A0A087Y4U2_POEFO Loading...

Anaphase-promoting complex subunit 13

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains. The APC/C complex catalyzes assembly of branched 'Lys-11'-/'Lys-48'-linked branched ubiquitin chains on target proteins.

AlphaFold DB (A0A3P9MVP0), UniProt , Accession A0A087Y4U2, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 74 aa.

						>A0A087Y4U2_POEFO|A0A087Y4U2
MDSEIQRDGRVLDLTDDAWREDRLPYEDVSIPLSELPEAEQDNGGSTESVKEQEMKWTDLALQSLHENTPSSGS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	73.1	Confident	88.1	Confident	176 Å²	176	139.2 Å²	139.2	87%	0.867	70%	0.703	S	S	*	*				0	116.3	0	-116.7	146.9	70.3	0	0	105.9	S3 E4	M1-S3 PolarHBondContact O-N 3.01Å; M1-S3 VanDerWaalsContact O-N 3.1Å; M1-E4 PolarHBondContact O-N 2.71Å
2	D	83.9	Confident	88.4	Confident	177 Å²	177	134.4 Å²	134.4	95%	0.947	68%	0.68	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.6	-4.6	-173.5	-52.5	-33.7	0	0	0	112.8
3	S	91.3	Very high	88.8	Confident	101 Å²	101	135.4 Å²	135.4	71%	0.706	69%	0.688	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83	-10.9	175.1	50.9	0	0	0	0	114.3	M1	M1-S3 PolarHBondContact O-N 3.01Å; M1-S3 VanDerWaalsContact O-N 3.1Å
4	E	88.5	Confident	89.3	Confident	144 Å²	144	134.4 Å²	134.4	67%	0.673	68%	0.684	S	S	*	*	S	Bend	trans	-107.3	131	177	-83.3	-179	88.9	0	0	111.6	M1	M1-E4 PolarHBondContact O-N 2.71Å
5	I	87.7	Confident	89.7	Confident	139 Å²	139	127 Å²	127	71%	0.713	65%	0.648	S	S	*	*	P	Polyproline II helix	trans	-83	125.5	175.5	-130.6	159.3	0	0	0	109.5	R7	I5-R7 HydrophobicContact CG2-CG 4.22Å; I5-R7 PolarHBondContact O-N 3.11Å
6	Q	88	Confident	90.1	Very high	196 Å²	196	125.3 Å²	125.3	92%	0.916	64%	0.641	S	S	*	*	P	Polyproline II helix	trans	-72	118.7	170.1	-75.8	-178.9	-14.4	0	0	108.7
7	R	87.9	Confident	90.4	Very high	186 Å²	186	124.4 Å²	124.4	70%	0.702	64%	0.638	S	S	*	*	P	Polyproline II helix	trans	-87.6	142.5	174.5	-64.9	-174.9	173.6	85.8	-1.9	109.8	I5 G9 L12	I5-R7 HydrophobicContact CG2-CG 4.22Å; I5-R7 PolarHBondContact O-N 3.11Å; R7-G9 PolarHBondContact O-N 3.48Å; R7-L12 HydrophobicContact CB-CD1 4.04Å
8	D	92.8	Very high	90.8	Very high	99 Å²	99	121.4 Å²	121.4	53%	0.529	64%	0.635	S	S	.	*			trans	-71.2	113.2	174.3	-174.4	-14.7	0	0	0	110	R10 V11 L12	D8-R10 PolarHBondContact O-N 3.27Å; D8-R10 WeakPolarHBondContact OD1-CB 3.22Å; D8-R10 PolarHBondContact OD1-N 2.73Å; D8-V11 HydrophobicContact CB-CB 4.2Å; D8-V11 HydrophobicContact CB-CG2 3.88Å; D8-V11 PolarHBondContact O-N 3.18Å; D8-V11 VanDerWaalsContact O-N 3.17Å; D8-L12 PolarHBondContact O-N 3.18Å
9	G	90.4	Very high	91	Very high	48 Å²	48	123.6 Å²	123.6	50%	0.495	63%	0.634	S	S	.	*	H	α-helix	trans	-60.5	-30.5	-179.8	0	0	0	0	0	113.5	R7 L12 D13	R7-G9 PolarHBondContact O-N 3.48Å; G9-L12 PolarHBondContact O-N 3.16Å; G9-D13 PolarHBondContact O-N 3.06Å
10	R	93.9	Very high	91.2	Very high	186 Å²	186	123.5 Å²	123.5	70%	0.702	63%	0.625	S	S	*	*	H	α-helix	trans	-69.6	-37.4	177.3	-176.5	-179.7	179.2	-164.1	-0.8	111.5	D8 L12 D13 L14	D8-R10 PolarHBondContact O-N 3.27Å; D8-R10 WeakPolarHBondContact OD1-CB 3.22Å; D8-R10 PolarHBondContact OD1-N 2.73Å; R10-L12 VanDerWaalsContact C-N 3.32Å; R10-D13 PolarHBondContact O-N 3.13Å; R10-L14 HydrophobicContact CG-CD1 4.06Å; R10-L14 VanDerWaalsContact O-CG 3.29Å; R10-L14 WeakPolarHBondContact O-CG 3.48Å; R10-L14 PolarHBondContact O-N 3.11Å; R10-L14 VanDerWaalsContact O-N 3.13Å
