8	49%	0.485	44%	0.437	S	S	.	.	H	α-helix	trans	-64.5	-43.5	174.6	175.2	0	0	0	0	111.5	W29 E30 S36 L37	W29-V33 HydrophobicContact CE3-CG2 3.96Å; W29-V33 HydrophobicContact CZ3-CG2 4Å; W29-V33 PolarHBondContact O-N 2.88Å; E30-V33 PolarHBondContact O-N 3Å; V33-S36 PolarHBondContact O-N 3.45Å; V33-S36 PolarHBondContact O-OG 3.24Å; V33-L37 PolarHBondContact O-N 3.49Å; V33-L37 VanDerWaalsContact O-N 3.09Å
34	F	96.7	Very high	97.1	Very high	92 Å²	92	87 Å²	87	40%	0.404	46%	0.462	S	S	.	.	H	α-helix	trans	-63.1	-46.6	177.7	-173.9	-87.8	0	0	0	112	L23 E30 R31 S36 L37 L38	L23-F34 HydrophobicContact CD1-CD1 3.87Å; L23-F34 HydrophobicContact CD1-CE1 4.12Å; L23-F34 HydrophobicContact CD2-CB 4.08Å; L23-F34 HydrophobicContact CD2-CD1 3.53Å; L23-F34 HydrophobicContact CD2-CE1 4.06Å; L23-F34 HydrophobicContact CD2-CG 3.8Å; L23-F34 HydrophobicContact CG-CD1 4.22Å; L23-F34 HydrophobicContact CG-CE1 4.42Å; E30-F34 PolarHBondContact O-N 3.48Å; R31-F34 PolarHBondContact O-N 3.42Å; F34-S36 VanDerWaalsContact C-N 3.33Å; F34-S36 PolarHBondContact O-N 2.78Å; F34-L37 PolarHBondContact O-N 3.37Å; F34-L38 HydrophobicContact CE1-CD1 4.05Å; F34-L38 PolarHBondContact O-N 3.34Å
35	N	96.1	Very high	97.2	Very high	30 Å²	30	83.8 Å²	83.8	16%	0.16	46%	0.462	C	S	.	.	H	α-helix	trans	-63.4	-37.9	178.7	-72.9	-32.3	0	0	0	112.2	Y17 R31 L37 L38 I39	Y17-N35 PolarHBondContact OH-OD1 3.42Å; R31-N35 WeakPolarHBondContact O-CB 3.42Å; R31-N35 VanDerWaalsContact O-CG 3.27Å; R31-N35 PolarHBondContact O-N 3.32Å; R31-N35 PolarHBondContact O-ND2 3.28Å; R31-N35 VanDerWaalsContact O-ND2 3.13Å; N35-L37 VanDerWaalsContact C-N 3.35Å; N35-L38 PolarHBondContact O-N 3.44Å; N35-I39 WeakPolarHBondContact O-CB 3.23Å; N35-I39 VanDerWaalsContact O-CG1 3.24Å; N35-I39 WeakPolarHBondContact O-CG1 3.24Å; N35-I39 PolarHBondContact O-N 2.87Å
36	S	97.6	Very high	97.2	Very high	68 Å²	68	83.1 Å²	83.1	48%	0.476	46%	0.46	S	S	.	.	H	α-helix	trans	-66.7	-38.5	177.7	69.5	0	0	0	0	111.7	T32 V33 F34 S40	T32-S36 WeakPolarHBondContact O-CB 3.48Å; T32-S36 PolarHBondContact O-N 2.83Å; T32-S36 PolarHBondContact O-OG 2.97Å; V33-S36 PolarHBondContact O-N 3.45Å; V33-S36 PolarHBondContact O-OG 3.24Å; F34-S36 VanDerWaalsContact C-N 3.33Å; F34-S36 PolarHBondContact O-N 2.78Å; S36-S40 WeakPolarHBondContact O-CB 3.46Å; S36-S40 PolarHBondContact O-N 3.04Å; S36-S40 PolarHBondContact O-OG 3.42Å
