A0A087Y2Z6_POEFO Loading...

Mitochondrial import inner membrane translocase subunit

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

AlphaFold DB (A0A3Q2DGN6), UniProt , Accession A0A087Y2Z6, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 95 aa.

						>A0A087Y2Z6_POEFO|A0A087Y2Z6
MDGFGSDFSAGGSGGKIDTGTIMEQVKVQIAVANAQELLQRMTDKCFKKCIGKPGSSLDNSEQKCIAMCMDRYMDAWNTVSRTYNSRLQRERARM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.2	Very low	49.5	Very low	228 Å²	228	136.1 Å²	136.1	100%	1.123	84%	0.837	S	S	*	*				0	87.2	0	-82.6	152.4	80.5	0	0	107.3
2	D	40.9	Very low	50.2	Low	163 Å²	163	131.7 Å²	131.7	87%	0.872	84%	0.839	S	S	*	*			trans	27.8	126.1	136.1	-35	-64.9	0	0	0	116.6
3	G	47.1	Very low	49.5	Very low	65 Å²	65	130.4 Å²	130.4	67%	0.67	84%	0.836	S	S	*	*			cis	144.2	104.6	17.1	0	0	0	0	0	106.9
4	F	47.6	Very low	49.7	Very low	222 Å²	222	126.6 Å²	126.6	97%	0.974	83%	0.833	S	S	*	*			trans	-133.5	89.1	168.7	-78.3	-77.8	0	0	0	108.2
5	G	54.9	Low	49.9	Very low	68 Å²	68	122.7 Å²	122.7	70%	0.701	82%	0.824	S	S	*	*			trans	-138.2	120.9	167.8	0	0	0	0	0	108.6
6	S	48.4	Very low	50.5	Low	108 Å²	108	126.6 Å²	126.6	76%	0.755	82%	0.823	S	S	*	*			trans	177.9	110.2	130.5	31.7	0	0	0	0	109.9
7	D	65	Low	51	Low	167 Å²	167	126.5 Å²	126.5	89%	0.893	81%	0.813	S	S	*	*			trans	-51.2	135.4	149	-61.5	-77.7	0	0	0	110.3
8	F	49.1	Very low	51.8	Low	185 Å²	185	125.4 Å²	125.4	81%	0.811	80%	0.799	S	S	*	*			trans	-142	112.5	147.1	67.3	-87.4	0	0	0	111.2
9	S	46.5	Very low	52.5	Low	110 Å²	110	124.3 Å²	124.3	77%	0.769	79%	0.79	S	S	*	*			trans	47.1	117.2	138.5	-66.4	0	0	0	0	120.7	G11	S9-G11 PolarHBondContact O-N 2.92Å
10	A	58.5	Low	53.3	Low	110 Å²	110	120.7 Å²	120.7	91%	0.909	78%	0.778	S	S	*	*			trans	-19	123.5	136.5	0	0	0	0	0	114.1
11	G	41.8	Very low	54.1	Low	71 Å²	71	118.8 Å²	118.8	73%	0.732	77%	0.765	S	S	*	*			trans	-162.2	88.7	171.9	0	0	0	0	0	109	S9 S13	S9-G11 PolarHBondContact O-N 2.92Å; G11-S13 PolarHBondContact O-N 3.35Å
12	G	57.1	Low	55.3	Low	83 Å²	83	111.6 Å²	111.6	86%	0.856	73%	0.73	S	S	*	*			trans	-53.9	126.4	164.7	0	0	0	0	0	109.4
13	S	41.7	Very low	56.6	Low	115 Å²	115	109.4 Å²	109.4	80%	0.804	72%	0.716	S	S	*	*			trans	-141.9	110.8	158.2	-97.2	0	0	0	0	106.4	G11 G15	G11-S13 PolarHBondContact O-N 3.35Å; S13-G15 PolarHBondContact O-N 3.24Å
14	G	51.7	Low	57.9	Low	77 Å²	77	111.2 Å²	111.2	79%	0.794	71%	0.707	S	S	*	*			trans	-50.1	113.7	174.2	0	0	0	0	0	108.6	K16	G14-K16 PolarHBondContact O-N 3.43Å
15	G	52.7	Low	58.6	Low	68 Å²	68	106.5 Å²	106.5	70%	0.701	69%	0.688	S	S	*	*			trans	-55.2	109.6	165.6	0	0	0	0	0	106	S13 I17	S13-G15 PolarHBondContact O-N 3.24Å; G15-I17 VanDerWaalsContact C-N 3.27Å; G15-I17 PolarHBondContact O-N 3.48Å
16	K	59.1	Low	59.5	Low	186 Å²	186	106.3 Å²	106.3	81%	0.809	67%	0.673	S	S	*	*			trans	-54.9	107.3	161.1	-77.2	171.9	177.2	156.1	0	104.1	G14 D18	G14-K16 PolarHBondContact O-N 3.43Å; K16-D18 PolarHBondContact O-N 3.43Å
17	I	60	Low	60.5	Low	125 Å²	125	106.5 Å²	106.5	64%	0.641	66%	0.66	S	S	*	*			trans	-54.6	101.4	166.7	-68.9	-178.5	0	0	0	104	G15 T19 I22	G15-I17 VanDerWaalsContact C-N 3.27Å; G15-I17 PolarHBondContact O-N 3.48Å; I17-T19 HydrophobicContact CG2-CG2 4.27Å; I17-T19 PolarHBondContact O-N 3.22Å; I17-I22 HydrophobicContact CB-CD1 4.45Å; I17-I22 HydrophobicContact CG2-CD1 3.22Å
18	D	64.4	Low	61.2	Low	107 Å²	107	102.4 Å²	102.4	57%	0.572	64%	0.641	S	S	*	*			trans	-66.8	84.3	176.4	-80.7	-52.1	0	0	0	106.7	K16 G20 T21 I22	K16-D18 PolarHBondContact O-N 3.43Å; D18-G20 PolarHBondContact O-N 3.44Å; D18-T21 HydrophobicContact CB-CG2 4.11Å; D18-T21 VanDerWaalsContact CB-OG1 3.3Å; D18-T21 WeakPolarHBondContact CB-OG1 3.38Å; D18-T21 PolarHBondContact O-N 2.98Å; D18-T21 PolarHBondContact O-OG1 2.98Å; D18-I22 PolarHBondContact O-N 3.25Å; D18-I22 VanDerWaalsContact O-N 3.1Å
19	T	66.5	Low	62	Low	103 Å²	103	99.9 Å²	99.9	63%	0.632	63%	0.632	S	S	*	*	H	α-helix	trans	-54.8	-26.1	-177.8	46.3	0	0	0	0	111.7	I17 M23	I17-T19 HydrophobicContact CG2-CG2 4.27Å; I17-T19 PolarHBondContact O-N 3.22Å; T19-M23 WeakPolarHBondContact O-CB 3.32Å; T19-M23 VanDerWaalsContact O-CG 3.31Å; T19-M23 WeakPolarHBondContact O-CG 3.34Å; T19-M23 PolarHBondContact O-N 2.87Å
20	G	67	Low	63.3	Low	53 Å²	53	99 Å²	99	55%	0.546	62%	0.617	S	S	.	*	H	α-helix	trans	-65.6	-44.8	171.3	0	0	0	0	0	114.2	D18 E24	D18-G20 PolarHBondContact O-N 3.44Å; G20-E24 PolarHBondContact O-N 3.09Å; G20-E24 VanDerWaalsContact O-N 3.13Å
21	T	70.4	Confident	64.2	Low	81 Å²	81	96.5 Å²	96.5	50%	0.497	60%	0.597	S	S	.	*	H	α-helix	trans	-72.9	-34.4	178.4	58.9	0	0	0	0	111.2	D18 E24 Q25	D18-T21 HydrophobicContact CB-CG2 4.11Å; D18-T21 VanDerWaalsContact CB-OG1 3.3Å; D18-T21 WeakPolarHBondContact CB-OG1 3.38Å; D18-T21 PolarHBondContact O-N 2.98Å; D18-T21 PolarHBondContact O-OG1 2.98Å; T21-E24 PolarHBondContact O-N 3.04Å; T21-Q25 WeakPolarHBondContact O-CG 3.36Å; T21-Q25 PolarHBondContact O-N 2.97Å
22	I	71.2	Confident	66.2	Low	76 Å²	76	96.7 Å²	96.7	39%	0.39	58%	0.584	S	S	.	*	H	α-helix	trans	-69.3	-43.9	174.5	-67.6	168.5	0	0	0	111.3	I17 D18 E24 Q25 V26	I17-I22 HydrophobicContact CB-CD1 4.45Å; I17-I22 HydrophobicContact CG2-CD1 3.22Å; D18-I22 PolarHBondContact O-N 3.25Å; D18-I22 VanDerWaalsContact O-N 3.1Å; I22-E24 PolarHBondContact O-N 3.46Å; I22-Q25 PolarHBondContact O-N 3.37Å; I22-V26 HydrophobicContact CG2-CG2 4.14Å; I22-V26 WeakPolarHBondContact O-CB 3.46Å; I22-V26 WeakPolarHBondContact O-CG2 3.46Å; I22-V26 PolarHBondContact O-N 3.34Å
23	M	66.9	Low	67.5	Low	118 Å²	118	95.2 Å²	95.2	58%	0.581	56%	0.563	S	S	*	*	H	α-helix	trans	-58.1	-39.8	174.3	-90.4	-96.6	-96.5	0	0	111.7	T19 V26 K27	T19-M23 WeakPolarHBondContact O-CB 3.32Å; T19-M23 VanDerWaalsContact O-CG 3.31Å; T19-M23 WeakPolarHBondContact O-CG 3.34Å; T19-M23 PolarHBondContact O-N 2.87Å; M23-V26 PolarHBondContact O-N 3.33Å; M23-K27 VanDerWaalsContact O-CG 3.25Å; M23-K27 WeakPolarHBondContact O-CG 3.37Å; M23-K27 PolarHBondContact O-N 3.48Å