11	V	92.1	Very high	91.5	Very high	79 Å²	79	124.9 Å²	124.9	48%	0.479	63%	0.63	S	S	.	*	H	α-helix	trans	-65.5	-41	175.4	176.4	0	0	0	0	109.9	D8 D13 L14 T15	D8-V11 HydrophobicContact CB-CB 4.2Å; D8-V11 HydrophobicContact CB-CG2 3.88Å; D8-V11 PolarHBondContact O-N 3.18Å; D8-V11 VanDerWaalsContact O-N 3.17Å; V11-D13 VanDerWaalsContact C-N 3.33Å; V11-D13 PolarHBondContact O-N 3.21Å; V11-L14 PolarHBondContact O-N 3.48Å; V11-T15 PolarHBondContact O-N 3.11Å; V11-T15 PolarHBondContact O-OG1 3.39Å; V11-T15 VanDerWaalsContact O-OG1 3.04Å
12	L	91.4	Very high	92.6	Very high	82 Å²	82	121.8 Å²	121.8	43%	0.429	62%	0.617	S	S	.	*	H	α-helix	trans	-65.3	-34.2	175.9	-63.7	178.3	0	0	0	113.1	R7 D8 G9 R10 R20	R7-L12 HydrophobicContact CB-CD1 4.04Å; D8-L12 PolarHBondContact O-N 3.18Å; G9-L12 PolarHBondContact O-N 3.16Å; R10-L12 VanDerWaalsContact C-N 3.32Å; L12-R20 PolarHBondContact O-NH2 2.99Å
13	D	93.6	Very high	93.2	Very high	147 Å²	147	123.9 Å²	123.9	79%	0.786	61%	0.611	S	S	*	*	H	α-helix	trans	-74.4	-29.4	178.9	-165.4	44.9	0	0	0	112.8	G9 R10 V11	G9-D13 PolarHBondContact O-N 3.06Å; R10-D13 PolarHBondContact O-N 3.13Å; V11-D13 VanDerWaalsContact C-N 3.33Å; V11-D13 PolarHBondContact O-N 3.21Å
14	L	96.3	Very high	93.5	Very high	121 Å²	121	126.3 Å²	126.3	63%	0.634	62%	0.616	S	S	*	*	H	α-helix	trans	-83.6	-28.7	-179.6	-71.5	171.5	0	0	0	114	R10 V11	R10-L14 HydrophobicContact CG-CD1 4.06Å; R10-L14 VanDerWaalsContact O-CG 3.29Å; R10-L14 WeakPolarHBondContact O-CG 3.48Å; R10-L14 PolarHBondContact O-N 3.11Å; R10-L14 VanDerWaalsContact O-N 3.13Å; V11-L14 PolarHBondContact O-N 3.48Å
15	T	94.3	Very high	93.8	Very high	24 Å²	24	123.9 Å²	123.9	15%	0.147	61%	0.612	C	S	.	*			trans	-85.1	120.3	-178.8	-52.3	0	0	0	0	110.3	V11 W19 R20	V11-T15 PolarHBondContact O-N 3.11Å; V11-T15 PolarHBondContact O-OG1 3.39Å; V11-T15 VanDerWaalsContact O-OG1 3.04Å; T15-W19 HydrophobicContact CG2-CB 4.07Å; T15-W19 HydrophobicContact CG2-CD2 3.88Å; T15-W19 HydrophobicContact CG2-CE3 3.59Å; T15-W19 HydrophobicContact CG2-CG 4.12Å; T15-W19 HydrophobicContact CG2-CZ3 4.26Å; T15-R20 HydrophobicContact CG2-CG 3.6Å; T15-R20 PolarHBondContact O-NH1 3.07Å; T15-R20 PolarHBondContact O-NH2 3.43Å
16	D	95.9	Very high	94.2	Very high	99 Å²	99	128.3 Å²	128.3	53%	0.529	62%	0.622	S	S	.	*			trans	-80.9	170.4	171.6	67.3	14.6	0	0	0	112.2	A18 W19 R20	D16-A18 VanDerWaalsContact C-N 3.31Å; D16-A18 PolarHBondContact O-N 3.46Å; D16-A18 PolarHBondContact OD1-N 2.9Å; D16-W19 PolarHBondContact O-N 3.36Å; D16-W19 WeakPolarHBondContact OD1-CB 3.41Å; D16-W19 PolarHBondContact OD1-N 3.26Å; D16-R20 WeakPolarHBondContact O-CG 3.39Å; D16-R20 PolarHBondContact O-N 3.26Å; D16-R20 VanDerWaalsContact O-N 3.12Å
17	D	95.9	Very high	94.6	Very high	110 Å²	110	126.7 Å²	126.7	59%	0.588	61%	0.614	S	S	*	*	H	α-helix	trans	-69.3	-32	-175.5	-63.9	-25.6	0	0	0	112.2	W19 R20 E21	D17-W19 PolarHBondContact O-N 3.3Å; D17-R20 PolarHBondContact O-N 3.22Å; D17-R20 IonicContact OD1-NH1 2.74Å; D17-R20 PolarHBondContact OD1-NH1 3.24Å; D17-E21 WeakPolarHBondContact O-CG 3.44Å; D17-E21 PolarHBondContact O-N 3.29Å