37	L	97.7	Very high	97.3	Very high	101 Å²	101	86.6 Å²	86.6	53%	0.529	47%	0.469	S	S	.	.	H	α-helix	trans	-65.7	-42.5	173	-178.5	137.8	0	0	0	112.1	V33 F34 N35 I39 S40 V41	V33-L37 PolarHBondContact O-N 3.49Å; V33-L37 VanDerWaalsContact O-N 3.09Å; F34-L37 PolarHBondContact O-N 3.37Å; N35-L37 VanDerWaalsContact C-N 3.35Å; L37-I39 VanDerWaalsContact C-N 3.35Å; L37-I39 PolarHBondContact O-N 2.88Å; L37-S40 WeakPolarHBondContact CA-OG 3.5Å; L37-S40 PolarHBondContact O-N 3.04Å; L37-S40 PolarHBondContact O-OG 2.91Å; L37-V41 HydrophobicContact CD2-CG2 4.42Å; L37-V41 VanDerWaalsContact O-CG2 3.31Å; L37-V41 WeakPolarHBondContact O-CG2 3.31Å; L37-V41 PolarHBondContact O-N 2.79Å
38	L	96.8	Very high	97.3	Very high	76 Å²	76	84.2 Å²	84.2	40%	0.398	46%	0.462	S	S	.	.	H	α-helix	trans	-62.2	-44.2	176.9	-174	146.9	0	0	0	111.4	F34 N35 V41 A42	F34-L38 HydrophobicContact CE1-CD1 4.05Å; F34-L38 PolarHBondContact O-N 3.34Å; N35-L38 PolarHBondContact O-N 3.44Å; L38-V41 PolarHBondContact O-N 3.47Å; L38-A42 WeakPolarHBondContact O-CB 3.47Å; L38-A42 PolarHBondContact O-N 3.48Å
39	I	97.9	Very high	97.4	Very high	114 Å²	114	80.2 Å²	80.2	59%	0.585	44%	0.44	S	S	*	.	H	α-helix	trans	-64	-41.1	176.4	-69.3	167.1	0	0	0	110.7	N35 L37 A42 A43	N35-I39 WeakPolarHBondContact O-CB 3.23Å; N35-I39 VanDerWaalsContact O-CG1 3.24Å; N35-I39 WeakPolarHBondContact O-CG1 3.24Å; N35-I39 PolarHBondContact O-N 2.87Å; L37-I39 VanDerWaalsContact C-N 3.35Å; L37-I39 PolarHBondContact O-N 2.88Å; I39-A42 PolarHBondContact O-N 3.47Å; I39-A43 VanDerWaalsContact O-CB 3.23Å; I39-A43 WeakPolarHBondContact O-CB 3.36Å; I39-A43 PolarHBondContact O-N 2.84Å
40	S	98.3	Very high	97.4	Very high	61 Å²	61	81.5 Å²	81.5	43%	0.427	45%	0.447	S	S	.	.	H	α-helix	trans	-66.1	-42.6	179.7	72.9	0	0	0	0	111.9	S36 L37 A43 M44	S36-S40 WeakPolarHBondContact O-CB 3.46Å; S36-S40 PolarHBondContact O-N 3.04Å; S36-S40 PolarHBondContact O-OG 3.42Å; L37-S40 WeakPolarHBondContact CA-OG 3.5Å; L37-S40 PolarHBondContact O-N 3.04Å; L37-S40 PolarHBondContact O-OG 2.91Å; S40-A43 PolarHBondContact O-N 3.35Å; S40-M44 WeakPolarHBondContact O-CB 3.46Å; S40-M44 VanDerWaalsContact O-CG 3.32Å; S40-M44 WeakPolarHBondContact O-CG 3.14Å; S40-M44 PolarHBondContact O-N 2.82Å
