A0A087Y584_POEFO Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB (A0A3B3U2Q2), UniProt , Accession A0A087Y584, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 73 aa.

						>A0A087Y584_POEFO|A0A087Y584
MPVINVDDLTDKDKAVMEVNQLKIEVKLERWLTSKCCEEIKEYIQAGVEEDTLVKGISEEKNPFKEKGGCVIC
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.7	Low	78.3	Confident	228 Å²	228	114.1 Å²	114.1	100%	1.123	63%	0.631	S	S	*	*				0	117.1	0	-169.7	-175.7	-66.7	0	0	106.7
2	P	76.3	Confident	79.3	Confident	100 Å²	100	118.1 Å²	118.1	65%	0.649	64%	0.637	S	S	*	*			trans	-66	147.4	176.7	27.4	-31.1	0	0	0	109.8	I4	P2-I4 HydrophobicContact CB-CG1 4.43Å; P2-I4 HydrophobicContact CG-CD1 4.23Å; P2-I4 HydrophobicContact CG-CG1 4.11Å; P2-I4 PolarHBondContact O-N 3.32Å
3	V	73.2	Confident	79.9	Confident	154 Å²	154	114.5 Å²	114.5	93%	0.933	62%	0.618	S	S	*	*			trans	-75.3	115.6	168.2	179.9	0	0	0	0	106.5
4	I	78.9	Confident	80.5	Confident	79 Å²	79	112.3 Å²	112.3	41%	0.405	60%	0.6	S	S	.	*			trans	-110.6	125.3	-176.9	-52.5	172.8	0	0	0	107.5	P2 V6 L9 M17	P2-I4 HydrophobicContact CB-CG1 4.43Å; P2-I4 HydrophobicContact CG-CD1 4.23Å; P2-I4 HydrophobicContact CG-CG1 4.11Å; P2-I4 PolarHBondContact O-N 3.32Å; I4-V6 PolarHBondContact O-N 3.19Å; I4-L9 HydrophobicContact CG2-CD1 3.86Å; I4-L9 HydrophobicContact CG2-CD2 4.34Å; I4-L9 HydrophobicContact CG2-CG 4.3Å; I4-M17 HydrophobicContact CD1-CE 3.47Å; I4-M17 VanDerWaalsContact CD1-CE 3.47Å; I4-M17 HydrophobicContact CD1-SD 4.39Å; I4-M17 HydrophobicContact CG2-CE 4.43Å
5	N	79.9	Confident	81.1	Confident	86 Å²	86	107.9 Å²	107.9	46%	0.46	59%	0.585	S	S	.	*			trans	-79.9	115.2	169.1	-170.6	-1	0	0	0	108.9	D7 D8	N5-D7 PolarHBondContact O-N 2.96Å; N5-D7 PolarHBondContact OD1-N 3.19Å; N5-D8 HydrophobicContact CB-CB 4.48Å; N5-D8 WeakPolarHBondContact CB-OD2 3.1Å; N5-D8 VanDerWaalsContact CG-OD2 3.31Å; N5-D8 PolarHBondContact ND2-OD2 3.31Å; N5-D8 PolarHBondContact O-N 2.88Å
6	V	72.7	Confident	81.8	Confident	91 Å²	91	105.6 Å²	105.6	55%	0.552	58%	0.576	S	S	*	*	G	3₁₀ helix	trans	-73.4	-22	-171.4	-142.2	0	0	0	0	112.3	I4 L9 K14	I4-V6 PolarHBondContact O-N 3.19Å; V6-L9 HydrophobicContact CG1-CD1 4.21Å; V6-K14 VanDerWaalsContact O-CE 3.28Å; V6-K14 WeakPolarHBondContact O-CE 3.49Å
7	D	77.1	Confident	82.3	Confident	141 Å²	141	104.1 Å²	104.1	75%	0.754	57%	0.565	S	S	*	*	G	3₁₀ helix	trans	-79.8	-21.7	-177.8	-62.2	-36.4	0	0	0	112.7	N5	N5-D7 PolarHBondContact O-N 2.96Å; N5-D7 PolarHBondContact OD1-N 3.19Å
8	D	83.5	Confident	82.8	Confident	128 Å²	128	105.3 Å²	105.3	68%	0.684	57%	0.566	S	S	*	*	G	3₁₀ helix	trans	-89.3	-3	179.8	-63.9	-35.6	0	0	0	113.2	N5	N5-D8 HydrophobicContact CB-CB 4.48Å; N5-D8 WeakPolarHBondContact CB-OD2 3.1Å; N5-D8 VanDerWaalsContact CG-OD2 3.31Å; N5-D8 PolarHBondContact ND2-OD2 3.31Å; N5-D8 PolarHBondContact O-N 2.88Å
9	L	82.1	Confident	83.4	Confident	35 Å²	35	103.4 Å²	103.4	18%	0.183	56%	0.558	C	S	.	*			trans	-86.5	137.4	-176.8	-70.2	165.4	0	0	0	112.1	I4 V6 D13 K14 M17	I4-L9 HydrophobicContact CG2-CD1 3.86Å; I4-L9 HydrophobicContact CG2-CD2 4.34Å; I4-L9 HydrophobicContact CG2-CG 4.3Å; V6-L9 HydrophobicContact CG1-CD1 4.21Å; L9-D13 HydrophobicContact CB-CB 4.38Å; L9-D13 HydrophobicContact CD2-CB 3.76Å; L9-K14 HydrophobicContact CB-CG 3.9Å; L9-K14 HydrophobicContact CD1-CG 4.3Å; L9-K14 WeakPolarHBondContact O-CE 3.1Å; L9-M17 HydrophobicContact CD1-CE 4.44Å; L9-M17 HydrophobicContact CD1-SD 3.7Å; L9-M17 HydrophobicContact CD2-SD 4.14Å
10	T	87.9	Confident	84	Confident	77 Å²	77	102.2 Å²	102.2	47%	0.472	55%	0.552	S	S	.	*			trans	-70.4	158.6	168.4	74.8	0	0	0	0	110.9	K12 D13 K14	T10-K12 PolarHBondContact O-N 3.49Å; T10-D13 WeakPolarHBondContact CB-OD2 3.19Å; T10-D13 PolarHBondContact N-OD2 2.97Å; T10-D13 PolarHBondContact O-N 2.94Å; T10-D13 PolarHBondContact OG1-N 3.06Å; T10-D13 PolarHBondContact OG1-OD2 3.13Å; T10-K14 PolarHBondContact O-N 2.91Å