18	A	96.7	Very high	94.9	Very high	71 Å²	71	125.6 Å²	125.6	59%	0.587	62%	0.622	S	S	*	*	H	α-helix	trans	-61.7	-44.6	176	0	0	0	0	0	111.6	D16 E21 D22	D16-A18 VanDerWaalsContact C-N 3.31Å; D16-A18 PolarHBondContact O-N 3.46Å; D16-A18 PolarHBondContact OD1-N 2.9Å; A18-E21 PolarHBondContact O-N 3.16Å; A18-D22 PolarHBondContact O-N 3.41Å
19	W	96.1	Very high	94.9	Very high	164 Å²	164	126.2 Å²	126.2	62%	0.621	63%	0.629	S	S	*	*	H	α-helix	trans	-71.2	-31.8	177.5	-173.8	20.4	0	0	0	112.6	T15 D16 D17 E21 D22	T15-W19 HydrophobicContact CG2-CB 4.07Å; T15-W19 HydrophobicContact CG2-CD2 3.88Å; T15-W19 HydrophobicContact CG2-CE3 3.59Å; T15-W19 HydrophobicContact CG2-CG 4.12Å; T15-W19 HydrophobicContact CG2-CZ3 4.26Å; D16-W19 PolarHBondContact O-N 3.36Å; D16-W19 WeakPolarHBondContact OD1-CB 3.41Å; D16-W19 PolarHBondContact OD1-N 3.26Å; D17-W19 PolarHBondContact O-N 3.3Å; W19-E21 VanDerWaalsContact C-N 3.28Å; W19-E21 PolarHBondContact O-N 2.96Å; W19-D22 PolarHBondContact O-N 3.08Å
20	R	94.3	Very high	95.2	Very high	120 Å²	120	129.4 Å²	129.4	45%	0.453	64%	0.644	S	S	.	*	H	α-helix	trans	-64	-35	173.6	-74.9	179	176.2	110.5	13.9	113	L12 T15 D16 D17	L12-R20 PolarHBondContact O-NH2 2.99Å; T15-R20 HydrophobicContact CG2-CG 3.6Å; T15-R20 PolarHBondContact O-NH1 3.07Å; T15-R20 PolarHBondContact O-NH2 3.43Å; D16-R20 WeakPolarHBondContact O-CG 3.39Å; D16-R20 PolarHBondContact O-N 3.26Å; D16-R20 VanDerWaalsContact O-N 3.12Å; D17-R20 PolarHBondContact O-N 3.22Å; D17-R20 IonicContact OD1-NH1 2.74Å; D17-R20 PolarHBondContact OD1-NH1 3.24Å
21	E	97.1	Very high	95.1	Very high	154 Å²	154	125 Å²	125	72%	0.72	63%	0.633	S	S	*	*	H	α-helix	trans	-91.8	-12.6	-176.6	-65.7	-176.3	139.6	0	0	113	D17 A18 W19	D17-E21 WeakPolarHBondContact O-CG 3.44Å; D17-E21 PolarHBondContact O-N 3.29Å; A18-E21 PolarHBondContact O-N 3.16Å; W19-E21 VanDerWaalsContact C-N 3.28Å; W19-E21 PolarHBondContact O-N 2.96Å
22	D	96.9	Very high	95.2	Very high	111 Å²	111	125 Å²	125	59%	0.594	64%	0.635	S	S	*	*			trans	-59.7	139.9	-178.8	-171	51.1	0	0	0	112.4	A18 W19	A18-D22 PolarHBondContact O-N 3.41Å; W19-D22 PolarHBondContact O-N 3.08Å
23	R	96.9	Very high	95.2	Very high	221 Å²	221	127.3 Å²	127.3	83%	0.834	65%	0.647	S	S	*	*			trans	-134.7	132.5	179.7	-65.8	-179.9	-176.6	-119.9	-0.4	108.9
24	L	96	Very high	95.1	Very high	152 Å²	152	122.9 Å²	122.9	80%	0.796	63%	0.628	S	S	*	*	P	Polyproline II helix	trans	-61.7	142.3	172.8	-65.2	176	0	0	0	110.4
25	P	96.2	Very high	94.9	Very high	93 Å²	93	121.6 Å²	121.6	60%	0.604	62%	0.618	S	S	*	*	P	Polyproline II helix	trans	-66.1	159.9	174.5	29.2	-34.7	0	0	0	111.3	E27	P25-E27 PolarHBondContact O-N 3.11Å
26	Y	95.9	Very high	94.7	Very high	232 Å²	232	123.9 Å²	123.9	91%	0.91	63%	0.629	S	S	*	*	P	Polyproline II helix	trans	-80	116.2	166.5	-66.2	-79.3	0	0	0	108.6
27	E	95.9	Very high	94.4	Very high	161 Å²	161	122.5 Å²	122.5	75%	0.752	63%	0.626	S	S	*	*	P	Polyproline II helix	trans	-92.8	142	174.4	-68.4	-73.2	113.5	0	0	110	P25	P25-E27 PolarHBondContact O-N 3.11Å
28	D	95.3	Very high	94	Very high	163 Å²	163	121.5 Å²	121.5	87%	0.872	62%	0.617	S	S	*	*	P	Polyproline II helix	trans	-76.8	148.2	175.7	-70.7	-43.4	0	0	0	111.6
29	V	92.6	Very high	93	Very high	113 Å²	113	123 Å²	123	69%	0.685	63%	0.63	S	S	*	*	P	Polyproline II helix	trans	-89.7	136.5	173.7	-177.4	0	0	0	0	109.4	I31	V29-I31 HydrophobicContact CB-CD1 4.09Å; V29-I31 HydrophobicContact CG1-CD1 3.98Å; V29-I31 WeakPolarHBondContact O-CG1 3.36Å; V29-I31 PolarHBondContact O-N 3.33Å; V29-I31 VanDerWaalsContact O-N 3.16Å