41	V	98.2	Very high	97.4	Very high	90 Å²	90	81 Å²	81	55%	0.545	45%	0.448	S	S	.	.	H	α-helix	trans	-62.7	-46.3	175.1	172.6	0	0	0	0	110.8	L37 L38 A43 M44 A45	L37-V41 HydrophobicContact CD2-CG2 4.42Å; L37-V41 VanDerWaalsContact O-CG2 3.31Å; L37-V41 WeakPolarHBondContact O-CG2 3.31Å; L37-V41 PolarHBondContact O-N 2.79Å; L38-V41 PolarHBondContact O-N 3.47Å; V41-A43 PolarHBondContact O-N 2.88Å; V41-M44 PolarHBondContact O-N 3.45Å; V41-A45 WeakPolarHBondContact O-CB 3.3Å; V41-A45 PolarHBondContact O-N 2.9Å
42	A	98.1	Very high	97.3	Very high	43 Å²	43	84.7 Å²	84.7	36%	0.355	47%	0.466	S	S	.	.	H	α-helix	trans	-62	-43.2	177.1	0	0	0	0	0	111.8	L38 I39 M44 A45 I46	L38-A42 WeakPolarHBondContact O-CB 3.47Å; L38-A42 PolarHBondContact O-N 3.48Å; I39-A42 PolarHBondContact O-N 3.47Å; A42-M44 VanDerWaalsContact C-N 3.34Å; A42-M44 PolarHBondContact O-N 3.41Å; A42-A45 PolarHBondContact O-N 3.3Å; A42-I46 VanDerWaalsContact O-CG1 3.29Å; A42-I46 WeakPolarHBondContact O-CG1 3.44Å; A42-I46 PolarHBondContact O-N 2.99Å
43	A	98.3	Very high	97.3	Very high	46 Å²	46	85.6 Å²	85.6	38%	0.38	47%	0.465	S	S	.	.	H	α-helix	trans	-62	-41.7	176.1	0	0	0	0	0	111.6	I39 S40 V41 I46 Y47	I39-A43 VanDerWaalsContact O-CB 3.23Å; I39-A43 WeakPolarHBondContact O-CB 3.36Å; I39-A43 PolarHBondContact O-N 2.84Å; S40-A43 PolarHBondContact O-N 3.35Å; V41-A43 PolarHBondContact O-N 2.88Å; A43-I46 PolarHBondContact O-N 3.3Å; A43-Y47 VanDerWaalsContact O-CB 3.22Å; A43-Y47 WeakPolarHBondContact O-CB 3.39Å; A43-Y47 PolarHBondContact O-N 3.02Å
44	M	98.2	Very high	97.1	Very high	113 Å²	113	84.9 Å²	84.9	56%	0.557	46%	0.462	S	S	*	.	H	α-helix	trans	-65.1	-41	174.6	-72.8	-59.7	102.6	0	0	112.1	S40 V41 A42 Y47 T48	S40-M44 WeakPolarHBondContact O-CB 3.46Å; S40-M44 VanDerWaalsContact O-CG 3.32Å; S40-M44 WeakPolarHBondContact O-CG 3.14Å; S40-M44 PolarHBondContact O-N 2.82Å; V41-M44 PolarHBondContact O-N 3.45Å; A42-M44 VanDerWaalsContact C-N 3.34Å; A42-M44 PolarHBondContact O-N 3.41Å; M44-Y47 PolarHBondContact O-N 3.48Å; M44-T48 WeakPolarHBondContact O-CB 3.22Å; M44-T48 VanDerWaalsContact O-CG2 3.3Å; M44-T48 WeakPolarHBondContact O-CG2 3.29Å; M44-T48 PolarHBondContact O-N 3.24Å; M44-T48 PolarHBondContact O-OG1 3.49Å
45	A	97.8	Very high	97	Very high	59 Å²	59	87.5 Å²	87.5	49%	0.488	48%	0.475	S	S	.	.	H	α-helix	trans	-62.7	-42.8	175.7	0	0	0	0	0	111.8	V41 A42 T48 G49	V41-A45 WeakPolarHBondContact O-CB 3.3Å; V41-A45 PolarHBondContact O-N 2.9Å; A42-A45 PolarHBondContact O-N 3.3Å; A45-T48 WeakPolarHBondContact CA-OG1 3.39Å; A45-T48 PolarHBondContact O-OG1 3.25Å; A45-T48 VanDerWaalsContact O-OG1 3.04Å; A45-G49 PolarHBondContact O-N 2.8Å