11	D	88.9	Confident	84.4	Confident	136 Å²	136	101.9 Å²	101.9	73%	0.727	55%	0.547	S	S	*	.	H	α-helix	trans	-57.5	-33.1	176.6	-63.3	-28.7	0	0	0	112.2	A15	D11-A15 WeakPolarHBondContact O-CB 3.38Å; D11-A15 PolarHBondContact O-N 3.04Å
12	K	90	Very high	86.1	Confident	162 Å²	162	95.3 Å²	95.3	70%	0.704	52%	0.515	S	S	*	.	H	α-helix	trans	-67.1	-42.1	175.6	-173.7	179.8	177.9	-176.9	0	111.6	T10 A15 V16	T10-K12 PolarHBondContact O-N 3.49Å; K12-A15 PolarHBondContact O-N 3.43Å; K12-V16 WeakPolarHBondContact O-CG2 3.25Å; K12-V16 PolarHBondContact O-N 2.91Å
13	D	87.9	Confident	87	Confident	71 Å²	71	96.3 Å²	96.3	38%	0.38	51%	0.51	S	S	.	.	H	α-helix	trans	-67.4	-39.4	179.7	-58.9	-44.1	0	0	0	111.1	L9 T10 V16 M17	L9-D13 HydrophobicContact CB-CB 4.38Å; L9-D13 HydrophobicContact CD2-CB 3.76Å; T10-D13 WeakPolarHBondContact CB-OD2 3.19Å; T10-D13 PolarHBondContact N-OD2 2.97Å; T10-D13 PolarHBondContact O-N 2.94Å; T10-D13 PolarHBondContact OG1-N 3.06Å; T10-D13 PolarHBondContact OG1-OD2 3.13Å; D13-V16 PolarHBondContact O-N 2.82Å; D13-M17 WeakPolarHBondContact O-CB 3.47Å; D13-M17 VanDerWaalsContact O-CG 3.29Å; D13-M17 WeakPolarHBondContact O-CG 3.47Å; D13-M17 PolarHBondContact O-N 2.98Å
14	K	87.9	Confident	88	Confident	84 Å²	84	94.3 Å²	94.3	37%	0.365	49%	0.492	S	S	.	.	H	α-helix	trans	-58.9	-47.4	172.6	-67.5	175.5	-176.2	172.3	0	111.5	V6 L9 T10 V16 M17 E18	V6-K14 VanDerWaalsContact O-CE 3.28Å; V6-K14 WeakPolarHBondContact O-CE 3.49Å; L9-K14 HydrophobicContact CB-CG 3.9Å; L9-K14 HydrophobicContact CD1-CG 4.3Å; L9-K14 WeakPolarHBondContact O-CE 3.1Å; T10-K14 PolarHBondContact O-N 2.91Å; K14-V16 PolarHBondContact O-N 3.11Å; K14-M17 PolarHBondContact O-N 3.32Å; K14-E18 WeakPolarHBondContact O-CB 3.39Å; K14-E18 PolarHBondContact O-N 3.38Å
15	A	90.3	Very high	88.7	Confident	46 Å²	46	94.8 Å²	94.8	38%	0.38	49%	0.493	S	S	.	.	H	α-helix	trans	-63.9	-38.9	178.4	0	0	0	0	0	112.8	D11 K12 E18 V19	D11-A15 WeakPolarHBondContact O-CB 3.38Å; D11-A15 PolarHBondContact O-N 3.04Å; K12-A15 PolarHBondContact O-N 3.43Å; A15-E18 PolarHBondContact O-N 2.79Å; A15-V19 WeakPolarHBondContact O-CG2 3.3Å; A15-V19 PolarHBondContact O-N 3.04Å
16	V	92.1	Very high	89.5	Confident	72 Å²	72	95.6 Å²	95.6	44%	0.436	50%	0.501	S	S	.	.	H	α-helix	trans	-65.3	-42.6	175.8	170.4	0	0	0	0	110.8	K12 D13 K14 N20	K12-V16 WeakPolarHBondContact O-CG2 3.25Å; K12-V16 PolarHBondContact O-N 2.91Å; D13-V16 PolarHBondContact O-N 2.82Å; K14-V16 PolarHBondContact O-N 3.11Å; V16-N20 WeakPolarHBondContact O-CB 3.42Å; V16-N20 PolarHBondContact O-N 2.89Å; V16-N20 PolarHBondContact O-ND2 3.21Å; V16-N20 VanDerWaalsContact O-ND2 3.12Å
17	M	89.3	Confident	90.6	Very high	79 Å²	79	99.3 Å²	99.3	39%	0.389	51%	0.51	S	S	.	.	H	α-helix	trans	-61.7	-45.3	175.8	-73.3	177.1	63.4	0	0	111.8	I4 L9 D13 K14 N20 Q21	I4-M17 HydrophobicContact CD1-CE 3.47Å; I4-M17 VanDerWaalsContact CD1-CE 3.47Å; I4-M17 HydrophobicContact CD1-SD 4.39Å; I4-M17 HydrophobicContact CG2-CE 4.43Å; L9-M17 HydrophobicContact CD1-CE 4.44Å; L9-M17 HydrophobicContact CD1-SD 3.7Å; L9-M17 HydrophobicContact CD2-SD 4.14Å; D13-M17 WeakPolarHBondContact O-CB 3.47Å; D13-M17 VanDerWaalsContact O-CG 3.29Å; D13-M17 WeakPolarHBondContact O-CG 3.47Å; D13-M17 PolarHBondContact O-N 2.98Å; K14-M17 PolarHBondContact O-N 3.32Å; M17-N20 PolarHBondContact O-N 3.5Å; M17-Q21 WeakPolarHBondContact O-CB 3.1Å; M17-Q21 PolarHBondContact O-N 2.73Å