24	E	74.4	Confident	69.5	Low	102 Å²	102	94.2 Å²	94.2	48%	0.477	55%	0.549	S	S	.	.	H	α-helix	trans	-68.9	-45.1	178.3	-165.1	58.9	-159.7	0	0	112	G20 T21 I22 V26 K27 V28	G20-E24 PolarHBondContact O-N 3.09Å; G20-E24 VanDerWaalsContact O-N 3.13Å; T21-E24 PolarHBondContact O-N 3.04Å; I22-E24 PolarHBondContact O-N 3.46Å; E24-V26 VanDerWaalsContact C-N 3.31Å; E24-V26 PolarHBondContact O-N 2.94Å; E24-K27 PolarHBondContact O-N 2.81Å; E24-K27 IonicContact OE2-NZ 3.24Å; E24-K27 PolarHBondContact OE2-NZ 3.02Å; E24-V28 WeakPolarHBondContact O-CG2 3.47Å; E24-V28 PolarHBondContact O-N 3.11Å
25	Q	63.9	Low	71.1	Confident	124 Å²	124	92.8 Å²	92.8	58%	0.579	53%	0.53	S	S	*	.	H	α-helix	trans	-59.8	-41.4	173.6	-73.4	-177.8	1	0	0	112.2	T21 I22 V28 Q29	T21-Q25 WeakPolarHBondContact O-CG 3.36Å; T21-Q25 PolarHBondContact O-N 2.97Å; I22-Q25 PolarHBondContact O-N 3.37Å; Q25-V28 PolarHBondContact O-N 3.33Å; Q25-Q29 WeakPolarHBondContact O-CG 3.33Å; Q25-Q29 PolarHBondContact O-N 2.94Å
26	V	72.8	Confident	72.9	Confident	63 Å²	63	95.3 Å²	95.3	38%	0.382	52%	0.523	S	S	.	.	H	α-helix	trans	-64.2	-43	176.6	169.5	0	0	0	0	111	I22 M23 E24 V28 Q29 I30	I22-V26 HydrophobicContact CG2-CG2 4.14Å; I22-V26 WeakPolarHBondContact O-CB 3.46Å; I22-V26 WeakPolarHBondContact O-CG2 3.46Å; I22-V26 PolarHBondContact O-N 3.34Å; M23-V26 PolarHBondContact O-N 3.33Å; E24-V26 VanDerWaalsContact C-N 3.31Å; E24-V26 PolarHBondContact O-N 2.94Å; V26-V28 PolarHBondContact O-N 3.44Å; V26-Q29 PolarHBondContact O-N 3.21Å; V26-I30 HydrophobicContact CG1-CD1 3.65Å; V26-I30 HydrophobicContact CG1-CG1 4.3Å; V26-I30 WeakPolarHBondContact O-CB 3.16Å; V26-I30 WeakPolarHBondContact O-CG1 3.43Å; V26-I30 PolarHBondContact O-N 3.06Å
27	K	70.8	Confident	74.5	Confident	112 Å²	112	90.8 Å²	90.8	49%	0.487	51%	0.505	S	S	.	.	H	α-helix	trans	-60.7	-43	175.2	-74.7	170.9	-166	166.3	0	112.3	M23 E24 I30 A31	M23-K27 VanDerWaalsContact O-CG 3.25Å; M23-K27 WeakPolarHBondContact O-CG 3.37Å; M23-K27 PolarHBondContact O-N 3.48Å; E24-K27 PolarHBondContact O-N 2.81Å; E24-K27 IonicContact OE2-NZ 3.24Å; E24-K27 PolarHBondContact OE2-NZ 3.02Å; K27-I30 PolarHBondContact O-N 2.79Å; K27-A31 WeakPolarHBondContact O-CB 3.2Å; K27-A31 PolarHBondContact O-N 3.36Å
28	V	78.3	Confident	76	Confident	81 Å²	81	86.3 Å²	86.3	49%	0.491	48%	0.482	S	S	.	.	H	α-helix	trans	-62.6	-46.3	176.9	173.1	0	0	0	0	110.1	E24 Q25 V26 I30 A31 V32	E24-V28 WeakPolarHBondContact O-CG2 3.47Å; E24-V28 PolarHBondContact O-N 3.11Å; Q25-V28 PolarHBondContact O-N 3.33Å; V26-V28 PolarHBondContact O-N 3.44Å; V28-I30 VanDerWaalsContact C-N 3.34Å; V28-I30 PolarHBondContact O-N 3.46Å; V28-A31 WeakPolarHBondContact O-CB 3.36Å; V28-A31 PolarHBondContact O-N 3.39Å; V28-V32 HydrophobicContact CG1-CG2 4.47Å; V28-V32 WeakPolarHBondContact O-CG2 3.44Å; V28-V32 PolarHBondContact O-N 3.43Å
29	Q	66.8	Low	77.4	Confident	132 Å²	132	85.9 Å²	85.9	62%	0.617	48%	0.479	S	S	*	.	H	α-helix	trans	-61.7	-40.8	177	-73.7	178.5	4.1	0	0	112.4	Q25 V26 V32 A33	Q25-Q29 WeakPolarHBondContact O-CG 3.33Å; Q25-Q29 PolarHBondContact O-N 2.94Å; V26-Q29 PolarHBondContact O-N 3.21Å; Q29-V32 PolarHBondContact O-N 2.82Å; Q29-A33 WeakPolarHBondContact O-CB 3.36Å; Q29-A33 PolarHBondContact O-N 2.82Å
30	I	74.4	Confident	78.8	Confident	91 Å²	91	87.1 Å²	87.1	47%	0.467	48%	0.478	S	S	.	.	H	α-helix	trans	-62.7	-43.8	174.4	-70.4	166.8	0	0	0	110.5	V26 K27 V28 V32 A33 N34	V26-I30 HydrophobicContact CG1-CD1 3.65Å; V26-I30 HydrophobicContact CG1-CG1 4.3Å; V26-I30 WeakPolarHBondContact O-CB 3.16Å; V26-I30 WeakPolarHBondContact O-CG1 3.43Å; V26-I30 PolarHBondContact O-N 3.06Å; K27-I30 PolarHBondContact O-N 2.79Å; V28-I30 VanDerWaalsContact C-N 3.34Å; V28-I30 PolarHBondContact O-N 3.46Å; I30-V32 VanDerWaalsContact C-N 3.33Å; I30-V32 PolarHBondContact O-N 3.48Å; I30-A33 PolarHBondContact O-N 3.33Å; I30-N34 VanDerWaalsContact CG2-ND2 3.3Å; I30-N34 WeakPolarHBondContact CG2-ND2 3.4Å; I30-N34 WeakPolarHBondContact O-CB 3.49Å; I30-N34 PolarHBondContact O-N 2.95Å; I30-N34 PolarHBondContact O-ND2 3.01Å
31	A	76.4	Confident	80.1	Confident	59 Å²	59	91.4 Å²	91.4	49%	0.488	48%	0.478	S	S	.	.	H	α-helix	trans	-62.2	-41.9	177.3	0	0	0	0	0	111.7	K27 V28 N34 A35	K27-A31 WeakPolarHBondContact O-CB 3.2Å; K27-A31 PolarHBondContact O-N 3.36Å; V28-A31 WeakPolarHBondContact O-CB 3.36Å; V28-A31 PolarHBondContact O-N 3.39Å; A31-N34 PolarHBondContact O-N 3.26Å; A31-A35 WeakPolarHBondContact O-CB 3.33Å; A31-A35 PolarHBondContact O-N 3.02Å
32	V	84.2	Confident	81.3	Confident	75 Å²	75	88.3 Å²	88.3	46%	0.455	46%	0.458	S	S	.	.	H	α-helix	trans	-62.7	-47.3	175.4	171.4	0	0	0	0	111.1	V28 Q29 I30 N34 A35 Q36	V28-V32 HydrophobicContact CG1-CG2 4.47Å; V28-V32 WeakPolarHBondContact O-CG2 3.44Å; V28-V32 PolarHBondContact O-N 3.43Å; Q29-V32 PolarHBondContact O-N 2.82Å; I30-V32 VanDerWaalsContact C-N 3.33Å; I30-V32 PolarHBondContact O-N 3.48Å; V32-N34 PolarHBondContact O-N 3.38Å; V32-A35 PolarHBondContact O-N 2.73Å; V32-Q36 WeakPolarHBondContact O-CG 3.26Å; V32-Q36 PolarHBondContact O-N 2.85Å
33	A	83.9	Confident	82.5	Confident	51 Å²	51	87.9 Å²	87.9	42%	0.421	46%	0.459	S	S	.	.	H	α-helix	trans	-61.5	-42.6	178.8	0	0	0	0	0	112	Q29 I30 A35 Q36 E37	Q29-A33 WeakPolarHBondContact O-CB 3.36Å; Q29-A33 PolarHBondContact O-N 2.82Å; I30-A33 PolarHBondContact O-N 3.33Å; A33-A35 PolarHBondContact O-N 2.88Å; A33-Q36 PolarHBondContact O-N 3.49Å; A33-E37 PolarHBondContact O-N 3.39Å