46	I	98.1	Very high	96.9	Very high	125 Å²	125	91.3 Å²	91.3	64%	0.641	49%	0.492	S	S	*	.	H	α-helix	trans	-65.6	-45	175.4	-66.9	165.5	0	0	0	110.6	A42 A43 G49 Y50	A42-I46 VanDerWaalsContact O-CG1 3.29Å; A42-I46 WeakPolarHBondContact O-CG1 3.44Å; A42-I46 PolarHBondContact O-N 2.99Å; A43-I46 PolarHBondContact O-N 3.3Å; I46-G49 PolarHBondContact O-N 3.44Å; I46-Y50 VanDerWaalsContact O-CB 3.32Å; I46-Y50 WeakPolarHBondContact O-CB 3.45Å; I46-Y50 PolarHBondContact O-N 3.39Å
47	Y	97.8	Very high	96.7	Very high	140 Å²	140	91.7 Å²	91.7	55%	0.549	49%	0.488	S	S	.	.	H	α-helix	trans	-61.5	-50.2	179.8	173.8	-103.6	0	0	0	111.5	A43 M44 G49 Y50 V51	A43-Y47 VanDerWaalsContact O-CB 3.22Å; A43-Y47 WeakPolarHBondContact O-CB 3.39Å; A43-Y47 PolarHBondContact O-N 3.02Å; M44-Y47 PolarHBondContact O-N 3.48Å; Y47-G49 PolarHBondContact O-N 2.78Å; Y47-Y50 PolarHBondContact O-N 2.99Å; Y47-V51 HydrophobicContact CD2-CG2 4.1Å; Y47-V51 HydrophobicContact CE1-CG2 4.14Å; Y47-V51 HydrophobicContact CE2-CG2 3.69Å; Y47-V51 WeakPolarHBondContact O-CB 3.3Å; Y47-V51 VanDerWaalsContact O-CG2 3.3Å; Y47-V51 WeakPolarHBondContact O-CG2 3.45Å; Y47-V51 PolarHBondContact O-N 3.03Å
48	T	96.9	Very high	96.6	Very high	60 Å²	60	92.4 Å²	92.4	37%	0.368	49%	0.49	S	S	.	.	H	α-helix	trans	-62.5	-43.2	176.5	52.8	0	0	0	0	111.3	M44 A45 Y50 V51 F52	M44-T48 WeakPolarHBondContact O-CB 3.22Å; M44-T48 VanDerWaalsContact O-CG2 3.3Å; M44-T48 WeakPolarHBondContact O-CG2 3.29Å; M44-T48 PolarHBondContact O-N 3.24Å; M44-T48 PolarHBondContact O-OG1 3.49Å; A45-T48 WeakPolarHBondContact CA-OG1 3.39Å; A45-T48 PolarHBondContact O-OG1 3.25Å; A45-T48 VanDerWaalsContact O-OG1 3.04Å; T48-Y50 PolarHBondContact O-N 3.42Å; T48-V51 PolarHBondContact O-N 3.03Å; T48-F52 HydrophobicContact CG2-CD2 4.45Å; T48-F52 HydrophobicContact CG2-CE2 4.13Å; T48-F52 WeakPolarHBondContact O-CB 3.01Å; T48-F52 WeakPolarHBondContact O-CD2 3.21Å; T48-F52 PolarHBondContact O-N 2.88Å
49	G	96.4	Very high	96.4	Very high	24 Å²	24	91.8 Å²	91.8	25%	0.247	50%	0.496	C	S	.	.	H	α-helix	trans	-55.8	-49	172.7	0	0	0	0	0	111.9	A45 I46 Y47 V51 M53	A45-G49 PolarHBondContact O-N 2.8Å; I46-G49 PolarHBondContact O-N 3.44Å; Y47-G49 PolarHBondContact O-N 2.78Å; G49-V51 PolarHBondContact O-N 3.01Å; G49-M53 WeakPolarHBondContact O-CA 3.32Å; G49-M53 WeakPolarHBondContact O-CB 3.45Å; G49-M53 WeakPolarHBondContact O-CG 3.2Å; G49-M53 PolarHBondContact O-N 3.09Å