18	E	91.1	Very high	91.4	Very high	126 Å²	126	98 Å²	98	59%	0.589	50%	0.502	S	S	*	.	H	α-helix	trans	-59.6	-50.3	177.3	-176	-178.6	179.5	0	0	111.7	K14 A15 N20 Q21 L22	K14-E18 WeakPolarHBondContact O-CB 3.39Å; K14-E18 PolarHBondContact O-N 3.38Å; A15-E18 PolarHBondContact O-N 2.79Å; E18-N20 VanDerWaalsContact C-N 3.27Å; E18-N20 PolarHBondContact O-N 2.98Å; E18-Q21 WeakPolarHBondContact O-CB 3.26Å; E18-Q21 PolarHBondContact O-N 3.07Å; E18-Q21 VanDerWaalsContact O-N 3.14Å; E18-L22 HydrophobicContact CG-CD1 4.18Å; E18-L22 WeakPolarHBondContact O-CG 3.19Å; E18-L22 PolarHBondContact O-N 3.18Å
19	V	95.6	Very high	92	Very high	69 Å²	69	100.2 Å²	100.2	42%	0.418	51%	0.508	S	S	.	.	H	α-helix	trans	-62.5	-36.9	179.4	170.6	0	0	0	0	111.5	A15 K23	A15-V19 WeakPolarHBondContact O-CG2 3.3Å; A15-V19 PolarHBondContact O-N 3.04Å; V19-K23 HydrophobicContact CG1-CD 4.24Å; V19-K23 VanDerWaalsContact O-CG 3.27Å; V19-K23 WeakPolarHBondContact O-CG 3.38Å; V19-K23 PolarHBondContact O-N 3.37Å
20	N	93.8	Very high	92.5	Very high	80 Å²	80	106.5 Å²	106.5	43%	0.428	53%	0.53	S	S	.	.	H	α-helix	trans	-67	-40.5	176.3	-72.8	-25.5	0	0	0	111.7	V16 M17 E18 K23 I24	V16-N20 WeakPolarHBondContact O-CB 3.42Å; V16-N20 PolarHBondContact O-N 2.89Å; V16-N20 PolarHBondContact O-ND2 3.21Å; V16-N20 VanDerWaalsContact O-ND2 3.12Å; M17-N20 PolarHBondContact O-N 3.5Å; E18-N20 VanDerWaalsContact C-N 3.27Å; E18-N20 PolarHBondContact O-N 2.98Å; N20-K23 PolarHBondContact O-N 3.22Å; N20-I24 WeakPolarHBondContact O-CG1 3.5Å; N20-I24 PolarHBondContact O-N 3.5Å
21	Q	93.1	Very high	92.8	Very high	96 Å²	96	110.6 Å²	110.6	45%	0.449	54%	0.536	S	S	.	.	H	α-helix	trans	-62.8	-46.5	174.7	-177.9	59.6	27	0	0	111.3	M17 E18 K23 I24 E25	M17-Q21 WeakPolarHBondContact O-CB 3.1Å; M17-Q21 PolarHBondContact O-N 2.73Å; E18-Q21 WeakPolarHBondContact O-CB 3.26Å; E18-Q21 PolarHBondContact O-N 3.07Å; E18-Q21 VanDerWaalsContact O-N 3.14Å; Q21-K23 VanDerWaalsContact C-N 3.3Å; Q21-K23 PolarHBondContact O-N 3Å; Q21-I24 WeakPolarHBondContact O-CA 3.39Å; Q21-I24 WeakPolarHBondContact O-CB 3.17Å; Q21-I24 PolarHBondContact O-N 3.05Å; Q21-E25 VanDerWaalsContact CG-OE1 3.32Å; Q21-E25 WeakPolarHBondContact CG-OE1 3.34Å; Q21-E25 PolarHBondContact NE2-OE1 3.41Å; Q21-E25 PolarHBondContact O-N 3.08Å
22	L	95.9	Very high	93.1	Very high	89 Å²	89	110.3 Å²	110.3	47%	0.466	53%	0.534	S	S	.	.	H	α-helix	trans	-60.1	-38.1	177.1	-69.1	171.8	0	0	0	112.7	E18 I24 E25 V26	E18-L22 HydrophobicContact CG-CD1 4.18Å; E18-L22 WeakPolarHBondContact O-CG 3.19Å; E18-L22 PolarHBondContact O-N 3.18Å; L22-I24 PolarHBondContact O-N 3.01Å; L22-E25 PolarHBondContact O-N 3.25Å; L22-V26 PolarHBondContact O-N 3.28Å
23	K	95.6	Very high	93.4	Very high	122 Å²	122	107.8 Å²	107.8	53%	0.53	53%	0.533	S	S	.	.	H	α-helix	trans	-66.2	-22.5	174.5	-75.6	170.8	-178	171.9	0	113.6	V19 N20 Q21 V26	V19-K23 HydrophobicContact CG1-CD 4.24Å; V19-K23 VanDerWaalsContact O-CG 3.27Å; V19-K23 WeakPolarHBondContact O-CG 3.38Å; V19-K23 PolarHBondContact O-N 3.37Å; N20-K23 PolarHBondContact O-N 3.22Å; Q21-K23 VanDerWaalsContact C-N 3.3Å; Q21-K23 PolarHBondContact O-N 3Å; K23-V26 WeakPolarHBondContact O-CG1 3.45Å
24	I	94.9	Very high	93.7	Very high	111 Å²	111	107.9 Å²	107.9	57%	0.569	54%	0.539	S	S	*	.	H	α-helix	trans	-82.5	-48.5	172.9	-65.4	165.8	0	0	0	109.1	N20 Q21 L22 V26 K27	N20-I24 WeakPolarHBondContact O-CG1 3.5Å; N20-I24 PolarHBondContact O-N 3.5Å; Q21-I24 WeakPolarHBondContact O-CA 3.39Å; Q21-I24 WeakPolarHBondContact O-CB 3.17Å; Q21-I24 PolarHBondContact O-N 3.05Å; L22-I24 PolarHBondContact O-N 3.01Å; I24-V26 VanDerWaalsContact C-N 3.29Å; I24-V26 PolarHBondContact O-N 3.4Å; I24-K27 WeakPolarHBondContact O-CB 3.44Å; I24-K27 PolarHBondContact O-N 2.98Å