34	N	84.4	Confident	84	Confident	94 Å²	94	86 Å²	86	50%	0.503	45%	0.451	S	S	.	.	H	α-helix	trans	-64.3	-39.6	175.6	-77.4	-63	0	0	0	112.3	I30 A31 V32 E37 L38	I30-N34 VanDerWaalsContact CG2-ND2 3.3Å; I30-N34 WeakPolarHBondContact CG2-ND2 3.4Å; I30-N34 WeakPolarHBondContact O-CB 3.49Å; I30-N34 PolarHBondContact O-N 2.95Å; I30-N34 PolarHBondContact O-ND2 3.01Å; A31-N34 PolarHBondContact O-N 3.26Å; V32-N34 PolarHBondContact O-N 3.38Å; N34-E37 PolarHBondContact O-N 3.34Å; N34-L38 WeakPolarHBondContact O-CB 3.46Å; N34-L38 PolarHBondContact O-N 3.22Å
35	A	85.4	Confident	85.1	Confident	47 Å²	47	87.1 Å²	87.1	39%	0.388	45%	0.454	S	S	.	.	H	α-helix	trans	-65.2	-41.2	175.6	0	0	0	0	0	111.5	A31 V32 A33 L38 L39	A31-A35 WeakPolarHBondContact O-CB 3.33Å; A31-A35 PolarHBondContact O-N 3.02Å; V32-A35 PolarHBondContact O-N 2.73Å; A33-A35 PolarHBondContact O-N 2.88Å; A35-L38 WeakPolarHBondContact O-CB 3.27Å; A35-L38 PolarHBondContact O-N 3.26Å; A35-L39 VanDerWaalsContact O-CG 3.31Å; A35-L39 WeakPolarHBondContact O-CG 3.35Å; A35-L39 PolarHBondContact O-N 3.48Å
36	Q	90	Very high	86.7	Confident	121 Å²	121	81.3 Å²	81.3	57%	0.565	43%	0.427	S	S	*	.	H	α-helix	trans	-60.8	-45.1	174.3	-74.4	175.7	-15.7	0	0	111.5	V32 A33 L38 L39 Q40	V32-Q36 WeakPolarHBondContact O-CG 3.26Å; V32-Q36 PolarHBondContact O-N 2.85Å; A33-Q36 PolarHBondContact O-N 3.49Å; Q36-L38 VanDerWaalsContact C-N 3.32Å; Q36-L38 PolarHBondContact O-N 3.04Å; Q36-L39 PolarHBondContact O-N 3.01Å; Q36-Q40 WeakPolarHBondContact O-CB 3.24Å; Q36-Q40 PolarHBondContact O-N 2.86Å
37	E	92.9	Very high	87.8	Confident	92 Å²	92	83.1 Å²	83.1	43%	0.43	43%	0.43	S	S	.	.	H	α-helix	trans	-62.4	-41.2	176.7	-175	174.7	175.4	0	0	111.8	A33 N34 L39 Q40 R41	A33-E37 PolarHBondContact O-N 3.39Å; N34-E37 PolarHBondContact O-N 3.34Å; E37-L39 VanDerWaalsContact C-N 3.35Å; E37-L39 PolarHBondContact O-N 3.07Å; E37-Q40 PolarHBondContact O-N 3.4Å; E37-R41 HydrophobicContact CG-CG 4.39Å; E37-R41 WeakPolarHBondContact O-CB 3.37Å; E37-R41 WeakPolarHBondContact O-CG 3.49Å; E37-R41 PolarHBondContact O-N 3.24Å; E37-R41 IonicContact OE1-CZ 3.24Å; E37-R41 VanDerWaalsContact OE1-CZ 3.24Å; E37-R41 IonicContact OE1-NE 2.88Å; E37-R41 PolarHBondContact OE1-NE 3.33Å; E37-R41 IonicContact OE1-NH2 2.73Å; E37-R41 PolarHBondContact OE1-NH2 2.88Å
38	L	91.3	Very high	89	Confident	31 Å²	31	86 Å²	86	16%	0.162	44%	0.443	C	S	.	.	H	α-helix	trans	-58.7	-47.5	175.5	179.3	63.9	0	0	0	111.3	N34 A35 Q36 R41 M42 Y73 M74 W77	N34-L38 WeakPolarHBondContact O-CB 3.46Å; N34-L38 PolarHBondContact O-N 3.22Å; A35-L38 WeakPolarHBondContact O-CB 3.27Å; A35-L38 PolarHBondContact O-N 3.26Å; Q36-L38 VanDerWaalsContact C-N 3.32Å; Q36-L38 PolarHBondContact O-N 3.04Å; L38-R41 PolarHBondContact O-N 3.42Å; L38-M42 VanDerWaalsContact O-CB 3.31Å; L38-M42 WeakPolarHBondContact O-CB 3.37Å; L38-M42 PolarHBondContact O-N 3.19Å; L38-Y73 HydrophobicContact CD1-CE1 3.67Å; L38-M74 HydrophobicContact CD2-SD 4.36Å; L38-W77 VanDerWaalsContact CD1-CD1 3.46Å; L38-W77 HydrophobicContact CD1-CD2 4.21Å; L38-W77 HydrophobicContact CD1-CG 3.9Å; L38-W77 HydrophobicContact CD2-CD2 4.19Å; L38-W77 HydrophobicContact CD2-CH2 4.49Å; L38-W77 HydrophobicContact CD2-CZ2 4.15Å
39	L	93.1	Very high	89.9	Confident	97 Å²	97	90 Å²	90	51%	0.508	45%	0.454	S	S	.	.	H	α-helix	trans	-62.8	-42.9	178	-70.5	173.3	0	0	0	111.6	A35 Q36 E37 M42 T43	A35-L39 VanDerWaalsContact O-CG 3.31Å; A35-L39 WeakPolarHBondContact O-CG 3.35Å; A35-L39 PolarHBondContact O-N 3.48Å; Q36-L39 PolarHBondContact O-N 3.01Å; E37-L39 VanDerWaalsContact C-N 3.35Å; E37-L39 PolarHBondContact O-N 3.07Å; L39-M42 HydrophobicContact CD2-CE 3.79Å; L39-M42 PolarHBondContact O-N 3.29Å; L39-T43 VanDerWaalsContact O-CB 3.28Å; L39-T43 WeakPolarHBondContact O-CB 3.43Å; L39-T43 PolarHBondContact O-N 3.34Å; L39-T43 PolarHBondContact O-OG1 2.9Å
40	Q	95.7	Very high	91.4	Very high	129 Å²	129	84.5 Å²	84.5	60%	0.603	43%	0.43	S	S	*	.	H	α-helix	trans	-59.9	-51.1	177.2	-162.4	93.9	26.7	0	0	110.7	Q36 E37 M42 T43 D44	Q36-Q40 WeakPolarHBondContact O-CB 3.24Å; Q36-Q40 PolarHBondContact O-N 2.86Å; E37-Q40 PolarHBondContact O-N 3.4Å; Q40-M42 VanDerWaalsContact C-N 3.35Å; Q40-M42 PolarHBondContact O-N 2.61Å; Q40-T43 PolarHBondContact O-N 3.1Å; Q40-D44 PolarHBondContact O-N 2.91Å
41	R	95.6	Very high	92.4	Very high	144 Å²	144	81 Å²	81	54%	0.543	41%	0.412	S	S	.	.	H	α-helix	trans	-63.7	-39.2	-179.8	-72.2	-177.9	-179.4	-108.2	4.3	112.7	E37 L38 K45	E37-R41 HydrophobicContact CG-CG 4.39Å; E37-R41 WeakPolarHBondContact O-CB 3.37Å; E37-R41 WeakPolarHBondContact O-CG 3.49Å; E37-R41 PolarHBondContact O-N 3.24Å; E37-R41 IonicContact OE1-CZ 3.24Å; E37-R41 VanDerWaalsContact OE1-CZ 3.24Å; E37-R41 IonicContact OE1-NE 2.88Å; E37-R41 PolarHBondContact OE1-NE 3.33Å; E37-R41 IonicContact OE1-NH2 2.73Å; E37-R41 PolarHBondContact OE1-NH2 2.88Å; L38-R41 PolarHBondContact O-N 3.42Å; R41-K45 WeakPolarHBondContact O-CB 3.21Å; R41-K45 WeakPolarHBondContact O-CG 3.17Å; R41-K45 PolarHBondContact O-N 3.36Å; R41-K45 VanDerWaalsContact O-N 3.13Å
42	M	96	Very high	93.2	Very high	15 Å²	15	81.7 Å²	81.7	7%	0.074	42%	0.424	C	S	.	.	H	α-helix	trans	-63.2	-48.6	175	-177.8	174.6	67.1	0	0	110.7	L38 L39 Q40 D44 K45 C46 M70 Y73 M74	L38-M42 VanDerWaalsContact O-CB 3.31Å; L38-M42 WeakPolarHBondContact O-CB 3.37Å; L38-M42 PolarHBondContact O-N 3.19Å; L39-M42 HydrophobicContact CD2-CE 3.79Å; L39-M42 PolarHBondContact O-N 3.29Å; Q40-M42 VanDerWaalsContact C-N 3.35Å; Q40-M42 PolarHBondContact O-N 2.61Å; M42-D44 PolarHBondContact O-N 3.04Å; M42-K45 PolarHBondContact O-N 3.27Å; M42-C46 WeakPolarHBondContact O-CB 3.31Å; M42-C46 PolarHBondContact O-N 3.47Å; M42-M70 HydrophobicContact CE-CE 4.45Å; M42-M70 HydrophobicContact CE-CG 4.16Å; M42-M70 HydrophobicContact CE-SD 4.33Å; M42-M70 HydrophobicContact CG-CG 4.22Å; M42-M70 HydrophobicContact SD-CB 4.03Å; M42-M70 HydrophobicContact SD-CG 3.98Å; M42-Y73 HydrophobicContact CB-CD1 3.6Å; M42-Y73 HydrophobicContact CB-CE1 3.54Å; M42-Y73 HydrophobicContact CB-CG 4.23Å; M42-Y73 HydrophobicContact CG-CD1 3.44Å; M42-Y73 VanDerWaalsContact CG-CD1 3.44Å; M42-Y73 HydrophobicContact CG-CE1 3.96Å; M42-Y73 HydrophobicContact CG-CG 3.81Å; M42-Y73 HydrophobicContact SD-CD1 3.72Å; M42-Y73 HydrophobicContact SD-CE1 4.43Å; M42-Y73 HydrophobicContact SD-CG 4.4Å; M42-M74 HydrophobicContact SD-CG 4.08Å; M42-M74 HydrophobicContact SD-SD 4.22Å