50	Y	96.8	Very high	96.3	Very high	184 Å²	184	90.8 Å²	90.8	72%	0.722	49%	0.49	S	S	*	.	H	α-helix	trans	-64.8	-39.7	179.5	179.4	-99.4	0	0	0	113.2	I46 Y47 T48 P54	I46-Y50 VanDerWaalsContact O-CB 3.32Å; I46-Y50 WeakPolarHBondContact O-CB 3.45Å; I46-Y50 PolarHBondContact O-N 3.39Å; Y47-Y50 PolarHBondContact O-N 2.99Å; T48-Y50 PolarHBondContact O-N 3.42Å; Y50-P54 WeakPolarHBondContact O-CD 3.5Å; Y50-P54 WeakPolarHBondContact O-CG 3.15Å
51	V	97.4	Very high	96.1	Very high	63 Å²	63	90.3 Å²	90.3	38%	0.382	48%	0.483	S	S	.	.	H	α-helix	trans	-74.7	-43	-178.9	171.1	0	0	0	0	111.6	Y47 T48 G49	Y47-V51 HydrophobicContact CD2-CG2 4.1Å; Y47-V51 HydrophobicContact CE1-CG2 4.14Å; Y47-V51 HydrophobicContact CE2-CG2 3.69Å; Y47-V51 WeakPolarHBondContact O-CB 3.3Å; Y47-V51 VanDerWaalsContact O-CG2 3.3Å; Y47-V51 WeakPolarHBondContact O-CG2 3.45Å; Y47-V51 PolarHBondContact O-N 3.03Å; T48-V51 PolarHBondContact O-N 3.03Å; G49-V51 PolarHBondContact O-N 3.01Å
52	F	95.4	Very high	95.9	Very high	115 Å²	115	91.9 Å²	91.9	50%	0.504	48%	0.484	S	S	.	.	H	α-helix	trans	-94	-31	-172.8	-61.6	-65.4	0	0	0	113.7	T48 P54 Q55 H56	T48-F52 HydrophobicContact CG2-CD2 4.45Å; T48-F52 HydrophobicContact CG2-CE2 4.13Å; T48-F52 WeakPolarHBondContact O-CB 3.01Å; T48-F52 WeakPolarHBondContact O-CD2 3.21Å; T48-F52 PolarHBondContact O-N 2.88Å; F52-P54 VanDerWaalsContact C-CD 3.48Å; F52-Q55 PolarHBondContact O-N 3.23Å; F52-H56 PolarHBondContact O-CD2 2.85Å; F52-H56 PolarHBondContact O-N 3.46Å
53	M	94.9	Very high	95.7	Very high	114 Å²	114	98.6 Å²	98.6	56%	0.562	50%	0.501	S	S	*	.	H	α-helix	trans	-57.1	-43.8	-179.9	-88.3	-135	-116.9	0	0	114.4	G49 Q55 H56 I57	G49-M53 WeakPolarHBondContact O-CA 3.32Å; G49-M53 WeakPolarHBondContact O-CB 3.45Å; G49-M53 WeakPolarHBondContact O-CG 3.2Å; G49-M53 PolarHBondContact O-N 3.09Å; M53-Q55 VanDerWaalsContact C-N 3.26Å; M53-Q55 PolarHBondContact O-N 3.44Å; M53-H56 CarbonylContact O-C 3.58Å; M53-H56 PolarHBondContact O-N 3.43Å; M53-I57 HydrophobicContact CB-CD1 4.04Å; M53-I57 WeakPolarHBondContact O-CB 3.01Å; M53-I57 VanDerWaalsContact O-CG1 3.29Å; M53-I57 WeakPolarHBondContact O-CG1 3.41Å; M53-I57 PolarHBondContact O-N 3.38Å; M53-I57 HydrophobicContact SD-CD1 4Å