25	E	93.9	Very high	94	Very high	89 Å²	89	108.3 Å²	108.3	42%	0.416	54%	0.54	S	S	.	.	H	α-helix	trans	-63.8	-29.5	-177.7	-70.3	177.8	-166.5	0	0	114.1	Q21 L22 K27 L28 R30	Q21-E25 VanDerWaalsContact CG-OE1 3.32Å; Q21-E25 WeakPolarHBondContact CG-OE1 3.34Å; Q21-E25 PolarHBondContact NE2-OE1 3.41Å; Q21-E25 PolarHBondContact O-N 3.08Å; L22-E25 PolarHBondContact O-N 3.25Å; E25-K27 PolarHBondContact O-N 3.17Å; E25-L28 VanDerWaalsContact O-CB 3.29Å; E25-L28 WeakPolarHBondContact O-CB 3.27Å; E25-L28 PolarHBondContact O-N 2.96Å; E25-R30 PolarHBondContact O-NH2 3.49Å
26	V	95.9	Very high	94.3	Very high	103 Å²	103	107.9 Å²	107.9	62%	0.624	53%	0.534	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.3	-30.8	175.3	73.7	0	0	0	0	111.9	L22 K23 I24 L28	L22-V26 PolarHBondContact O-N 3.28Å; K23-V26 WeakPolarHBondContact O-CG1 3.45Å; I24-V26 VanDerWaalsContact C-N 3.29Å; I24-V26 PolarHBondContact O-N 3.4Å; V26-L28 VanDerWaalsContact C-N 3.27Å; V26-L28 PolarHBondContact O-N 3.02Å
27	K	95.1	Very high	94.4	Very high	170 Å²	170	108 Å²	108	74%	0.739	54%	0.538	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.1	-5.6	-180	-61	179.9	-177.2	-179.7	0	113.1	I24 E25 E29	I24-K27 WeakPolarHBondContact O-CB 3.44Å; I24-K27 PolarHBondContact O-N 2.98Å; E25-K27 PolarHBondContact O-N 3.17Å; K27-E29 PolarHBondContact O-N 3.43Å
28	L	95.3	Very high	94.7	Very high	113 Å²	113	110 Å²	110	59%	0.592	55%	0.546	S	S	*	.			trans	-65.2	123.3	178.6	-172.9	70.3	0	0	0	110.2	E25 V26 R30	E25-L28 VanDerWaalsContact O-CB 3.29Å; E25-L28 WeakPolarHBondContact O-CB 3.27Å; E25-L28 PolarHBondContact O-N 2.96Å; V26-L28 VanDerWaalsContact C-N 3.27Å; V26-L28 PolarHBondContact O-N 3.02Å; L28-R30 PolarHBondContact O-N 2.91Å; L28-R30 VanDerWaalsContact O-N 3.15Å; L28-R30 PolarHBondContact O-NH1 3.35Å; L28-R30 VanDerWaalsContact O-NH1 3.17Å
29	E	94.5	Very high	94.9	Very high	174 Å²	174	108 Å²	108	81%	0.813	54%	0.537	S	S	*	.			trans	-70.1	107.2	171.6	-67.7	-175.4	174.8	0	0	109.3	K27	K27-E29 PolarHBondContact O-N 3.43Å
30	R	93.9	Very high	95	Very high	168 Å²	168	109.6 Å²	109.6	63%	0.634	54%	0.542	S	S	*	.	P	Polyproline II helix	trans	-85.6	133.8	179	-67.2	172.8	-176.4	70.9	4	109.4	E25 L28	E25-R30 PolarHBondContact O-NH2 3.49Å; L28-R30 PolarHBondContact O-N 2.91Å; L28-R30 VanDerWaalsContact O-N 3.15Å; L28-R30 PolarHBondContact O-NH1 3.35Å; L28-R30 VanDerWaalsContact O-NH1 3.17Å
31	W	94.2	Very high	95.1	Very high	162 Å²	162	111.7 Å²	111.7	61%	0.614	55%	0.547	S	S	*	.	P	Polyproline II helix	trans	-78.6	155.4	172.4	-68.9	7.8	0	0	0	110.8	T33	W31-T33 PolarHBondContact O-N 3.49Å
32	L	95.7	Very high	95.2	Very high	130 Å²	130	113.4 Å²	113.4	68%	0.681	56%	0.555	S	S	*	*	P	Polyproline II helix	trans	-64.3	130.4	174.9	-68.6	174	0	0	0	109.8	S34 K35 C36	L32-S34 PolarHBondContact O-N 3.47Å; L32-K35 HydrophobicContact CB-CB 4.34Å; L32-K35 PolarHBondContact O-N 3.09Å; L32-K35 VanDerWaalsContact O-N 3.09Å; L32-C36 PolarHBondContact O-N 3.4Å; L32-C36 VanDerWaalsContact O-N 3.08Å
33	T	94.8	Very high	95.2	Very high	110 Å²	110	118.1 Å²	118.1	68%	0.675	57%	0.568	S	S	*	*	H	α-helix	trans	-56.8	-37.6	179	-50.3	0	0	0	0	111.9	W31 K35 C36 C37	W31-T33 PolarHBondContact O-N 3.49Å; T33-K35 PolarHBondContact O-N 3.28Å; T33-C36 PolarHBondContact O-N 3.39Å; T33-C37 WeakPolarHBondContact O-CB 3.39Å; T33-C37 PolarHBondContact O-N 3.39Å; T33-C37 PolarHBondContact O-SG 2.99Å
34	S	95.2	Very high	95.1	Very high	72 Å²	72	116.9 Å²	116.9	50%	0.503	57%	0.566	S	S	.	*	H	α-helix	trans	-57.1	-49.6	176	51.5	0	0	0	0	112.1	L32 C36 C37 E38	L32-S34 PolarHBondContact O-N 3.47Å; S34-C36 PolarHBondContact O-N 2.78Å; S34-C37 PolarHBondContact O-N 3.41Å; S34-E38 WeakPolarHBondContact O-CG 3.28Å; S34-E38 PolarHBondContact O-N 3.48Å
35	K	94.8	Very high	95.1	Very high	93 Å²	93	117.1 Å²	117.1	40%	0.404	57%	0.565	S	S	.	*	H	α-helix	trans	-61.5	-45.7	178	-178	179.5	172.6	-176.3	0	111.5	L32 T33 C37 E38 E39	L32-K35 HydrophobicContact CB-CB 4.34Å; L32-K35 PolarHBondContact O-N 3.09Å; L32-K35 VanDerWaalsContact O-N 3.09Å; T33-K35 PolarHBondContact O-N 3.28Å; K35-C37 VanDerWaalsContact C-N 3.33Å; K35-C37 PolarHBondContact O-N 3.5Å; K35-E38 PolarHBondContact O-N 3.23Å; K35-E39 WeakPolarHBondContact CE-OE1 3.43Å; K35-E39 IonicContact NZ-OE1 3.74Å; K35-E39 PolarHBondContact O-N 2.89Å