43	T	95.7	Very high	93.4	Very high	67 Å²	67	86.8 Å²	86.8	41%	0.411	44%	0.44	S	S	.	.	H	α-helix	trans	-57.9	-49.7	179.4	-59	0	0	0	0	110.5	L39 Q40 K45 C46 F47	L39-T43 VanDerWaalsContact O-CB 3.28Å; L39-T43 WeakPolarHBondContact O-CB 3.43Å; L39-T43 PolarHBondContact O-N 3.34Å; L39-T43 PolarHBondContact O-OG1 2.9Å; Q40-T43 PolarHBondContact O-N 3.1Å; T43-K45 VanDerWaalsContact C-N 3.34Å; T43-K45 PolarHBondContact O-N 3.13Å; T43-C46 PolarHBondContact O-N 3.43Å; T43-F47 WeakPolarHBondContact O-CB 3.26Å; T43-F47 PolarHBondContact O-N 2.94Å
44	D	97.1	Very high	93.7	Very high	78 Å²	78	89.5 Å²	89.5	42%	0.417	45%	0.454	S	S	.	.	H	α-helix	trans	-59.6	-42.5	179.1	-73.3	-15.2	0	0	0	112.7	Q40 M42 K48	Q40-D44 PolarHBondContact O-N 2.91Å; M42-D44 PolarHBondContact O-N 3.04Å; D44-K48 WeakPolarHBondContact O-CB 3.47Å; D44-K48 WeakPolarHBondContact O-CD 3.47Å; D44-K48 VanDerWaalsContact O-CG 3.24Å; D44-K48 WeakPolarHBondContact O-CG 3.31Å; D44-K48 PolarHBondContact O-N 3.44Å; D44-K48 VanDerWaalsContact O-N 3.1Å
45	K	97.5	Very high	94	Very high	127 Å²	127	87.9 Å²	87.9	55%	0.552	46%	0.46	S	S	*	.	H	α-helix	trans	-66.8	-48	178.7	-84.3	172.5	177.1	-76.3	0	111.7	R41 M42 T43 K49 Y73	R41-K45 WeakPolarHBondContact O-CB 3.21Å; R41-K45 WeakPolarHBondContact O-CG 3.17Å; R41-K45 PolarHBondContact O-N 3.36Å; R41-K45 VanDerWaalsContact O-N 3.13Å; M42-K45 PolarHBondContact O-N 3.27Å; T43-K45 VanDerWaalsContact C-N 3.34Å; T43-K45 PolarHBondContact O-N 3.13Å; K45-K49 VanDerWaalsContact O-CB 3.31Å; K45-K49 WeakPolarHBondContact O-CB 3.46Å; K45-K49 PolarHBondContact O-N 2.94Å; K45-Y73 HydrophobicContact CD-CD2 3.89Å; K45-Y73 HydrophobicContact CD-CE2 3.4Å; K45-Y73 VanDerWaalsContact CD-CE2 3.4Å
46	C	97.7	Very high	94.3	Very high	2 Å²	2	91.9 Å²	91.9	1%	0.014	48%	0.484	C	S	.	.	H	α-helix	trans	-70.4	-37.1	-177.4	-68.8	0	0	0	0	112.1	M42 T43 K49 C50 C69	M42-C46 WeakPolarHBondContact O-CB 3.31Å; M42-C46 PolarHBondContact O-N 3.47Å; T43-C46 PolarHBondContact O-N 3.43Å; C46-K49 PolarHBondContact O-N 3.48Å; C46-C50 VanDerWaalsContact O-CB 3.24Å; C46-C50 WeakPolarHBondContact O-CB 3.47Å; C46-C50 PolarHBondContact O-N 2.97Å; C46-C69 WeakPolarHBondContact CA-SG 3.33Å; C46-C69 HydrophobicContact CB-CB 3.76Å; C46-C69 WeakPolarHBondContact CB-SG 3.02Å; C46-C69 WeakPolarHBondContact SG-CB 3.37Å; C46-C69 CovalentContact SG-SG 2.05Å; C46-C69 PolarHBondContact SG-SG 3.32Å
47	F	96.6	Very high	94.5	Very high	101 Å²	101	90.4 Å²	90.4	44%	0.443	49%	0.487	S	S	.	.	H	α-helix	trans	-60.8	-52.5	173.4	-170.7	-89.9	0	0	0	111.2	T43 K49 C50 I51	T43-F47 WeakPolarHBondContact O-CB 3.26Å; T43-F47 PolarHBondContact O-N 2.94Å; F47-K49 PolarHBondContact O-N 3.26Å; F47-C50 PolarHBondContact O-N 3.43Å; F47-I51 HydrophobicContact CD1-CB 4.38Å; F47-I51 HydrophobicContact CD2-CB 4.18Å; F47-I51 HydrophobicContact CD2-CG1 3.57Å; F47-I51 HydrophobicContact CE1-CB 4.21Å; F47-I51 HydrophobicContact CE1-CG2 4.27Å; F47-I51 HydrophobicContact CE2-CB 4.01Å; F47-I51 HydrophobicContact CE2-CG1 3.67Å; F47-I51 HydrophobicContact CE2-CG2 3.98Å; F47-I51 HydrophobicContact CG-CB 4.36Å; F47-I51 HydrophobicContact CG-CG1 4.04Å; F47-I51 HydrophobicContact CZ-CB 4.03Å; F47-I51 HydrophobicContact CZ-CG1 4.21Å; F47-I51 HydrophobicContact CZ-CG2 3.77Å; F47-I51 WeakPolarHBondContact O-CB 3.3Å; F47-I51 PolarHBondContact O-N 3.29Å
48	K	96.5	Very high	94.5	Very high	172 Å²	172	89.7 Å²	89.7	75%	0.748	49%	0.486	S	S	*	.	H	α-helix	trans	-59.6	-30.7	177.6	-74	172.5	-177.4	171.5	0	113.4	D44	D44-K48 WeakPolarHBondContact O-CB 3.47Å; D44-K48 WeakPolarHBondContact O-CD 3.47Å; D44-K48 VanDerWaalsContact O-CG 3.24Å; D44-K48 WeakPolarHBondContact O-CG 3.31Å; D44-K48 PolarHBondContact O-N 3.44Å; D44-K48 VanDerWaalsContact O-N 3.1Å
49	K	97.1	Very high	94.6	Very high	166 Å²	166	92.1 Å²	92.1	72%	0.722	50%	0.499	S	S	*	.	H	α-helix	trans	-81.9	-39	-178.6	-178.6	58.6	178.6	176.8	0	112.8	K45 C46 F47	K45-K49 VanDerWaalsContact O-CB 3.31Å; K45-K49 WeakPolarHBondContact O-CB 3.46Å; K45-K49 PolarHBondContact O-N 2.94Å; C46-K49 PolarHBondContact O-N 3.48Å; F47-K49 PolarHBondContact O-N 3.26Å
50	C	97.4	Very high	94.7	Very high	16 Å²	16	93.6 Å²	93.6	11%	0.108	51%	0.508	C	S	.	.	H	α-helix	trans	-103.9	-23.5	-167.8	-68.9	0	0	0	0	114	C46 F47 C65 I66	C46-C50 VanDerWaalsContact O-CB 3.24Å; C46-C50 WeakPolarHBondContact O-CB 3.47Å; C46-C50 PolarHBondContact O-N 2.97Å; F47-C50 PolarHBondContact O-N 3.43Å; C50-C65 WeakPolarHBondContact CA-SG 3.48Å; C50-C65 HydrophobicContact CB-CB 3.59Å; C50-C65 WeakPolarHBondContact CB-SG 3.05Å; C50-C65 WeakPolarHBondContact SG-CB 3.3Å; C50-C65 PolarHBondContact SG-O 3.43Å; C50-C65 VanDerWaalsContact SG-O 3.33Å; C50-C65 CovalentContact SG-SG 2.04Å; C50-C65 PolarHBondContact SG-SG 3.24Å; C50-I66 HydrophobicContact CB-CG1 3.87Å