54	P	94.6	Very high	95.5	Very high	64 Å²	64	102.9 Å²	102.9	42%	0.416	51%	0.512	S	S	.	.	H	α-helix	trans	-57.8	-41	-173.8	-26.7	35.1	0	0	0	112.6	Y50 F52 I57 M58	Y50-P54 WeakPolarHBondContact O-CD 3.5Å; Y50-P54 WeakPolarHBondContact O-CG 3.15Å; F52-P54 VanDerWaalsContact C-CD 3.48Å; P54-I57 PolarHBondContact O-N 3.11Å; P54-M58 WeakPolarHBondContact O-CB 3.44Å; P54-M58 VanDerWaalsContact O-CG 3.27Å; P54-M58 WeakPolarHBondContact O-CG 3.48Å; P54-M58 PolarHBondContact O-N 3.34Å
55	Q	93.7	Very high	95.1	Very high	147 Å²	147	105.8 Å²	105.8	69%	0.687	52%	0.524	S	S	*	.	H	α-helix	trans	-64.8	-43.3	176.2	-175.4	179.4	-27.4	0	0	111.5	F52 M53 M58 A59	F52-Q55 PolarHBondContact O-N 3.23Å; M53-Q55 VanDerWaalsContact C-N 3.26Å; M53-Q55 PolarHBondContact O-N 3.44Å; Q55-M58 PolarHBondContact O-N 3.22Å; Q55-A59 WeakPolarHBondContact O-CB 3.48Å; Q55-A59 PolarHBondContact O-N 3.03Å
56	H	93.5	Very high	94.6	Very high	111 Å²	111	107.9 Å²	107.9	51%	0.514	53%	0.53	S	S	.	.	H	α-helix	trans	-65.4	-41.5	176.9	-65.8	-55.7	0	0	0	112.3	F52 M53 A59 I60	F52-H56 PolarHBondContact O-CD2 2.85Å; F52-H56 PolarHBondContact O-N 3.46Å; M53-H56 CarbonylContact O-C 3.58Å; M53-H56 PolarHBondContact O-N 3.43Å; H56-A59 PolarHBondContact O-N 3.38Å; H56-I60 WeakPolarHBondContact O-CB 3.47Å; H56-I60 WeakPolarHBondContact O-CD1 3.29Å; H56-I60 WeakPolarHBondContact O-CG1 3.33Å; H56-I60 PolarHBondContact O-N 3.13Å
57	I	94.9	Very high	93.6	Very high	76 Å²	76	105.4 Å²	105.4	39%	0.39	52%	0.521	S	S	.	.	H	α-helix	trans	-62	-46.6	176.4	-68.3	167.4	0	0	0	110.1	M53 P54 A59 I60 L61	M53-I57 HydrophobicContact CB-CD1 4.04Å; M53-I57 WeakPolarHBondContact O-CB 3.01Å; M53-I57 VanDerWaalsContact O-CG1 3.29Å; M53-I57 WeakPolarHBondContact O-CG1 3.41Å; M53-I57 PolarHBondContact O-N 3.38Å; M53-I57 HydrophobicContact SD-CD1 4Å; P54-I57 PolarHBondContact O-N 3.11Å; I57-A59 PolarHBondContact O-N 3.12Å; I57-I60 PolarHBondContact O-N 3.42Å; I57-L61 HydrophobicContact CG2-CD1 3.86Å; I57-L61 HydrophobicContact CG2-CG 4.26Å; I57-L61 VanDerWaalsContact O-CG 3.29Å; I57-L61 WeakPolarHBondContact O-CG 3.45Å; I57-L61 PolarHBondContact O-N 3.12Å
58	M	94	Very high	92.2	Very high	116 Å²	116	110.3 Å²	110.3	57%	0.571	55%	0.549	S	S	*	.	H	α-helix	trans	-62.9	-41.8	178.1	-71.8	-63.5	171.1	0	0	112.4	P54 Q55 I60 L61 H62	P54-M58 WeakPolarHBondContact O-CB 3.44Å; P54-M58 VanDerWaalsContact O-CG 3.27Å; P54-M58 WeakPolarHBondContact O-CG 3.48Å; P54-M58 PolarHBondContact O-N 3.34Å; Q55-M58 PolarHBondContact O-N 3.22Å; M58-I60 VanDerWaalsContact C-N 3.3Å; M58-I60 PolarHBondContact O-N 3.42Å; M58-L61 PolarHBondContact O-N 3.48Å; M58-L61 HydrophobicContact SD-CD1 4.28Å; M58-H62 WeakPolarHBondContact O-CB 3.27Å; M58-H62 PolarHBondContact O-N 3.11Å