36	C	95.6	Very high	95.1	Very high	37 Å²	37	116.7 Å²	116.7	25%	0.25	58%	0.577	C	S	.	*	H	α-helix	trans	-61.9	-41.4	177.8	-65.6	0	0	0	0	112.1	L32 T33 S34 I40	L32-C36 PolarHBondContact O-N 3.4Å; L32-C36 VanDerWaalsContact O-N 3.08Å; T33-C36 PolarHBondContact O-N 3.39Å; S34-C36 PolarHBondContact O-N 2.78Å; C36-I40 WeakPolarHBondContact O-CB 3.32Å; C36-I40 WeakPolarHBondContact O-CD1 3.45Å; C36-I40 WeakPolarHBondContact O-CG1 3.49Å; C36-I40 PolarHBondContact O-N 3.3Å
37	C	94.9	Very high	94.8	Very high	75 Å²	75	113.4 Å²	113.4	51%	0.507	56%	0.564	S	S	.	*	H	α-helix	trans	-66	-38	177.6	-70.6	0	0	0	0	112.4	T33 S34 K35 K41	T33-C37 WeakPolarHBondContact O-CB 3.39Å; T33-C37 PolarHBondContact O-N 3.39Å; T33-C37 PolarHBondContact O-SG 2.99Å; S34-C37 PolarHBondContact O-N 3.41Å; K35-C37 VanDerWaalsContact C-N 3.33Å; K35-C37 PolarHBondContact O-N 3.5Å; C37-K41 WeakPolarHBondContact O-CB 2.87Å; C37-K41 PolarHBondContact O-N 2.82Å
38	E	95.8	Very high	94.6	Very high	121 Å²	121	107.5 Å²	107.5	57%	0.565	54%	0.542	S	S	*	.	H	α-helix	trans	-63.2	-52.9	175.7	-75.1	172.1	-179.5	0	0	111.2	S34 K35 I40 K41 E42	S34-E38 WeakPolarHBondContact O-CG 3.28Å; S34-E38 PolarHBondContact O-N 3.48Å; K35-E38 PolarHBondContact O-N 3.23Å; E38-I40 PolarHBondContact O-N 3.44Å; E38-K41 WeakPolarHBondContact O-CB 3.34Å; E38-K41 PolarHBondContact O-N 3.18Å; E38-K41 VanDerWaalsContact O-N 3.17Å; E38-E42 WeakPolarHBondContact O-CG 3.41Å; E38-E42 PolarHBondContact O-N 3.27Å
39	E	95.4	Very high	94.1	Very high	85 Å²	85	108.3 Å²	108.3	40%	0.397	54%	0.542	S	S	.	.	H	α-helix	trans	-61.4	-42.5	-179.7	-70.4	178.6	-179.1	0	0	112.2	K35 K41 E42 Y43	K35-E39 WeakPolarHBondContact CE-OE1 3.43Å; K35-E39 IonicContact NZ-OE1 3.74Å; K35-E39 PolarHBondContact O-N 2.89Å; E39-K41 VanDerWaalsContact C-N 3.35Å; E39-K41 PolarHBondContact O-N 3.05Å; E39-E42 PolarHBondContact O-N 2.92Å; E39-Y43 WeakPolarHBondContact O-CB 3.41Å; E39-Y43 PolarHBondContact O-N 3.32Å
40	I	96.4	Very high	93.7	Very high	102 Å²	102	108.1 Å²	108.1	52%	0.523	54%	0.542	S	S	.	.	H	α-helix	trans	-63.1	-43.7	176.6	-71.2	167.8	0	0	0	110.6	C36 E38 Y43 I44	C36-I40 WeakPolarHBondContact O-CB 3.32Å; C36-I40 WeakPolarHBondContact O-CD1 3.45Å; C36-I40 WeakPolarHBondContact O-CG1 3.49Å; C36-I40 PolarHBondContact O-N 3.3Å; E38-I40 PolarHBondContact O-N 3.44Å; I40-Y43 PolarHBondContact O-N 2.98Å; I40-I44 HydrophobicContact CG2-CD1 3.67Å; I40-I44 HydrophobicContact CG2-CG1 4.39Å; I40-I44 VanDerWaalsContact O-CG1 3.27Å; I40-I44 WeakPolarHBondContact O-CG1 3.47Å; I40-I44 PolarHBondContact O-N 3.04Å
41	K	95.3	Very high	93.5	Very high	123 Å²	123	103.3 Å²	103.3	54%	0.535	53%	0.528	S	S	.	.	H	α-helix	trans	-62.8	-46.3	179	178.5	-174.5	171.5	-170.3	0	111.1	C37 E38 E39 Y43 I44 Q45	C37-K41 WeakPolarHBondContact O-CB 2.87Å; C37-K41 PolarHBondContact O-N 2.82Å; E38-K41 WeakPolarHBondContact O-CB 3.34Å; E38-K41 PolarHBondContact O-N 3.18Å; E38-K41 VanDerWaalsContact O-N 3.17Å; E39-K41 VanDerWaalsContact C-N 3.35Å; E39-K41 PolarHBondContact O-N 3.05Å; K41-Y43 VanDerWaalsContact C-N 3.34Å; K41-Y43 PolarHBondContact O-N 3.36Å; K41-I44 PolarHBondContact O-N 3.45Å; K41-Q45 VanDerWaalsContact CE-NE2 3.31Å; K41-Q45 HydrophobicContact CG-CG 4.33Å; K41-Q45 WeakPolarHBondContact O-CB 3.35Å; K41-Q45 VanDerWaalsContact O-CG 3.26Å; K41-Q45 WeakPolarHBondContact O-CG 3.47Å; K41-Q45 PolarHBondContact O-N 3.4Å