30	S	95.1	Very high	91.6	Very high	114 Å²	114	123.8 Å²	123.8	80%	0.797	64%	0.64	S	S	*	*			trans	-67.5	111.2	172.3	59.2	0	0	0	0	110.6
31	I	93.3	Very high	90.1	Very high	93 Å²	93	121 Å²	121	48%	0.477	63%	0.633	S	S	.	*			trans	-100.8	131	179.3	-49.3	-56.9	0	0	0	110.1	V29 L33 L36	V29-I31 HydrophobicContact CB-CD1 4.09Å; V29-I31 HydrophobicContact CG1-CD1 3.98Å; V29-I31 WeakPolarHBondContact O-CG1 3.36Å; V29-I31 PolarHBondContact O-N 3.33Å; V29-I31 VanDerWaalsContact O-N 3.16Å; I31-L33 PolarHBondContact O-N 3.11Å; I31-L36 HydrophobicContact CG2-CD1 3.74Å; I31-L36 HydrophobicContact CG2-CD2 4.11Å; I31-L36 HydrophobicContact CG2-CG 4.07Å
32	P	94.1	Very high	88.3	Confident	79 Å²	79	121.7 Å²	121.7	51%	0.513	64%	0.641	S	S	.	*			trans	-72.8	92.4	173.1	30.3	-33.8	0	0	0	109.9	S34 E35	P32-S34 PolarHBondContact O-N 3.28Å; P32-S34 VanDerWaalsContact O-N 3.08Å; P32-E35 HydrophobicContact CB-CB 4.46Å; P32-E35 HydrophobicContact CB-CG 4.02Å; P32-E35 HydrophobicContact CG-CB 4.22Å; P32-E35 HydrophobicContact CG-CG 4.05Å; P32-E35 WeakPolarHBondContact O-CB 3.49Å; P32-E35 PolarHBondContact O-N 2.63Å
33	L	90.8	Very high	86.4	Confident	131 Å²	131	124 Å²	124	69%	0.686	65%	0.653	S	S	*	*	G	3₁₀ helix	trans	-56.3	-28.7	-175.7	-62.7	178.5	0	0	0	113.6	I31 E35 L36	I31-L33 PolarHBondContact O-N 3.11Å; L33-E35 PolarHBondContact O-N 2.61Å; L33-L36 HydrophobicContact CD2-CD1 3.92Å; L33-L36 WeakPolarHBondContact O-CB 3.3Å; L33-L36 PolarHBondContact O-N 3.42Å; L33-L36 VanDerWaalsContact O-N 3.09Å
34	S	92	Very high	84.5	Confident	55 Å²	55	117 Å²	117	39%	0.385	65%	0.651	S	S	.	*	G	3₁₀ helix	trans	-64.3	-23.9	176.7	60.7	0	0	0	0	113.9	P32 S49 V50 K51	P32-S34 PolarHBondContact O-N 3.28Å; P32-S34 VanDerWaalsContact O-N 3.08Å; S34-S49 WeakPolarHBondContact O-CB 3.4Å; S34-V50 PolarHBondContact O-N 3.16Å; S34-K51 WeakPolarHBondContact O-CB 3.37Å; S34-K51 PolarHBondContact O-N 2.84Å
35	E	91.7	Very high	82.9	Confident	93 Å²	93	112.5 Å²	112.5	44%	0.435	64%	0.641	S	S	.	*	G	3₁₀ helix	trans	-91	-3.1	177.8	-56.8	-71	165	0	0	111.6	P32 L33 S49 K51	P32-E35 HydrophobicContact CB-CB 4.46Å; P32-E35 HydrophobicContact CB-CG 4.02Å; P32-E35 HydrophobicContact CG-CB 4.22Å; P32-E35 HydrophobicContact CG-CG 4.05Å; P32-E35 WeakPolarHBondContact O-CB 3.49Å; P32-E35 PolarHBondContact O-N 2.63Å; L33-E35 PolarHBondContact O-N 2.61Å; E35-S49 VanDerWaalsContact C-CB 3.41Å; E35-S49 WeakPolarHBondContact O-CB 3.2Å; E35-K51 WeakPolarHBondContact OE1-CD 3.38Å; E35-K51 IonicContact OE1-NZ 2.61Å; E35-K51 PolarHBondContact OE1-NZ 3.46Å
36	L	90.8	Very high	81.5	Confident	73 Å²	73	110.3 Å²	110.3	38%	0.382	63%	0.627	S	S	.	*	S	Bend	trans	-93.9	152	174.5	-58.8	-176.1	0	0	0	110.6	I31 L33 S49 V50	I31-L36 HydrophobicContact CG2-CD1 3.74Å; I31-L36 HydrophobicContact CG2-CD2 4.11Å; I31-L36 HydrophobicContact CG2-CG 4.07Å; L33-L36 HydrophobicContact CD2-CD1 3.92Å; L33-L36 WeakPolarHBondContact O-CB 3.3Å; L33-L36 PolarHBondContact O-N 3.42Å; L33-L36 VanDerWaalsContact O-N 3.09Å; L36-S49 WeakPolarHBondContact O-CA 3.36Å; L36-V50 PolarHBondContact O-N 3.49Å; L36-V50 VanDerWaalsContact O-N 3.08Å
37	P	89.8	Confident	80.8	Confident	69 Å²	69	105.8 Å²	105.8	45%	0.448	62%	0.624	S	S	.	*	P	Polyproline II helix	trans	-67.1	156.1	168.4	29.1	-34.5	0	0	0	111.3	E48	P37-E48 WeakPolarHBondContact CA-O 3.04Å