59	A	93.8	Very high	92	Very high	63 Å²	63	112.8 Å²	112.8	52%	0.521	56%	0.558	S	S	.	*	H	α-helix	trans	-60.8	-40.8	175.1	0	0	0	0	0	112	Q55 H56 I57 Y63	Q55-A59 WeakPolarHBondContact O-CB 3.48Å; Q55-A59 PolarHBondContact O-N 3.03Å; H56-A59 PolarHBondContact O-N 3.38Å; I57-A59 PolarHBondContact O-N 3.12Å; A59-Y63 WeakPolarHBondContact O-CB 3.46Å; A59-Y63 PolarHBondContact O-N 2.95Å
60	I	94.7	Very high	91.7	Very high	92 Å²	92	117.5 Å²	117.5	47%	0.472	57%	0.574	S	S	.	*	H	α-helix	trans	-66	-45.1	175.8	-69.2	164.5	0	0	0	110.9	H56 I57 M58 H62 Y63 F64	H56-I60 WeakPolarHBondContact O-CB 3.47Å; H56-I60 WeakPolarHBondContact O-CD1 3.29Å; H56-I60 WeakPolarHBondContact O-CG1 3.33Å; H56-I60 PolarHBondContact O-N 3.13Å; I57-I60 PolarHBondContact O-N 3.42Å; M58-I60 VanDerWaalsContact C-N 3.3Å; M58-I60 PolarHBondContact O-N 3.42Å; I60-H62 VanDerWaalsContact C-N 3.33Å; I60-H62 PolarHBondContact O-N 3.28Å; I60-Y63 WeakPolarHBondContact O-CB 3.29Å; I60-Y63 PolarHBondContact O-N 3.47Å; I60-F64 HydrophobicContact CG2-CD2 3.65Å; I60-F64 HydrophobicContact CG2-CE2 3.57Å; I60-F64 WeakPolarHBondContact O-CD2 3.19Å; I60-F64 PolarHBondContact O-N 2.93Å; I60-F64 VanDerWaalsContact O-N 3.09Å
61	L	95.3	Very high	91.5	Very high	52 Å²	52	113.8 Å²	113.8	27%	0.272	57%	0.566	S	S	.	*	H	α-helix	trans	-62.6	-39.6	179.5	-71.4	172.9	0	0	0	112.3	I57 M58 F64 E65 V66 V67	I57-L61 HydrophobicContact CG2-CD1 3.86Å; I57-L61 HydrophobicContact CG2-CG 4.26Å; I57-L61 VanDerWaalsContact O-CG 3.29Å; I57-L61 WeakPolarHBondContact O-CG 3.45Å; I57-L61 PolarHBondContact O-N 3.12Å; M58-L61 PolarHBondContact O-N 3.48Å; M58-L61 HydrophobicContact SD-CD1 4.28Å; L61-F64 PolarHBondContact O-N 2.86Å; L61-E65 PolarHBondContact O-N 3.35Å; L61-V66 HydrophobicContact CD2-CB 4.15Å; L61-V66 HydrophobicContact CD2-CG1 4.08Å; L61-V66 PolarHBondContact O-N 3.39Å; L61-V67 HydrophobicContact CB-CG2 4.42Å; L61-V67 HydrophobicContact CD1-CG2 4.47Å