42	E	96.4	Very high	93.1	Very high	132 Å²	132	99.2 Å²	99.2	62%	0.617	52%	0.521	S	S	*	.	H	α-helix	trans	-59.9	-45.1	177.9	-73.9	179.3	179.7	0	0	111.4	E38 E39 Q45 A46	E38-E42 WeakPolarHBondContact O-CG 3.41Å; E38-E42 PolarHBondContact O-N 3.27Å; E39-E42 PolarHBondContact O-N 2.92Å; E42-Q45 PolarHBondContact O-N 3.25Å; E42-A46 WeakPolarHBondContact O-CB 3.27Å; E42-A46 PolarHBondContact O-N 3.45Å
43	Y	95.3	Very high	92.6	Very high	188 Å²	188	100.6 Å²	100.6	74%	0.737	53%	0.528	S	S	*	.	H	α-helix	trans	-59.7	-48.2	176.6	179.6	-96.7	0	0	0	112.2	E39 I40 K41 A46 G47	E39-Y43 WeakPolarHBondContact O-CB 3.41Å; E39-Y43 PolarHBondContact O-N 3.32Å; I40-Y43 PolarHBondContact O-N 2.98Å; K41-Y43 VanDerWaalsContact C-N 3.34Å; K41-Y43 PolarHBondContact O-N 3.36Å; Y43-A46 PolarHBondContact O-N 3.04Å; Y43-G47 PolarHBondContact O-N 3.4Å
44	I	94.3	Very high	92.3	Very high	96 Å²	96	99.4 Å²	99.4	49%	0.492	52%	0.521	S	S	.	.	H	α-helix	trans	-61.1	-49.8	178	-69	168.5	0	0	0	109.9	I40 K41 A46 G47 V48	I40-I44 HydrophobicContact CG2-CD1 3.67Å; I40-I44 HydrophobicContact CG2-CG1 4.39Å; I40-I44 VanDerWaalsContact O-CG1 3.27Å; I40-I44 WeakPolarHBondContact O-CG1 3.47Å; I40-I44 PolarHBondContact O-N 3.04Å; K41-I44 PolarHBondContact O-N 3.45Å; I44-A46 VanDerWaalsContact C-N 3.27Å; I44-A46 PolarHBondContact O-N 2.62Å; I44-G47 PolarHBondContact O-N 3.08Å; I44-V48 HydrophobicContact CG2-CG2 4.03Å; I44-V48 VanDerWaalsContact O-CG2 3.3Å; I44-V48 WeakPolarHBondContact O-CG2 3.39Å; I44-V48 PolarHBondContact O-N 3.05Å
45	Q	94	Very high	91.8	Very high	117 Å²	117	101.4 Å²	101.4	55%	0.547	52%	0.521	S	S	.	.	H	α-helix	trans	-59.9	-36.3	-178.2	-74	-178.4	-30.7	0	0	112.8	K41 E42 G47	K41-Q45 VanDerWaalsContact CE-NE2 3.31Å; K41-Q45 HydrophobicContact CG-CG 4.33Å; K41-Q45 WeakPolarHBondContact O-CB 3.35Å; K41-Q45 VanDerWaalsContact O-CG 3.26Å; K41-Q45 WeakPolarHBondContact O-CG 3.47Å; K41-Q45 PolarHBondContact O-N 3.4Å; E42-Q45 PolarHBondContact O-N 3.25Å; Q45-G47 VanDerWaalsContact C-N 3.32Å; Q45-G47 PolarHBondContact O-N 3.01Å
46	A	94.1	Very high	91.1	Very high	80 Å²	80	99.3 Å²	99.3	66%	0.661	53%	0.526	S	S	*	.	H	α-helix	trans	-65.5	-34.2	174.9	0	0	0	0	0	112.8	E42 Y43 I44	E42-A46 WeakPolarHBondContact O-CB 3.27Å; E42-A46 PolarHBondContact O-N 3.45Å; Y43-A46 PolarHBondContact O-N 3.04Å; I44-A46 VanDerWaalsContact C-N 3.27Å; I44-A46 PolarHBondContact O-N 2.62Å
47	G	90.4	Very high	90.4	Very high	34 Å²	34	101 Å²	101	35%	0.351	53%	0.531	S	S	.	.	H	α-helix	trans	-88.9	-16.3	-178.6	0	0	0	0	0	115.6	Y43 I44 Q45 E49 E50 D51	Y43-G47 PolarHBondContact O-N 3.4Å; I44-G47 PolarHBondContact O-N 3.08Å; Q45-G47 VanDerWaalsContact C-N 3.32Å; Q45-G47 PolarHBondContact O-N 3.01Å; G47-E49 PolarHBondContact O-N 3.01Å; G47-E50 PolarHBondContact O-N 3.17Å; G47-E50 VanDerWaalsContact O-N 3.08Å; G47-D51 PolarHBondContact O-N 3.15Å
48	V	90.6	Very high	89.6	Confident	46 Å²	46	100.2 Å²	100.2	28%	0.279	53%	0.527	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.5	-33.8	-175.7	159.6	0	0	0	0	113.1	I44 E50 V54	I44-V48 HydrophobicContact CG2-CG2 4.03Å; I44-V48 VanDerWaalsContact O-CG2 3.3Å; I44-V48 WeakPolarHBondContact O-CG2 3.39Å; I44-V48 PolarHBondContact O-N 3.05Å; V48-E50 VanDerWaalsContact C-N 3.32Å; V48-V54 HydrophobicContact CG1-CG1 4.07Å
49	E	84.5	Confident	88.5	Confident	130 Å²	130	101 Å²	101	61%	0.607	53%	0.53	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73	-26.1	-179.1	-66.1	-59	131.2	0	0	113.2	G47 K55	G47-E49 PolarHBondContact O-N 3.01Å; E49-K55 VanDerWaalsContact OE1-CE 3.25Å; E49-K55 WeakPolarHBondContact OE1-CE 3.29Å; E49-K55 IonicContact OE1-NZ 2.88Å; E49-K55 PolarHBondContact OE1-NZ 2.94Å; E49-K55 WeakPolarHBondContact OE2-CE 3.48Å; E49-K55 IonicContact OE2-NZ 2.73Å; E49-K55 PolarHBondContact OE2-NZ 3.3Å