38	E	86.4	Confident	80.4	Confident	89 Å²	89	100.1 Å²	100.1	42%	0.416	60%	0.597	S	S	.	*	P	Polyproline II helix	trans	-61.9	134.9	175	-68	-177	98.9	0	0	111.5	E40 Q41 V50 Q53	E38-E40 VanDerWaalsContact C-N 3.32Å; E38-E40 PolarHBondContact O-N 3.29Å; E38-Q41 HydrophobicContact CB-CG 4.01Å; E38-Q41 PolarHBondContact OE2-NE2 2.74Å; E38-V50 HydrophobicContact CG-CG2 3.77Å; E38-Q53 PolarHBondContact OE2-NE2 2.97Å; E38-Q53 PolarHBondContact OE2-OE1 3.09Å
39	A	75.4	Confident	80.2	Confident	102 Å²	102	92.5 Å²	92.5	84%	0.843	56%	0.557	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.5	-25.3	-177.5	0	0	0	0	0	113.9
40	E	67.1	Low	80.1	Confident	181 Å²	181	89.1 Å²	89.1	85%	0.846	54%	0.537	S	S	*	.	T	Hydrogen-bonded Turn	trans	-101	27	-167.3	-61.2	-92	107.5	0	0	113.1	E38 D42	E38-E40 VanDerWaalsContact C-N 3.32Å; E38-E40 PolarHBondContact O-N 3.29Å; E40-D42 VanDerWaalsContact C-N 3.32Å; E40-D42 PolarHBondContact O-N 2.94Å
41	Q	63.8	Low	80.1	Confident	63 Å²	63	87.5 Å²	87.5	29%	0.294	52%	0.515	S	S	.	.			trans	-78.4	82.7	179.2	-62	-149.2	-22.6	0	0	111.8	E38 N43	E38-Q41 HydrophobicContact CB-CG 4.01Å; E38-Q41 PolarHBondContact OE2-NE2 2.74Å; Q41-N43 PolarHBondContact O-N 3.08Å; Q41-N43 VanDerWaalsContact O-N 3.16Å
42	D	59	Low	80.1	Confident	167 Å²	167	87.8 Å²	87.8	89%	0.893	52%	0.515	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.3	-20.6	173.7	-171.2	37	0	0	0	112.7	E40	E40-D42 VanDerWaalsContact C-N 3.32Å; E40-D42 PolarHBondContact O-N 2.94Å
43	N	56.2	Low	79.9	Confident	160 Å²	160	87.9 Å²	87.9	86%	0.856	51%	0.508	S	S	*	.	T	Hydrogen-bonded Turn	trans	-113.2	53.5	-174.2	-155.8	44.8	0	0	0	114	Q41	Q41-N43 PolarHBondContact O-N 3.08Å; Q41-N43 VanDerWaalsContact O-N 3.16Å
44	G	57.1	Low	79.9	Confident	75 Å²	75	88.9 Å²	88.9	77%	0.773	51%	0.51	S	S	*	.	T	Hydrogen-bonded Turn	trans	65.6	66.3	160.8	0	0	0	0	0	115.5
45	G	62.6	Low	80	Confident	57 Å²	57	93 Å²	93	59%	0.588	52%	0.524	S	S	*	.			trans	68.4	72	141.4	0	0	0	0	0	117.8	T47	G45-T47 PolarHBondContact O-N 2.68Å
46	S	66.9	Low	80.1	Confident	46 Å²	46	93.7 Å²	93.7	32%	0.322	53%	0.526	S	S	.	.			trans	-68.6	117.8	148.7	-164.5	0	0	0	0	108.2	E48	S46-E48 PolarHBondContact O-N 2.87Å; S46-E48 WeakPolarHBondContact OG-CB 3.04Å
47	T	80.5	Confident	80.2	Confident	138 Å²	138	101.2 Å²	101.2	85%	0.847	55%	0.549	S	S	*	.			trans	-78.9	2.7	171.1	58.3	0	0	0	0	112.4	G45	G45-T47 PolarHBondContact O-N 2.68Å
48	E	87.4	Confident	80.3	Confident	41 Å²	41	103.9 Å²	103.9	19%	0.192	57%	0.565	C	S	.	*	S	Bend	trans	-83.8	141.3	-175.5	-171.6	170.7	89.6	0	0	110.9	P37 S46 E52 Q53 K56	P37-E48 WeakPolarHBondContact CA-O 3.04Å; S46-E48 PolarHBondContact O-N 2.87Å; S46-E48 WeakPolarHBondContact OG-CB 3.04Å; E48-E52 HydrophobicContact CG-CB 3.25Å; E48-E52 HydrophobicContact CG-CG 4.2Å; E48-Q53 VanDerWaalsContact OE1-CA 3.3Å; E48-Q53 WeakPolarHBondContact OE1-CA 3.33Å; E48-Q53 PolarHBondContact OE1-N 3.26Å; E48-K56 VanDerWaalsContact CD-CE 3.43Å; E48-K56 WeakPolarHBondContact OE1-CE 3.22Å; E48-K56 IonicContact OE1-NZ 2.98Å; E48-K56 PolarHBondContact OE1-NZ 3.37Å; E48-K56 WeakPolarHBondContact OE2-CE 3.4Å; E48-K56 IonicContact OE2-NZ 2.63Å; E48-K56 PolarHBondContact OE2-NZ 3.17Å