51	I	96.6	Very high	94.7	Very high	17 Å²	17	91.2 Å²	91.2	9%	0.087	51%	0.505	C	S	.	.			trans	-102.1	102.3	-176.2	-51.8	-53.5	0	0	0	109.6	F47 P54 L58 E62 I66	F47-I51 HydrophobicContact CD1-CB 4.38Å; F47-I51 HydrophobicContact CD2-CB 4.18Å; F47-I51 HydrophobicContact CD2-CG1 3.57Å; F47-I51 HydrophobicContact CE1-CB 4.21Å; F47-I51 HydrophobicContact CE1-CG2 4.27Å; F47-I51 HydrophobicContact CE2-CB 4.01Å; F47-I51 HydrophobicContact CE2-CG1 3.67Å; F47-I51 HydrophobicContact CE2-CG2 3.98Å; F47-I51 HydrophobicContact CG-CB 4.36Å; F47-I51 HydrophobicContact CG-CG1 4.04Å; F47-I51 HydrophobicContact CZ-CB 4.03Å; F47-I51 HydrophobicContact CZ-CG1 4.21Å; F47-I51 HydrophobicContact CZ-CG2 3.77Å; F47-I51 WeakPolarHBondContact O-CB 3.3Å; F47-I51 PolarHBondContact O-N 3.29Å; I51-P54 HydrophobicContact CG2-CG 4.45Å; I51-L58 HydrophobicContact CD1-CD2 3.39Å; I51-L58 HydrophobicContact CG1-CD2 4.32Å; I51-E62 HydrophobicContact CD1-CB 3.62Å; I51-E62 HydrophobicContact CD1-CG 3.69Å; I51-I66 HydrophobicContact CD1-CD1 3.88Å; I51-I66 HydrophobicContact CG1-CD1 4.39Å
52	G	91.9	Very high	94.8	Very high	73 Å²	73	85.2 Å²	85.2	75%	0.753	48%	0.484	S	S	*	.	S	Bend	trans	-87.1	-31.5	177.6	0	0	0	0	0	113.4
53	K	90	Very high	94.8	Very high	182 Å²	182	89.2 Å²	89.2	79%	0.791	50%	0.502	S	S	*	.	S	Bend	trans	-133.2	98.2	179.7	-69.7	-178.4	-177	176	0	108.9	G55	K53-G55 PolarHBondContact O-N 2.97Å
54	P	89.9	Confident	94.9	Very high	108 Å²	108	92.7 Å²	92.7	70%	0.701	51%	0.512	S	S	*	.			trans	-58	125.9	179.4	-21.7	32.1	0	0	0	110.8	I51	I51-P54 HydrophobicContact CG2-CG 4.45Å
55	G	89.1	Confident	94.9	Very high	61 Å²	61	90.8 Å²	90.8	63%	0.629	50%	0.504	S	S	*	.			trans	-130.2	179.1	176.3	0	0	0	0	0	111.6	K53 S57	K53-G55 PolarHBondContact O-N 2.97Å; G55-S57 PolarHBondContact O-N 3.33Å
56	S	92.4	Very high	94.9	Very high	130 Å²	130	86 Å²	86	91%	0.909	48%	0.484	S	S	*	.	S	Bend	trans	-72.1	-8.7	174.1	55.8	0	0	0	0	113.4
57	S	93.6	Very high	94.8	Very high	90 Å²	90	88.4 Å²	88.4	63%	0.629	50%	0.504	S	S	*	.	S	Bend	trans	-151.5	147.2	-173.9	-48.8	0	0	0	0	109	G55	G55-S57 PolarHBondContact O-N 3.33Å
58	L	93.6	Very high	94.9	Very high	78 Å²	78	88.6 Å²	88.6	41%	0.408	51%	0.507	S	S	.	.			trans	-82	129.8	173	-62.8	173.1	0	0	0	109.2	I51 E62 Q63 I66	I51-L58 HydrophobicContact CD1-CD2 3.39Å; I51-L58 HydrophobicContact CG1-CD2 4.32Å; L58-E62 WeakPolarHBondContact CA-OE2 3.21Å; L58-E62 HydrophobicContact CB-CB 4.39Å; L58-E62 HydrophobicContact CD2-CB 4.27Å; L58-Q63 HydrophobicContact CB-CG 3.61Å; L58-Q63 HydrophobicContact CD1-CG 4.24Å; L58-I66 HydrophobicContact CD1-CD1 3.87Å; L58-I66 HydrophobicContact CD2-CD1 4.01Å
59	D	93.4	Very high	95	Very high	81 Å²	81	81.6 Å²	81.6	43%	0.433	48%	0.48	S	S	.	.			trans	-72.8	167.2	169.8	81.1	32.4	0	0	0	111.3	S61 E62 Q63	D59-S61 PolarHBondContact O-N 3.49Å; D59-S61 VanDerWaalsContact OD1-CA 3.28Å; D59-S61 WeakPolarHBondContact OD1-CA 3.42Å; D59-S61 VanDerWaalsContact OD1-CB 3.3Å; D59-S61 WeakPolarHBondContact OD1-CB 3.44Å; D59-S61 PolarHBondContact OD1-N 3.22Å; D59-S61 PolarHBondContact OD1-OG 2.79Å; D59-S61 PolarHBondContact OD2-OG 3.47Å; D59-E62 PolarHBondContact N-OE2 3.36Å; D59-E62 PolarHBondContact O-N 2.96Å; D59-E62 WeakPolarHBondContact OD1-CG 3.31Å; D59-E62 PolarHBondContact OD1-N 3.45Å; D59-Q63 WeakPolarHBondContact O-CG 3.47Å; D59-Q63 PolarHBondContact O-N 3.41Å
60	N	96.4	Very high	95	Very high	129 Å²	129	76.8 Å²	76.8	69%	0.69	46%	0.461	S	S	*	.	H	α-helix	trans	-62.7	-29	-176.7	-168.5	51.1	0	0	0	113	K64	N60-K64 WeakPolarHBondContact O-CB 3Å; N60-K64 PolarHBondContact O-N 2.95Å; N60-K64 VanDerWaalsContact O-N 3.15Å
61	S	95.6	Very high	94.9	Very high	79 Å²	79	80.8 Å²	80.8	55%	0.552	48%	0.481	S	S	*	.	H	α-helix	trans	-75.6	-39.5	178	77.5	0	0	0	0	111.7	D59 K64 C65	D59-S61 PolarHBondContact O-N 3.49Å; D59-S61 VanDerWaalsContact OD1-CA 3.28Å; D59-S61 WeakPolarHBondContact OD1-CA 3.42Å; D59-S61 VanDerWaalsContact OD1-CB 3.3Å; D59-S61 WeakPolarHBondContact OD1-CB 3.44Å; D59-S61 PolarHBondContact OD1-N 3.22Å; D59-S61 PolarHBondContact OD1-OG 2.79Å; D59-S61 PolarHBondContact OD2-OG 3.47Å; S61-K64 PolarHBondContact O-N 2.97Å; S61-C65 WeakPolarHBondContact O-CB 3.42Å; S61-C65 PolarHBondContact O-N 3.31Å
62	E	96.6	Very high	94.9	Very high	18 Å²	18	88.2 Å²	88.2	8%	0.084	51%	0.508	C	S	.	.	H	α-helix	trans	-64.6	-46	174.3	-70.7	-179.5	141.9	0	0	111.1	I51 L58 D59 K64 C65 I66	I51-E62 HydrophobicContact CD1-CB 3.62Å; I51-E62 HydrophobicContact CD1-CG 3.69Å; L58-E62 WeakPolarHBondContact CA-OE2 3.21Å; L58-E62 HydrophobicContact CB-CB 4.39Å; L58-E62 HydrophobicContact CD2-CB 4.27Å; D59-E62 PolarHBondContact N-OE2 3.36Å; D59-E62 PolarHBondContact O-N 2.96Å; D59-E62 WeakPolarHBondContact OD1-CG 3.31Å; D59-E62 PolarHBondContact OD1-N 3.45Å; E62-K64 PolarHBondContact O-N 3.18Å; E62-C65 PolarHBondContact O-N 2.87Å; E62-I66 WeakPolarHBondContact O-CB 3.25Å; E62-I66 WeakPolarHBondContact O-CG1 3.48Å; E62-I66 PolarHBondContact O-N 3.34Å
63	Q	95.7	Very high	95.2	Very high	99 Å²	99	86.8 Å²	86.8	46%	0.463	48%	0.48	S	S	.	.	H	α-helix	trans	-57.8	-49	174.9	-71.8	179	-18.7	0	0	111.6	L58 D59 C65 I66 A67	L58-Q63 HydrophobicContact CB-CG 3.61Å; L58-Q63 HydrophobicContact CD1-CG 4.24Å; D59-Q63 WeakPolarHBondContact O-CG 3.47Å; D59-Q63 PolarHBondContact O-N 3.41Å; Q63-C65 PolarHBondContact O-N 2.85Å; Q63-I66 PolarHBondContact O-N 3.43Å; Q63-A67 PolarHBondContact O-N 2.87Å
64	K	97.8	Very high	95.4	Very high	140 Å²	140	81.6 Å²	81.6	61%	0.609	46%	0.46	S	S	*	.	H	α-helix	trans	-63.1	-41.7	178.1	-171.7	177	-179.4	178.8	0	111.7	N60 S61 E62 A67 M68	N60-K64 WeakPolarHBondContact O-CB 3Å; N60-K64 PolarHBondContact O-N 2.95Å; N60-K64 VanDerWaalsContact O-N 3.15Å; S61-K64 PolarHBondContact O-N 2.97Å; E62-K64 PolarHBondContact O-N 3.18Å; K64-A67 PolarHBondContact O-N 3.47Å; K64-M68 HydrophobicContact CG-CE 4.21Å; K64-M68 WeakPolarHBondContact O-CG 3.27Å; K64-M68 PolarHBondContact O-N 3.36Å; K64-M68 VanDerWaalsContact O-N 3.15Å