50	E	86.6	Confident	87.5	Confident	170 Å²	170	105.6 Å²	105.6	79%	0.794	55%	0.552	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.6	-11.7	179.3	-61	-175.7	169.9	0	0	112.5	G47 V48 T52	G47-E50 PolarHBondContact O-N 3.17Å; G47-E50 VanDerWaalsContact O-N 3.08Å; V48-E50 VanDerWaalsContact C-N 3.32Å; E50-T52 PolarHBondContact O-N 3.32Å
51	D	89.3	Confident	86.5	Confident	66 Å²	66	108.5 Å²	108.5	35%	0.353	56%	0.561	S	S	.	*			trans	-70.9	104.9	179.6	-169.1	-25.6	0	0	0	111.1	G47 L53 V54 K55	G47-D51 PolarHBondContact O-N 3.15Å; D51-L53 PolarHBondContact O-N 3.34Å; D51-L53 WeakPolarHBondContact OD1-CA 3.38Å; D51-L53 WeakPolarHBondContact OD1-CB 3.47Å; D51-L53 PolarHBondContact OD1-N 2.97Å; D51-V54 HydrophobicContact CB-CB 4.04Å; D51-V54 HydrophobicContact CB-CG2 3.89Å; D51-V54 PolarHBondContact O-N 3.34Å; D51-V54 PolarHBondContact OD1-N 2.9Å; D51-K55 PolarHBondContact O-N 2.96Å
52	T	85.3	Confident	85.8	Confident	76 Å²	76	105.1 Å²	105.1	47%	0.466	55%	0.549	S	S	.	.	H	α-helix	trans	-59	-25.8	177.8	58.8	0	0	0	0	114.2	E50 G56 I57	E50-T52 PolarHBondContact O-N 3.32Å; T52-G56 CarbonylContact O-C 3.2Å; T52-G56 WeakPolarHBondContact O-CA 3.32Å; T52-G56 PolarHBondContact O-N 3.39Å; T52-I57 PolarHBondContact O-N 3.27Å
53	L	86.3	Confident	84.9	Confident	159 Å²	159	103.3 Å²	103.3	83%	0.832	55%	0.548	S	S	*	.	H	α-helix	trans	-82.8	-22.5	177.6	-61	179.4	0	0	0	111.9	D51	D51-L53 PolarHBondContact O-N 3.34Å; D51-L53 WeakPolarHBondContact OD1-CA 3.38Å; D51-L53 WeakPolarHBondContact OD1-CB 3.47Å; D51-L53 PolarHBondContact OD1-N 2.97Å
54	V	86.9	Confident	84.1	Confident	86 Å²	86	103 Å²	103	52%	0.521	55%	0.551	S	S	.	*	H	α-helix	trans	-88.1	-47	175.9	-179.8	0	0	0	0	111.3	V48 D51	V48-V54 HydrophobicContact CG1-CG1 4.07Å; D51-V54 HydrophobicContact CB-CB 4.04Å; D51-V54 HydrophobicContact CB-CG2 3.89Å; D51-V54 PolarHBondContact O-N 3.34Å; D51-V54 PolarHBondContact OD1-N 2.9Å
55	K	84.8	Confident	83	Confident	113 Å²	113	103.2 Å²	103.2	49%	0.491	55%	0.549	S	S	.	.	H	α-helix	trans	-85.8	-15.8	-179.1	-66.4	-67.4	179.6	166	0	113.9	E49 D51	E49-K55 VanDerWaalsContact OE1-CE 3.25Å; E49-K55 WeakPolarHBondContact OE1-CE 3.29Å; E49-K55 IonicContact OE1-NZ 2.88Å; E49-K55 PolarHBondContact OE1-NZ 2.94Å; E49-K55 WeakPolarHBondContact OE2-CE 3.48Å; E49-K55 IonicContact OE2-NZ 2.73Å; E49-K55 PolarHBondContact OE2-NZ 3.3Å; D51-K55 PolarHBondContact O-N 2.96Å
56	G	80.1	Confident	81.7	Confident	50 Å²	50	105.9 Å²	105.9	52%	0.515	56%	0.561	S	S	.	*			trans	83.7	148.6	-172.4	0	0	0	0	0	111.8	T52	T52-G56 CarbonylContact O-C 3.2Å; T52-G56 WeakPolarHBondContact O-CA 3.32Å; T52-G56 PolarHBondContact O-N 3.39Å
57	I	81.3	Confident	80.2	Confident	71 Å²	71	111.7 Å²	111.7	36%	0.364	57%	0.572	S	S	.	*			trans	-97.8	135	175.8	-163.7	158	0	0	0	109.2	T52 K61 N62	T52-I57 PolarHBondContact O-N 3.27Å; I57-K61 HydrophobicContact CG1-CB 4.12Å; I57-N62 HydrophobicContact CG1-CB 4.38Å; I57-N62 HydrophobicContact CG2-CB 3.74Å
58	S	79.3	Confident	78.6	Confident	60 Å²	60	113 Å²	113	42%	0.42	59%	0.585	S	S	.	*			trans	-64.5	144.2	172	67	0	0	0	0	109.6	E60 K61 N62	S58-E60 PolarHBondContact O-N 3.39Å; S58-E60 VanDerWaalsContact O-N 3.13Å; S58-K61 PolarHBondContact O-N 2.98Å; S58-K61 WeakPolarHBondContact OG-CG 3.29Å; S58-N62 PolarHBondContact O-N 3.33Å
59	E	71.8	Confident	76.8	Confident	136 Å²	136	113.5 Å²	113.5	64%	0.636	60%	0.599	S	S	*	*	G	3₁₀ helix	trans	-54.1	-38.7	-176.4	-68.2	-168.1	-178.9	0	0	112.9	K61 N62 K65	E59-K61 VanDerWaalsContact C-N 3.29Å; E59-K61 PolarHBondContact O-N 3.01Å; E59-N62 PolarHBondContact O-N 3.3Å; E59-K65 HydrophobicContact CB-CD 4.05Å; E59-K65 WeakPolarHBondContact O-CD 3.41Å; E59-K65 IonicContact OE2-NZ 2.79Å; E59-K65 PolarHBondContact OE2-NZ 3.31Å
60	E	73.6	Confident	75.2	Confident	182 Å²	182	112.8 Å²	112.8	85%	0.85	61%	0.607	S	S	*	*	G	3₁₀ helix	trans	-66.6	-28	179.8	-61.3	-177.7	166.4	0	0	113.8	S58	S58-E60 PolarHBondContact O-N 3.39Å; S58-E60 VanDerWaalsContact O-N 3.13Å