49	S	91.8	Very high	80.6	Confident	4 Å²	4	104.1 Å²	104.1	3%	0.028	57%	0.569	C	S	.	*			trans	-69.7	155.5	175.9	66.8	0	0	0	0	112.2	S34 E35 L36 K51 E52 Q53	S34-S49 WeakPolarHBondContact O-CB 3.4Å; E35-S49 VanDerWaalsContact C-CB 3.41Å; E35-S49 WeakPolarHBondContact O-CB 3.2Å; L36-S49 WeakPolarHBondContact O-CA 3.36Å; S49-K51 PolarHBondContact O-N 3.41Å; S49-E52 WeakPolarHBondContact CB-OE2 3.48Å; S49-E52 PolarHBondContact N-OE2 3.12Å; S49-E52 PolarHBondContact O-N 3.47Å; S49-E52 VanDerWaalsContact O-N 3.11Å; S49-E52 WeakPolarHBondContact OG-CB 3.48Å; S49-E52 VanDerWaalsContact OG-CG 3.24Å; S49-E52 WeakPolarHBondContact OG-CG 3.24Å; S49-E52 PolarHBondContact OG-N 3.45Å; S49-E52 PolarHBondContact OG-OE2 3.36Å; S49-Q53 PolarHBondContact O-N 3.45Å; S49-Q53 VanDerWaalsContact O-N 3.11Å
50	V	90.8	Very high	81.4	Confident	42 Å²	42	105.4 Å²	105.4	26%	0.255	56%	0.561	S	S	.	*	H	α-helix	trans	-51.1	-44.6	174.4	174	0	0	0	0	111.1	S34 L36 E38 E52 Q53 E54	S34-V50 PolarHBondContact O-N 3.16Å; L36-V50 PolarHBondContact O-N 3.49Å; L36-V50 VanDerWaalsContact O-N 3.08Å; E38-V50 HydrophobicContact CG-CG2 3.77Å; V50-E52 PolarHBondContact O-N 3.05Å; V50-Q53 WeakPolarHBondContact O-CB 3.49Å; V50-Q53 PolarHBondContact O-N 3.49Å; V50-E54 WeakPolarHBondContact O-CG 3.41Å; V50-E54 PolarHBondContact O-N 3.39Å
51	K	93.8	Very high	82.4	Confident	80 Å²	80	99.1 Å²	99.1	35%	0.348	54%	0.539	S	S	.	.	H	α-helix	trans	-61.7	-41.6	-179.7	177	177.9	164.9	-171.2	0	113.1	S34 E35 S49 Q53 M55	S34-K51 WeakPolarHBondContact O-CB 3.37Å; S34-K51 PolarHBondContact O-N 2.84Å; E35-K51 WeakPolarHBondContact OE1-CD 3.38Å; E35-K51 IonicContact OE1-NZ 2.61Å; E35-K51 PolarHBondContact OE1-NZ 3.46Å; S49-K51 PolarHBondContact O-N 3.41Å; K51-Q53 VanDerWaalsContact C-N 3.34Å; K51-M55 HydrophobicContact CD-CE 4.39Å; K51-M55 HydrophobicContact CG-CE 3.76Å; K51-M55 WeakPolarHBondContact O-CG 3.45Å; K51-M55 PolarHBondContact O-N 3.13Å
52	E	93.3	Very high	83.6	Confident	99 Å²	99	101 Å²	101	46%	0.463	55%	0.551	S	S	.	*	H	α-helix	trans	-67.3	-37.6	178	-75.6	166.8	123.3	0	0	111.5	E48 S49 V50 M55	E48-E52 HydrophobicContact CG-CB 3.25Å; E48-E52 HydrophobicContact CG-CG 4.2Å; S49-E52 WeakPolarHBondContact CB-OE2 3.48Å; S49-E52 PolarHBondContact N-OE2 3.12Å; S49-E52 PolarHBondContact O-N 3.47Å; S49-E52 VanDerWaalsContact O-N 3.11Å; S49-E52 WeakPolarHBondContact OG-CB 3.48Å; S49-E52 VanDerWaalsContact OG-CG 3.24Å; S49-E52 WeakPolarHBondContact OG-CG 3.24Å; S49-E52 PolarHBondContact OG-N 3.45Å; S49-E52 PolarHBondContact OG-OE2 3.36Å; V50-E52 PolarHBondContact O-N 3.05Å; E52-M55 PolarHBondContact O-N 3.38Å
53	Q	90.2	Very high	84.9	Confident	80 Å²	80	100.4 Å²	100.4	37%	0.374	54%	0.543	S	S	.	.	H	α-helix	trans	-64.5	-42.3	177.1	-168.8	-172.7	44.2	0	0	111.9	E38 E48 S49 V50 K51 M55 K56	E38-Q53 PolarHBondContact OE2-NE2 2.97Å; E38-Q53 PolarHBondContact OE2-OE1 3.09Å; E48-Q53 VanDerWaalsContact OE1-CA 3.3Å; E48-Q53 WeakPolarHBondContact OE1-CA 3.33Å; E48-Q53 PolarHBondContact OE1-N 3.26Å; S49-Q53 PolarHBondContact O-N 3.45Å; S49-Q53 VanDerWaalsContact O-N 3.11Å; V50-Q53 WeakPolarHBondContact O-CB 3.49Å; V50-Q53 PolarHBondContact O-N 3.49Å; K51-Q53 VanDerWaalsContact C-N 3.34Å; Q53-M55 PolarHBondContact O-N 3.04Å; Q53-K56 WeakPolarHBondContact O-CB 3.41Å; Q53-K56 PolarHBondContact O-N 3.06Å; Q53-K56 VanDerWaalsContact O-N 3.11Å