65	C	98	Very high	95.7	Very high	37 Å²	37	79.8 Å²	79.8	25%	0.25	44%	0.444	C	S	.	.	H	α-helix	trans	-61.4	-46.3	176.1	-176.9	0	0	0	0	111.5	C50 S61 E62 Q63 A67 M68 C69	C50-C65 WeakPolarHBondContact CA-SG 3.48Å; C50-C65 HydrophobicContact CB-CB 3.59Å; C50-C65 WeakPolarHBondContact CB-SG 3.05Å; C50-C65 WeakPolarHBondContact SG-CB 3.3Å; C50-C65 PolarHBondContact SG-O 3.43Å; C50-C65 VanDerWaalsContact SG-O 3.33Å; C50-C65 CovalentContact SG-SG 2.04Å; C50-C65 PolarHBondContact SG-SG 3.24Å; S61-C65 WeakPolarHBondContact O-CB 3.42Å; S61-C65 PolarHBondContact O-N 3.31Å; E62-C65 PolarHBondContact O-N 2.87Å; Q63-C65 PolarHBondContact O-N 2.85Å; C65-A67 PolarHBondContact O-N 3.29Å; C65-M68 PolarHBondContact O-N 3.46Å; C65-C69 VanDerWaalsContact O-CB 3.27Å; C65-C69 WeakPolarHBondContact O-CB 3.43Å; C65-C69 PolarHBondContact O-N 2.92Å
66	I	97.3	Very high	96.1	Very high	28 Å²	28	79.5 Å²	79.5	14%	0.144	44%	0.436	C	S	.	.	H	α-helix	trans	-60.4	-47.2	179.4	-74.3	169	0	0	0	110.7	C50 I51 L58 E62 Q63 M68 C69 M70	C50-I66 HydrophobicContact CB-CG1 3.87Å; I51-I66 HydrophobicContact CD1-CD1 3.88Å; I51-I66 HydrophobicContact CG1-CD1 4.39Å; L58-I66 HydrophobicContact CD1-CD1 3.87Å; L58-I66 HydrophobicContact CD2-CD1 4.01Å; E62-I66 WeakPolarHBondContact O-CB 3.25Å; E62-I66 WeakPolarHBondContact O-CG1 3.48Å; E62-I66 PolarHBondContact O-N 3.34Å; Q63-I66 PolarHBondContact O-N 3.43Å; I66-M68 PolarHBondContact O-N 3.13Å; I66-C69 WeakPolarHBondContact O-CB 3.45Å; I66-C69 PolarHBondContact O-N 3.48Å; I66-C69 VanDerWaalsContact O-N 3.14Å; I66-M70 HydrophobicContact CG2-CE 3.63Å; I66-M70 HydrophobicContact CG2-CG 4.24Å; I66-M70 HydrophobicContact CG2-SD 3.88Å; I66-M70 WeakPolarHBondContact O-CG 3.49Å; I66-M70 PolarHBondContact O-N 2.05Å
67	A	96	Very high	96.2	Very high	52 Å²	52	78.3 Å²	78.3	43%	0.43	41%	0.411	S	S	.	.	H	α-helix	trans	-56	-51.6	178.1	0	0	0	0	0	111.4	Q63 K64 C65 C69 M70 D71	Q63-A67 PolarHBondContact O-N 2.87Å; K64-A67 PolarHBondContact O-N 3.47Å; C65-A67 PolarHBondContact O-N 3.29Å; A67-C69 VanDerWaalsContact C-N 3.3Å; A67-C69 PolarHBondContact O-N 3.01Å; A67-M70 PolarHBondContact O-N 3.38Å; A67-D71 PolarHBondContact O-N 2.84Å; A67-D71 VanDerWaalsContact O-N 3.09Å
68	M	98.1	Very high	96.2	Very high	104 Å²	104	76.3 Å²	76.3	51%	0.512	39%	0.394	S	S	.	.	H	α-helix	trans	-61.9	-37.8	176.8	-66.2	-175.7	-58.6	0	0	112.5	K64 C65 I66 R72	K64-M68 HydrophobicContact CG-CE 4.21Å; K64-M68 WeakPolarHBondContact O-CG 3.27Å; K64-M68 PolarHBondContact O-N 3.36Å; K64-M68 VanDerWaalsContact O-N 3.15Å; C65-M68 PolarHBondContact O-N 3.46Å; I66-M68 PolarHBondContact O-N 3.13Å; M68-R72 WeakPolarHBondContact O-CB 3.24Å; M68-R72 VanDerWaalsContact O-CG 3.26Å; M68-R72 WeakPolarHBondContact O-CG 3.2Å; M68-R72 PolarHBondContact O-N 3.24Å
69	C	98.2	Very high	96.3	Very high	26 Å²	26	76.7 Å²	76.7	18%	0.176	40%	0.399	C	S	.	.	H	α-helix	trans	-65.3	-45.6	178.8	177	0	0	0	0	111.8	C46 C65 I66 A67 R72 Y73	C46-C69 WeakPolarHBondContact CA-SG 3.33Å; C46-C69 HydrophobicContact CB-CB 3.76Å; C46-C69 WeakPolarHBondContact CB-SG 3.02Å; C46-C69 WeakPolarHBondContact SG-CB 3.37Å; C46-C69 CovalentContact SG-SG 2.05Å; C46-C69 PolarHBondContact SG-SG 3.32Å; C65-C69 VanDerWaalsContact O-CB 3.27Å; C65-C69 WeakPolarHBondContact O-CB 3.43Å; C65-C69 PolarHBondContact O-N 2.92Å; I66-C69 WeakPolarHBondContact O-CB 3.45Å; I66-C69 PolarHBondContact O-N 3.48Å; I66-C69 VanDerWaalsContact O-N 3.14Å; A67-C69 VanDerWaalsContact C-N 3.3Å; A67-C69 PolarHBondContact O-N 3.01Å; C69-R72 PolarHBondContact O-N 2.04Å; C69-Y73 VanDerWaalsContact O-CB 3.3Å; C69-Y73 WeakPolarHBondContact O-CB 3.34Å; C69-Y73 PolarHBondContact O-N 2.86Å
70	M	96.4	Very high	96.5	Very high	64 Å²	64	77.4 Å²	77.4	32%	0.315	41%	0.407	S	S	.	.	H	α-helix	trans	-62.3	-45.2	178.7	-71.9	-179.8	171.4	0	0	110.9	M42 I66 A67 R72 Y73 M74	M42-M70 HydrophobicContact CE-CE 4.45Å; M42-M70 HydrophobicContact CE-CG 4.16Å; M42-M70 HydrophobicContact CE-SD 4.33Å; M42-M70 HydrophobicContact CG-CG 4.22Å; M42-M70 HydrophobicContact SD-CB 4.03Å; M42-M70 HydrophobicContact SD-CG 3.98Å; I66-M70 HydrophobicContact CG2-CE 3.63Å; I66-M70 HydrophobicContact CG2-CG 4.24Å; I66-M70 HydrophobicContact CG2-SD 3.88Å; I66-M70 WeakPolarHBondContact O-CG 3.49Å; I66-M70 PolarHBondContact O-N 2.05Å; A67-M70 PolarHBondContact O-N 3.38Å; M70-R72 PolarHBondContact O-N 3.07Å; M70-Y73 PolarHBondContact O-N 3.35Å; M70-M74 WeakPolarHBondContact O-CG 3.37Å; M70-M74 PolarHBondContact O-N 2.84Å
71	D	95.9	Very high	96.4	Very high	101 Å²	101	72.9 Å²	72.9	54%	0.54	39%	0.385	S	S	.	.	H	α-helix	trans	-56.8	-51.1	175.9	-69.6	-21.7	0	0	0	111.3	A67 Y73 M74 D75	A67-D71 PolarHBondContact O-N 2.84Å; A67-D71 VanDerWaalsContact O-N 3.09Å; D71-Y73 VanDerWaalsContact C-N 3.33Å; D71-Y73 PolarHBondContact O-N 3.31Å; D71-M74 PolarHBondContact O-N 2.75Å; D71-D75 PolarHBondContact O-N 2.86Å
72	R	97.5	Very high	96.3	Very high	172 Å²	172	77.2 Å²	77.2	65%	0.649	39%	0.389	S	S	*	.	H	α-helix	trans	-64.5	-35.4	178.6	-68.4	-62.1	87.3	156.9	5.8	113.2	M68 C69 M70 D75 A76	M68-R72 WeakPolarHBondContact O-CB 3.24Å; M68-R72 VanDerWaalsContact O-CG 3.26Å; M68-R72 WeakPolarHBondContact O-CG 3.2Å; M68-R72 PolarHBondContact O-N 3.24Å; C69-R72 PolarHBondContact O-N 2.04Å; M70-R72 PolarHBondContact O-N 3.07Å; R72-D75 IonicContact CZ-OD2 3.11Å; R72-D75 IonicContact NE-OD2 3.26Å; R72-D75 PolarHBondContact NE-OD2 3.45Å; R72-D75 IonicContact NH2-OD2 2.61Å; R72-D75 PolarHBondContact NH2-OD2 3.09Å; R72-A76 WeakPolarHBondContact O-CB 3.31Å; R72-A76 PolarHBondContact O-N 2.89Å