61	K	77.2	Confident	73.9	Confident	163 Å²	163	110.3 Å²	110.3	71%	0.709	60%	0.603	S	S	*	*	G	3₁₀ helix	trans	-95.8	-8.5	179.5	-66.7	-178.1	-178.6	179.8	0	112.3	I57 S58 E59 P63	I57-K61 HydrophobicContact CG1-CB 4.12Å; S58-K61 PolarHBondContact O-N 2.98Å; S58-K61 WeakPolarHBondContact OG-CG 3.29Å; E59-K61 VanDerWaalsContact C-N 3.29Å; E59-K61 PolarHBondContact O-N 3.01Å; K61-P63 WeakPolarHBondContact O-CD 3.41Å
62	N	79.4	Confident	72.1	Confident	52 Å²	52	114.3 Å²	114.3	28%	0.278	62%	0.623	S	S	.	*			trans	-73.6	111.6	-179.4	-172.2	-7	0	0	0	110.3	I57 S58 E59 F64 K65	I57-N62 HydrophobicContact CG1-CB 4.38Å; I57-N62 HydrophobicContact CG2-CB 3.74Å; S58-N62 PolarHBondContact O-N 3.33Å; E59-N62 PolarHBondContact O-N 3.3Å; N62-F64 PolarHBondContact O-N 3.14Å; N62-F64 VanDerWaalsContact O-N 3.11Å; N62-F64 WeakPolarHBondContact OD1-CB 3.49Å; N62-F64 PolarHBondContact OD1-N 3.02Å; N62-K65 HydrophobicContact CB-CB 4.29Å; N62-K65 WeakPolarHBondContact O-CB 3.49Å; N62-K65 PolarHBondContact O-N 2.94Å
63	P	78.9	Confident	70.1	Confident	94 Å²	94	119.2 Å²	119.2	61%	0.61	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.2	-15.6	178.6	27.3	-33.1	0	0	0	113	K61	K61-P63 WeakPolarHBondContact O-CD 3.41Å
64	F	77.8	Confident	69.3	Low	182 Å²	182	117.3 Å²	117.3	80%	0.798	65%	0.65	S	S	*	*	T	Hydrogen-bonded Turn	trans	-101.8	9.5	176.9	-53.4	-76.3	0	0	0	113.4	N62 E66	N62-F64 PolarHBondContact O-N 3.14Å; N62-F64 VanDerWaalsContact O-N 3.11Å; N62-F64 WeakPolarHBondContact OD1-CB 3.49Å; N62-F64 PolarHBondContact OD1-N 3.02Å; F64-E66 PolarHBondContact O-N 3.12Å
65	K	70.1	Confident	68.3	Low	100 Å²	100	118.9 Å²	118.9	44%	0.435	66%	0.657	S	S	.	*	S	Bend	trans	-56.1	131.3	168.3	179.6	164.9	179.6	156	0	108.6	E59 N62 K67	E59-K65 HydrophobicContact CB-CD 4.05Å; E59-K65 WeakPolarHBondContact O-CD 3.41Å; E59-K65 IonicContact OE2-NZ 2.79Å; E59-K65 PolarHBondContact OE2-NZ 3.31Å; N62-K65 HydrophobicContact CB-CB 4.29Å; N62-K65 WeakPolarHBondContact O-CB 3.49Å; N62-K65 PolarHBondContact O-N 2.94Å; K65-K67 PolarHBondContact O-N 2.95Å
66	E	67.9	Low	67.4	Low	174 Å²	174	119.2 Å²	119.2	81%	0.813	67%	0.666	S	S	*	*			trans	-40.8	103.6	-172.2	-73.6	-169.4	143.6	0	0	112.8	F64 G68	F64-E66 PolarHBondContact O-N 3.12Å; E66-G68 PolarHBondContact O-N 3.46Å
67	K	61.6	Low	66.7	Low	202 Å²	202	123.3 Å²	123.3	88%	0.878	68%	0.675	S	S	*	*	S	Bend	trans	-86.3	73.2	162.5	-72.7	-169.9	179.2	179.9	0	108.4	K65	K65-K67 PolarHBondContact O-N 2.95Å
68	G	56.9	Low	65.8	Low	62 Å²	62	126.6 Å²	126.6	64%	0.639	69%	0.694	S	S	*	*			trans	83.5	120.3	171.1	0	0	0	0	0	113.7	E66	E66-G68 PolarHBondContact O-N 3.46Å
69	G	52.3	Low	64.9	Low	55 Å²	55	131 Å²	131	57%	0.567	71%	0.713	S	S	*	*			trans	-53.2	143.4	166.2	0	0	0	0	0	110.7	V71	G69-V71 PolarHBondContact O-N 3.27Å
70	C	52.7	Low	64.4	Low	115 Å²	115	130.6 Å²	130.6	78%	0.777	72%	0.718	S	S	*	*			trans	-53.8	109.7	172.4	-177.6	0	0	0	0	109	I72	C70-I72 PolarHBondContact O-N 3.06Å
71	V	57.7	Low	63.7	Low	118 Å²	118	126.7 Å²	126.7	72%	0.715	71%	0.708	S	S	*	*			trans	-83.4	98.9	164.6	-165.7	0	0	0	0	105.6	G69 C73	G69-V71 PolarHBondContact O-N 3.27Å; V71-C73 VanDerWaalsContact C-N 3.35Å; V71-C73 PolarHBondContact O-N 3.31Å
72	I	53	Low	62.5	Low	151 Å²	151	123.7 Å²	123.7	77%	0.774	71%	0.708	S	S	*	*			trans	-74.4	99.3	160.1	-56.1	179.5	0	0	0	105	C70	C70-I72 PolarHBondContact O-N 3.06Å
73	C	42.3	Very low	61	Low	179 Å²	179	130.2 Å²	130.2	100%	1.209	75%	0.747	S	S	*	*			trans	-79.5	0	162.4	-67.4	0	0	0	0	109.5	V71	V71-C73 VanDerWaalsContact C-N 3.35Å; V71-C73 PolarHBondContact O-N 3.31Å

Retrieved 73 of 73 residues in 160.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).