62	H	93.6	Very high	91.1	Very high	123 Å²	123	116.8 Å²	116.8	57%	0.569	58%	0.577	S	S	*	*	H	α-helix	trans	-68.6	-38.5	175.3	-172.6	-105.2	0	0	0	111.8	M58 I60 F64 E65	M58-H62 WeakPolarHBondContact O-CB 3.27Å; M58-H62 PolarHBondContact O-N 3.11Å; I60-H62 VanDerWaalsContact C-N 3.33Å; I60-H62 PolarHBondContact O-N 3.28Å; H62-F64 VanDerWaalsContact C-N 3.27Å; H62-F64 PolarHBondContact O-N 3.07Å; H62-E65 PolarHBondContact O-N 3.26Å; H62-E65 VanDerWaalsContact O-N 3.12Å
63	Y	93.3	Very high	90.8	Very high	183 Å²	183	116.9 Å²	116.9	72%	0.718	58%	0.581	S	S	*	*	H	α-helix	trans	-60.4	-35.3	173.7	175.1	-96.8	0	0	0	112.9	A59 I60 E65	A59-Y63 WeakPolarHBondContact O-CB 3.46Å; A59-Y63 PolarHBondContact O-N 2.95Å; I60-Y63 WeakPolarHBondContact O-CB 3.29Å; I60-Y63 PolarHBondContact O-N 3.47Å; Y63-E65 VanDerWaalsContact C-N 3.33Å
64	F	95.2	Very high	90.6	Very high	136 Å²	136	117.1 Å²	117.1	60%	0.596	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.6	6.3	177.2	-70.8	-62.6	0	0	0	114.2	I60 L61 H62 V66	I60-F64 HydrophobicContact CG2-CD2 3.65Å; I60-F64 HydrophobicContact CG2-CE2 3.57Å; I60-F64 WeakPolarHBondContact O-CD2 3.19Å; I60-F64 PolarHBondContact O-N 2.93Å; I60-F64 VanDerWaalsContact O-N 3.09Å; L61-F64 PolarHBondContact O-N 2.86Å; H62-F64 VanDerWaalsContact C-N 3.27Å; H62-F64 PolarHBondContact O-N 3.07Å; F64-V66 HydrophobicContact CB-CG2 3.86Å; F64-V66 PolarHBondContact O-N 3.04Å
65	E	88.9	Confident	90.3	Very high	174 Å²	174	120.9 Å²	120.9	81%	0.813	60%	0.595	S	S	*	*	T	Hydrogen-bonded Turn	trans	55.1	21.9	-177.7	-55.7	-177.3	161.4	0	0	114	L61 H62 Y63 V67	L61-E65 PolarHBondContact O-N 3.35Å; H62-E65 PolarHBondContact O-N 3.26Å; H62-E65 VanDerWaalsContact O-N 3.12Å; Y63-E65 VanDerWaalsContact C-N 3.33Å; E65-V67 VanDerWaalsContact C-N 3.32Å
66	V	88.1	Confident	90	Very high	103 Å²	103	118.8 Å²	118.8	62%	0.624	59%	0.588	S	S	*	*	S	Bend	trans	-74.6	-28.6	179.3	176.9	0	0	0	0	111	L61 F64	L61-V66 HydrophobicContact CD2-CB 4.15Å; L61-V66 HydrophobicContact CD2-CG1 4.08Å; L61-V66 PolarHBondContact O-N 3.39Å; F64-V66 HydrophobicContact CB-CG2 3.86Å; F64-V66 PolarHBondContact O-N 3.04Å
67	V	76.7	Confident	89.7	Confident	73 Å²	73	119.5 Å²	119.5	44%	0.442	59%	0.594	S	S	.	*			trans	-125.2	127	173.4	171	0	0	0	0	106.9	L61 E65	L61-V67 HydrophobicContact CB-CG2 4.42Å; L61-V67 HydrophobicContact CD1-CG2 4.47Å; E65-V67 VanDerWaalsContact C-N 3.32Å
68	Q	68.7	Low	89.3	Confident	243 Å²	243	123.5 Å²	123.5	100%	1.136	61%	0.612	S	S	*	*			trans	-79.9	0	-179.8	-63.9	-166.3	-79.8	0	0	112.6

Retrieved 68 of 68 residues in 98.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).