73	Y	97.4	Very high	96.3	Very high	44 Å²	44	80.1 Å²	80.1	17%	0.173	41%	0.408	C	S	.	.	H	α-helix	trans	-65	-45.5	176.6	-177	-92.1	0	0	0	111.1	L38 M42 K45 C69 M70 D71 A76 W77	L38-Y73 HydrophobicContact CD1-CE1 3.67Å; M42-Y73 HydrophobicContact CB-CD1 3.6Å; M42-Y73 HydrophobicContact CB-CE1 3.54Å; M42-Y73 HydrophobicContact CB-CG 4.23Å; M42-Y73 HydrophobicContact CG-CD1 3.44Å; M42-Y73 VanDerWaalsContact CG-CD1 3.44Å; M42-Y73 HydrophobicContact CG-CE1 3.96Å; M42-Y73 HydrophobicContact CG-CG 3.81Å; M42-Y73 HydrophobicContact SD-CD1 3.72Å; M42-Y73 HydrophobicContact SD-CE1 4.43Å; M42-Y73 HydrophobicContact SD-CG 4.4Å; K45-Y73 HydrophobicContact CD-CD2 3.89Å; K45-Y73 HydrophobicContact CD-CE2 3.4Å; K45-Y73 VanDerWaalsContact CD-CE2 3.4Å; C69-Y73 VanDerWaalsContact O-CB 3.3Å; C69-Y73 WeakPolarHBondContact O-CB 3.34Å; C69-Y73 PolarHBondContact O-N 2.86Å; M70-Y73 PolarHBondContact O-N 3.35Å; D71-Y73 VanDerWaalsContact C-N 3.33Å; D71-Y73 PolarHBondContact O-N 3.31Å; Y73-A76 PolarHBondContact O-N 2.96Å; Y73-W77 WeakPolarHBondContact O-CB 3.28Å; Y73-W77 PolarHBondContact O-N 2.87Å
74	M	95	Very high	96.3	Very high	72 Å²	72	82.5 Å²	82.5	36%	0.355	41%	0.414	S	S	.	.	H	α-helix	trans	-65	-39.2	178.2	-71.3	-61.4	-78.4	0	0	112	L38 M42 M70 D71 W77 N78	L38-M74 HydrophobicContact CD2-SD 4.36Å; M42-M74 HydrophobicContact SD-CG 4.08Å; M42-M74 HydrophobicContact SD-SD 4.22Å; M70-M74 WeakPolarHBondContact O-CG 3.37Å; M70-M74 PolarHBondContact O-N 2.84Å; D71-M74 PolarHBondContact O-N 2.75Å; M74-W77 PolarHBondContact O-N 2.89Å; M74-N78 VanDerWaalsContact O-CB 3.27Å; M74-N78 WeakPolarHBondContact O-CB 3.37Å; M74-N78 VanDerWaalsContact O-CG 3.28Å; M74-N78 PolarHBondContact O-N 2.9Å; M74-N78 PolarHBondContact O-ND2 3.36Å; M74-N78 VanDerWaalsContact O-ND2 3.07Å
75	D	96.2	Very high	96.2	Very high	70 Å²	70	79.4 Å²	79.4	37%	0.374	40%	0.404	S	S	.	.	H	α-helix	trans	-62.2	-45.4	174.6	-71.1	-32	0	0	0	112.4	D71 R72 N78 T79	D71-D75 PolarHBondContact O-N 2.86Å; R72-D75 IonicContact CZ-OD2 3.11Å; R72-D75 IonicContact NE-OD2 3.26Å; R72-D75 PolarHBondContact NE-OD2 3.45Å; R72-D75 IonicContact NH2-OD2 2.61Å; R72-D75 PolarHBondContact NH2-OD2 3.09Å; D75-N78 PolarHBondContact O-N 2.92Å; D75-T79 WeakPolarHBondContact O-CB 3.43Å; D75-T79 PolarHBondContact O-N 3.02Å; D75-T79 PolarHBondContact O-OG1 2.83Å
76	A	96.4	Very high	96	Very high	55 Å²	55	80.1 Å²	80.1	46%	0.455	41%	0.41	S	S	.	.	H	α-helix	trans	-63	-46.1	176.1	0	0	0	0	0	111.2	R72 Y73 N78 T79 V80	R72-A76 WeakPolarHBondContact O-CB 3.31Å; R72-A76 PolarHBondContact O-N 2.89Å; Y73-A76 PolarHBondContact O-N 2.96Å; A76-N78 PolarHBondContact O-N 2.83Å; A76-T79 PolarHBondContact O-N 2.7Å; A76-V80 WeakPolarHBondContact O-CG2 3.3Å; A76-V80 PolarHBondContact O-N 2.88Å
77	W	94.6	Very high	96	Very high	105 Å²	105	85.7 Å²	85.7	40%	0.398	43%	0.429	S	S	.	.	H	α-helix	trans	-60.8	-46	178.1	-177.9	85.9	0	0	0	111.8	L38 Y73 M74 T79 V80 S81	L38-W77 VanDerWaalsContact CD1-CD1 3.46Å; L38-W77 HydrophobicContact CD1-CD2 4.21Å; L38-W77 HydrophobicContact CD1-CG 3.9Å; L38-W77 HydrophobicContact CD2-CD2 4.19Å; L38-W77 HydrophobicContact CD2-CH2 4.49Å; L38-W77 HydrophobicContact CD2-CZ2 4.15Å; Y73-W77 WeakPolarHBondContact O-CB 3.28Å; Y73-W77 PolarHBondContact O-N 2.87Å; M74-W77 PolarHBondContact O-N 2.89Å; W77-T79 VanDerWaalsContact C-N 3.3Å; W77-T79 PolarHBondContact O-N 2.89Å; W77-V80 PolarHBondContact O-N 3.34Å; W77-S81 WeakPolarHBondContact O-CB 3.32Å; W77-S81 PolarHBondContact O-N 3.1Å
78	N	94.1	Very high	95.9	Very high	48 Å²	48	85.6 Å²	85.6	26%	0.257	42%	0.421	S	S	.	.	H	α-helix	trans	-60.4	-40.7	176.9	-82.5	-40.2	0	0	0	112.2	M74 D75 A76 R82	M74-N78 VanDerWaalsContact O-CB 3.27Å; M74-N78 WeakPolarHBondContact O-CB 3.37Å; M74-N78 VanDerWaalsContact O-CG 3.28Å; M74-N78 PolarHBondContact O-N 2.9Å; M74-N78 PolarHBondContact O-ND2 3.36Å; M74-N78 VanDerWaalsContact O-ND2 3.07Å; D75-N78 PolarHBondContact O-N 2.92Å; A76-N78 PolarHBondContact O-N 2.83Å; N78-R82 WeakPolarHBondContact O-CB 3.49Å; N78-R82 WeakPolarHBondContact O-CG 3.36Å; N78-R82 PolarHBondContact O-N 2.96Å
79	T	96.7	Very high	95.7	Very high	86 Å²	86	85.7 Å²	85.7	53%	0.528	42%	0.42	S	S	.	.	H	α-helix	trans	-64.9	-51.2	178.4	-59.5	0	0	0	0	110.4	D75 A76 W77 S81 R82 T83	D75-T79 WeakPolarHBondContact O-CB 3.43Å; D75-T79 PolarHBondContact O-N 3.02Å; D75-T79 PolarHBondContact O-OG1 2.83Å; A76-T79 PolarHBondContact O-N 2.7Å; W77-T79 VanDerWaalsContact C-N 3.3Å; W77-T79 PolarHBondContact O-N 2.89Å; T79-S81 PolarHBondContact O-N 2.88Å; T79-R82 PolarHBondContact O-N 3.4Å; T79-T83 PolarHBondContact O-N 2.91Å; T79-T83 PolarHBondContact O-OG1 3.46Å; T79-T83 VanDerWaalsContact O-OG1 3.11Å
80	V	96.4	Very high	95.5	Very high	97 Å²	97	90.8 Å²	90.8	59%	0.588	44%	0.436	S	S	*	.	H	α-helix	trans	-61.6	-44.5	178.3	173.7	0	0	0	0	111.1	A76 W77 R82 T83 Y84	A76-V80 WeakPolarHBondContact O-CG2 3.3Å; A76-V80 PolarHBondContact O-N 2.88Å; W77-V80 PolarHBondContact O-N 3.34Å; V80-R82 PolarHBondContact O-N 3.3Å; V80-T83 PolarHBondContact O-N 2.99Å; V80-Y84 WeakPolarHBondContact O-CB 3.35Å; V80-Y84 PolarHBondContact O-N 2.88Å
81	S	93.8	Very high	95.5	Very high	34 Å²	34	92 Å²	92	24%	0.238	44%	0.441	C	S	.	.	H	α-helix	trans	-60	-46.5	179.2	-178.1	0	0	0	0	111.6	W77 T79 Y84 N85	W77-S81 WeakPolarHBondContact O-CB 3.32Å; W77-S81 PolarHBondContact O-N 3.1Å; T79-S81 PolarHBondContact O-N 2.88Å; S81-Y84 PolarHBondContact O-N 2.86Å; S81-N85 WeakPolarHBondContact O-CB 3.32Å; S81-N85 PolarHBondContact O-N 3.36Å; S81-N85 PolarHBondContact O-ND2 3.49Å; S81-N85 PolarHBondContact OG-ND2 2.81Å
82	R	94.8	Very high	95.3	Very high	169 Å²	169	94.2 Å²	94.2	64%	0.638	44%	0.441	S	S	*	.	H	α-helix	trans	-61.8	-47.3	176.5	-76.7	-175.6	-113	-96.1	7.2	112	N78 T79 V80 S86	N78-R82 WeakPolarHBondContact O-CB 3.49Å; N78-R82 WeakPolarHBondContact O-CG 3.36Å; N78-R82 PolarHBondContact O-N 2.96Å; T79-R82 PolarHBondContact O-N 3.4Å; V80-R82 PolarHBondContact O-N 3.3Å; R82-S86 WeakPolarHBondContact O-CB 3.49Å; R82-S86 PolarHBondContact O-N 3.48Å