54	E	91.4	Very high	86.3	Confident	153 Å²	153	95.9 Å²	95.9	72%	0.715	52%	0.524	S	S	*	.	H	α-helix	trans	-63.1	-27	176.6	-71.4	178.8	160.8	0	0	113.2	V50 K56	V50-E54 WeakPolarHBondContact O-CG 3.41Å; V50-E54 PolarHBondContact O-N 3.39Å; E54-K56 VanDerWaalsContact C-N 3.29Å
55	M	94.6	Very high	87.6	Confident	141 Å²	141	97.8 Å²	97.8	70%	0.695	52%	0.516	S	S	*	.	T	Hydrogen-bonded Turn	trans	-80.2	-8.4	177.5	-68.8	-178.3	-173.6	0	0	113.4	K51 E52 Q53	K51-M55 HydrophobicContact CD-CE 4.39Å; K51-M55 HydrophobicContact CG-CE 3.76Å; K51-M55 WeakPolarHBondContact O-CG 3.45Å; K51-M55 PolarHBondContact O-N 3.13Å; E52-M55 PolarHBondContact O-N 3.38Å; Q53-M55 PolarHBondContact O-N 3.04Å
56	K	93	Very high	88	Confident	108 Å²	108	102.6 Å²	102.6	47%	0.47	52%	0.523	S	S	.	.	S	Bend	trans	-80	133.8	177.3	-71.4	176.8	172.9	168	0	111.1	E48 Q53 E54 T58	E48-K56 VanDerWaalsContact CD-CE 3.43Å; E48-K56 WeakPolarHBondContact OE1-CE 3.22Å; E48-K56 IonicContact OE1-NZ 2.98Å; E48-K56 PolarHBondContact OE1-NZ 3.37Å; E48-K56 WeakPolarHBondContact OE2-CE 3.4Å; E48-K56 IonicContact OE2-NZ 2.63Å; E48-K56 PolarHBondContact OE2-NZ 3.17Å; Q53-K56 WeakPolarHBondContact O-CB 3.41Å; Q53-K56 PolarHBondContact O-N 3.06Å; Q53-K56 VanDerWaalsContact O-N 3.11Å; E54-K56 VanDerWaalsContact C-N 3.29Å; K56-T58 HydrophobicContact CB-CG2 4.25Å; K56-T58 PolarHBondContact O-N 3.45Å
57	W	94.4	Very high	87.8	Confident	230 Å²	230	108.5 Å²	108.5	87%	0.871	55%	0.545	S	S	*	.			trans	-87.2	103.6	168.2	-165.4	29.5	0	0	0	109.5
58	T	90.4	Very high	86.9	Confident	126 Å²	126	108.5 Å²	108.5	77%	0.773	54%	0.54	S	S	*	.			trans	-96.5	-8.6	-176.5	55.2	0	0	0	0	113.5	K56 L60	K56-T58 HydrophobicContact CB-CG2 4.25Å; K56-T58 PolarHBondContact O-N 3.45Å; T58-L60 PolarHBondContact O-N 2.67Å
59	D	93.4	Very high	85.7	Confident	94 Å²	94	110.8 Å²	110.8	50%	0.503	56%	0.557	S	S	.	*			trans	-81.2	118.2	178.6	-178.2	38.7	0	0	0	111.4	A61	D59-A61 PolarHBondContact OD1-N 2.99Å
60	L	91.1	Very high	84.2	Confident	129 Å²	129	116 Å²	116	68%	0.675	59%	0.591	S	S	*	*			trans	-110	4.7	178.9	-170.9	55.1	0	0	0	112.4	T58 L62	T58-L60 PolarHBondContact O-N 2.67Å; L60-L62 HydrophobicContact CB-CD1 4.44Å; L60-L62 HydrophobicContact CB-CG 3.97Å; L60-L62 HydrophobicContact CD2-CD1 3.88Å; L60-L62 HydrophobicContact CD2-CD2 3.94Å; L60-L62 HydrophobicContact CD2-CG 3.91Å; L60-L62 HydrophobicContact CG-CD1 4.29Å; L60-L62 HydrophobicContact CG-CD2 3.85Å; L60-L62 HydrophobicContact CG-CG 3.78Å; L60-L62 PolarHBondContact O-N 2.98Å
61	A	89.7	Confident	82.8	Confident	48 Å²	48	119.5 Å²	119.5	40%	0.397	62%	0.617	S	S	.	*			trans	52.8	22.9	-179.3	0	0	0	0	0	115.2	D59 Q63 S64	D59-A61 PolarHBondContact OD1-N 2.99Å; A61-Q63 PolarHBondContact O-N 2.95Å; A61-Q63 VanDerWaalsContact O-N 3.11Å; A61-S64 WeakPolarHBondContact O-CB 3.36Å; A61-S64 PolarHBondContact O-N 3Å; A61-S64 VanDerWaalsContact O-N 3.13Å; A61-S64 PolarHBondContact O-OG 3.18Å
62	L	87.8	Confident	81.2	Confident	102 Å²	102	121.8 Å²	121.8	53%	0.534	64%	0.643	S	S	.	*	T	Hydrogen-bonded Turn	trans	-62.7	-21.1	-176.5	-66.3	-179.9	0	0	0	113.5	L60 S64 L65	L60-L62 HydrophobicContact CB-CD1 4.44Å; L60-L62 HydrophobicContact CB-CG 3.97Å; L60-L62 HydrophobicContact CD2-CD1 3.88Å; L60-L62 HydrophobicContact CD2-CD2 3.94Å; L60-L62 HydrophobicContact CD2-CG 3.91Å; L60-L62 HydrophobicContact CG-CD1 4.29Å; L60-L62 HydrophobicContact CG-CD2 3.85Å; L60-L62 HydrophobicContact CG-CG 3.78Å; L60-L62 PolarHBondContact O-N 2.98Å; L62-S64 PolarHBondContact O-N 3.35Å; L62-L65 HydrophobicContact CD2-CD1 3.78Å; L62-L65 WeakPolarHBondContact O-CB 3.29Å; L62-L65 PolarHBondContact O-N 3.17Å