83	T	96.9	Very high	94.9	Very high	79 Å²	79	90 Å²	90	49%	0.485	44%	0.444	S	S	.	.	H	α-helix	trans	-64	-44.9	179.8	-57	0	0	0	0	111.4	T79 V80 S86 R87	T79-T83 PolarHBondContact O-N 2.91Å; T79-T83 PolarHBondContact O-OG1 3.46Å; T79-T83 VanDerWaalsContact O-OG1 3.11Å; V80-T83 PolarHBondContact O-N 2.99Å; T83-S86 PolarHBondContact O-N 3.28Å; T83-R87 WeakPolarHBondContact O-CG 3.38Å; T83-R87 PolarHBondContact O-N 3.45Å
84	Y	95.9	Very high	94.5	Very high	150 Å²	150	96.8 Å²	96.8	59%	0.588	47%	0.469	S	S	*	.	H	α-helix	trans	-60.4	-49.4	178.3	178.2	-104.7	0	0	0	111.5	V80 S81 S86 R87 L88	V80-Y84 WeakPolarHBondContact O-CB 3.35Å; V80-Y84 PolarHBondContact O-N 2.88Å; S81-Y84 PolarHBondContact O-N 2.86Å; Y84-S86 PolarHBondContact O-N 3.32Å; Y84-R87 PolarHBondContact O-N 3.33Å; Y84-L88 HydrophobicContact CE1-CD2 4.49Å; Y84-L88 WeakPolarHBondContact O-CB 3.08Å; Y84-L88 PolarHBondContact O-N 3.49Å
85	N	94.3	Very high	93.1	Very high	74 Å²	74	103.5 Å²	103.5	40%	0.396	50%	0.502	S	S	.	.	H	α-helix	trans	-60.9	-43.5	176.7	-80.4	-68.4	0	0	0	111.8	S81 R87 L88 Q89	S81-N85 WeakPolarHBondContact O-CB 3.32Å; S81-N85 PolarHBondContact O-N 3.36Å; S81-N85 PolarHBondContact O-ND2 3.49Å; S81-N85 PolarHBondContact OG-ND2 2.81Å; N85-R87 VanDerWaalsContact C-N 3.3Å; N85-R87 PolarHBondContact O-N 3.14Å; N85-L88 PolarHBondContact O-N 3.03Å; N85-Q89 WeakPolarHBondContact O-CG 3.48Å; N85-Q89 PolarHBondContact O-N 3.23Å
86	S	95	Very high	92.9	Very high	53 Å²	53	105.2 Å²	105.2	37%	0.371	51%	0.509	S	S	.	.	H	α-helix	trans	-59.6	-40.5	176.7	-173.3	0	0	0	0	112.3	R82 T83 Y84 R90	R82-S86 WeakPolarHBondContact O-CB 3.49Å; R82-S86 PolarHBondContact O-N 3.48Å; T83-S86 PolarHBondContact O-N 3.28Å; Y84-S86 PolarHBondContact O-N 3.32Å; S86-R90 WeakPolarHBondContact O-CG 3.28Å; S86-R90 PolarHBondContact O-N 2.99Å
87	R	95.8	Very high	92.8	Very high	144 Å²	144	107.8 Å²	107.8	54%	0.543	51%	0.511	S	S	.	.	H	α-helix	trans	-66.7	-46.6	175	-69.6	-70.9	-175.2	-172.1	0.4	111.6	T83 Y84 N85 Q89 R90 E91	T83-R87 WeakPolarHBondContact O-CG 3.38Å; T83-R87 PolarHBondContact O-N 3.45Å; Y84-R87 PolarHBondContact O-N 3.33Å; N85-R87 VanDerWaalsContact C-N 3.3Å; N85-R87 PolarHBondContact O-N 3.14Å; R87-Q89 VanDerWaalsContact C-N 3.3Å; R87-Q89 PolarHBondContact O-N 3.48Å; R87-R90 PolarHBondContact O-N 3.15Å; R87-R90 VanDerWaalsContact O-N 3.09Å; R87-E91 PolarHBondContact O-N 3.23Å
88	L	95.3	Very high	92.7	Very high	50 Å²	50	108 Å²	108	26%	0.262	52%	0.518	S	S	.	.	H	α-helix	trans	-56.9	-43	179.7	-178.7	62.5	0	0	0	112.2	Y84 N85 E91 R92	Y84-L88 HydrophobicContact CE1-CD2 4.49Å; Y84-L88 WeakPolarHBondContact O-CB 3.08Å; Y84-L88 PolarHBondContact O-N 3.49Å; N85-L88 PolarHBondContact O-N 3.03Å; L88-E91 PolarHBondContact O-N 3.45Å; L88-R92 WeakPolarHBondContact O-CB 3.37Å; L88-R92 WeakPolarHBondContact O-CG 3.43Å; L88-R92 PolarHBondContact O-N 3.26Å
89	Q	93.2	Very high	92.6	Very high	106 Å²	106	111.5 Å²	111.5	50%	0.495	53%	0.533	S	S	.	.	H	α-helix	trans	-65	-38.8	177.4	-63.5	-58.8	-19.5	0	0	112.3	N85 R87 R92 A93	N85-Q89 WeakPolarHBondContact O-CG 3.48Å; N85-Q89 PolarHBondContact O-N 3.23Å; R87-Q89 VanDerWaalsContact C-N 3.3Å; R87-Q89 PolarHBondContact O-N 3.48Å; Q89-R92 PolarHBondContact O-N 2.77Å; Q89-A93 WeakPolarHBondContact O-CB 3.33Å; Q89-A93 PolarHBondContact O-N 3.23Å
90	R	94.4	Very high	92.3	Very high	134 Å²	134	113.1 Å²	113.1	51%	0.506	53%	0.533	S	S	.	.	H	α-helix	trans	-66.3	-41.7	177	-69.2	174.5	-168.4	-172.9	3.1	112.2	S86 R87 A93 R94	S86-R90 WeakPolarHBondContact O-CG 3.28Å; S86-R90 PolarHBondContact O-N 2.99Å; R87-R90 PolarHBondContact O-N 3.15Å; R87-R90 VanDerWaalsContact O-N 3.09Å; R90-A93 PolarHBondContact O-N 2.98Å; R90-R94 WeakPolarHBondContact O-CG 3.3Å; R90-R94 PolarHBondContact O-N 2.79Å
91	E	95.3	Very high	92	Very high	90 Å²	90	114.2 Å²	114.2	42%	0.421	53%	0.53	S	S	.	.	H	α-helix	trans	-68.1	-38.1	177.5	-65.2	-53.3	138.3	0	0	111.5	R87 L88 A93 R94 M95	R87-E91 PolarHBondContact O-N 3.23Å; L88-E91 PolarHBondContact O-N 3.45Å; E91-A93 VanDerWaalsContact C-N 3.31Å; E91-A93 PolarHBondContact O-N 2.6Å; E91-R94 PolarHBondContact O-N 2.93Å; E91-R94 IonicContact OE1-NH1 2.92Å; E91-R94 PolarHBondContact OE1-NH1 3.15Å; E91-R94 IonicContact OE2-NH1 3.95Å; E91-M95 PolarHBondContact O-N 3.42Å
92	R	92	Very high	91.9	Very high	146 Å²	146	119.9 Å²	119.9	55%	0.551	55%	0.551	S	S	*	*	H	α-helix	trans	-63.3	-34.3	172.7	-75.9	177.8	178.9	179.5	-0.3	113.4	L88 Q89 R94 M95	L88-R92 WeakPolarHBondContact O-CB 3.37Å; L88-R92 WeakPolarHBondContact O-CG 3.43Å; L88-R92 PolarHBondContact O-N 3.26Å; Q89-R92 PolarHBondContact O-N 2.77Å; R92-R94 VanDerWaalsContact C-N 3.29Å; R92-M95 PolarHBondContact O-N 3.31Å
93	A	90	Very high	91.7	Very high	85 Å²	85	116.2 Å²	116.2	70%	0.702	54%	0.544	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78	-13	177.6	0	0	0	0	0	113.9	Q89 R90 E91	Q89-A93 WeakPolarHBondContact O-CB 3.33Å; Q89-A93 PolarHBondContact O-N 3.23Å; R90-A93 PolarHBondContact O-N 2.98Å; E91-A93 VanDerWaalsContact C-N 3.31Å; E91-A93 PolarHBondContact O-N 2.6Å
94	R	88.1	Confident	91.3	Very high	186 Å²	186	119.3 Å²	119.3	70%	0.702	55%	0.549	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.7	-9.6	174.3	-75	171.9	172.5	174.2	-8.9	112.9	R90 E91 R92	R90-R94 WeakPolarHBondContact O-CG 3.3Å; R90-R94 PolarHBondContact O-N 2.79Å; E91-R94 PolarHBondContact O-N 2.93Å; E91-R94 IonicContact OE1-NH1 2.92Å; E91-R94 PolarHBondContact OE1-NH1 3.15Å; E91-R94 IonicContact OE2-NH1 3.95Å; R92-R94 VanDerWaalsContact C-N 3.29Å
95	M	66	Low	90.9	Very high	213 Å²	213	116.5 Å²	116.5	100%	1.049	55%	0.545	S	S	*	.			trans	-92.3	0	173.9	-133.1	177.1	-73.8	0	0	109	E91 R92	E91-M95 PolarHBondContact O-N 3.42Å; R92-M95 PolarHBondContact O-N 3.31Å

Retrieved 95 of 95 residues in 108.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).