63	Q	86.8	Confident	79.8	Confident	155 Å²	155	119.5 Å²	119.5	72%	0.724	65%	0.646	S	S	*	*	H	α-helix	trans	-53.9	-32.6	173.8	62	-173.9	55.4	0	0	113	A61 L65 H66	A61-Q63 PolarHBondContact O-N 2.95Å; A61-Q63 VanDerWaalsContact O-N 3.11Å; Q63-L65 PolarHBondContact O-N 3.36Å; Q63-H66 PolarHBondContact O-N 3.29Å
64	S	85.4	Confident	77.4	Confident	66 Å²	66	125.4 Å²	125.4	46%	0.462	70%	0.696	S	S	.	*	H	α-helix	trans	-65.3	-24.3	179.3	62.8	0	0	0	0	113.5	A61 L62 H66	A61-S64 WeakPolarHBondContact O-CB 3.36Å; A61-S64 PolarHBondContact O-N 3Å; A61-S64 VanDerWaalsContact O-N 3.13Å; A61-S64 PolarHBondContact O-OG 3.18Å; L62-S64 PolarHBondContact O-N 3.35Å; S64-H66 VanDerWaalsContact C-N 3.35Å
65	L	84.8	Confident	76.7	Confident	114 Å²	114	124 Å²	124	60%	0.597	70%	0.695	S	S	*	*	H	α-helix	trans	-73.8	-28.3	178.7	-63.9	170.2	0	0	0	112	L62 Q63	L62-L65 HydrophobicContact CD2-CD1 3.78Å; L62-L65 WeakPolarHBondContact O-CB 3.29Å; L62-L65 PolarHBondContact O-N 3.17Å; Q63-L65 PolarHBondContact O-N 3.36Å
66	H	70.1	Confident	75.8	Confident	159 Å²	159	123.1 Å²	123.1	74%	0.736	70%	0.695	S	S	*	*	H	α-helix	trans	-79	-29.8	-175	-147.1	-173.4	0	0	0	112.3	Q63 S64 N68 T69	Q63-H66 PolarHBondContact O-N 3.29Å; S64-H66 VanDerWaalsContact C-N 3.35Å; H66-N68 VanDerWaalsContact C-N 3.28Å; H66-N68 PolarHBondContact O-N 2.92Å; H66-T69 PolarHBondContact O-OG1 3.25Å; H66-T69 VanDerWaalsContact O-OG1 3.11Å
67	E	64	Low	74.8	Confident	169 Å²	169	123.9 Å²	123.9	79%	0.79	71%	0.708	S	S	*	*	H	α-helix	trans	-73.3	-20.8	175.1	-65.7	177.2	129.9	0	0	112.8
68	N	60.4	Low	73.7	Confident	139 Å²	139	117.7 Å²	117.7	74%	0.743	70%	0.698	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98	2	-174.6	-148.2	24.5	0	0	0	113.6	H66 P70	H66-N68 VanDerWaalsContact C-N 3.28Å; H66-N68 PolarHBondContact O-N 2.92Å; N68-P70 WeakPolarHBondContact O-CD 3.43Å
69	T	61.8	Low	72.7	Confident	89 Å²	89	117.2 Å²	117.2	55%	0.546	69%	0.693	S	S	.	*	S	Bend	trans	-78.6	110.4	166.9	54.4	0	0	0	0	108.5	H66 S71	H66-T69 PolarHBondContact O-OG1 3.25Å; H66-T69 VanDerWaalsContact O-OG1 3.11Å; T69-S71 PolarHBondContact O-N 3.34Å; T69-S71 VanDerWaalsContact O-N 3.16Å
70	P	62	Low	71.3	Confident	113 Å²	113	118.7 Å²	118.7	73%	0.734	71%	0.706	S	S	*	*			trans	-58.4	127.7	172.2	24.4	-31.8	0	0	0	107.8	N68 S72	N68-P70 WeakPolarHBondContact O-CD 3.43Å; P70-S72 PolarHBondContact O-N 3.1Å
71	S	59.6	Low	69.9	Low	115 Å²	115	118 Å²	118	80%	0.804	71%	0.708	S	S	*	*			trans	-56.4	87.3	163.9	176.3	0	0	0	0	107.7	T69 G73	T69-S71 PolarHBondContact O-N 3.34Å; T69-S71 VanDerWaalsContact O-N 3.16Å; S71-G73 PolarHBondContact O-N 3.24Å
72	S	60.7	Low	68.3	Low	128 Å²	128	123.4 Å²	123.4	90%	0.895	73%	0.732	S	S	*	*			trans	-79.9	81.2	173.4	-146.6	0	0	0	0	105.6	P70	P70-S72 PolarHBondContact O-N 3.1Å
73	G	63.7	Low	66.7	Low	51 Å²	51	125.2 Å²	125.2	53%	0.526	75%	0.749	S	S	.	*			trans	-169.6	73.7	-172.2	0	0	0	0	0	112.9	S71	S71-G73 PolarHBondContact O-N 3.24Å
74	S	41.2	Very low	64.9	Low	204 Å²	204	122.5 Å²	122.5	100%	1.427	75%	0.751	S	S	*	*			trans	177.6	0	134.8	-73.4	0	0	0	0	110.2

Retrieved 74 of 74 residues in 319.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).