A0A087Y894_POEFO Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB (Q6DGZ5), UniProt , Accession A0A087Y894, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 68 aa.

						>A0A087Y894_POEFO|A0A087Y894
MSTTNNIAQARKLVEQLRIEAGIERIKVSKAAADLMSYCEQHARSDPLLVGVPTSENPFKDKKPCIIL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60	Low	83.9	Confident	203 Å²	203	109.9 Å²	109.9	100%	1	60%	0.602	S	S	*	*				0	-14.2	0	-73.7	-173	168.9	0	0	114	T4	M1-T4 PolarHBondContact O-OG1 3.21Å; M1-T4 VanDerWaalsContact O-OG1 3.07Å
2	S	68.3	Low	84.9	Confident	102 Å²	102	114.7 Å²	114.7	71%	0.713	61%	0.612	S	S	*	*	H	α-helix	trans	-73.2	-31.9	-178.7	-35.4	0	0	0	0	114.4	N6	S2-N6 PolarHBondContact O-N 3.07Å
3	T	73.1	Confident	85.9	Confident	105 Å²	105	113.9 Å²	113.9	64%	0.644	61%	0.607	S	S	*	*	H	α-helix	trans	-69.6	-40.3	-177.9	48.2	0	0	0	0	113	N6 I7	T3-N6 PolarHBondContact O-N 3.12Å; T3-I7 WeakPolarHBondContact O-CG1 3.43Å; T3-I7 PolarHBondContact O-N 3.3Å; T3-I7 VanDerWaalsContact O-N 3.12Å
4	T	74.9	Confident	86.7	Confident	86 Å²	86	110.2 Å²	110.2	53%	0.528	59%	0.591	S	S	.	*	H	α-helix	trans	-65.3	-38.8	177.2	48.6	0	0	0	0	112.1	M1 N6 I7 A8	M1-T4 PolarHBondContact O-OG1 3.21Å; M1-T4 VanDerWaalsContact O-OG1 3.07Å; T4-N6 VanDerWaalsContact C-N 3.34Å; T4-I7 PolarHBondContact O-N 3.38Å; T4-A8 PolarHBondContact O-N 2.97Å; T4-A8 VanDerWaalsContact O-N 3.08Å
5	N	84.1	Confident	87.4	Confident	104 Å²	104	109.8 Å²	109.8	56%	0.556	58%	0.584	S	S	*	*	H	α-helix	trans	-63.5	-40.8	174.9	-74.9	-8.6	0	0	0	111.6	A8 Q9	N5-A8 PolarHBondContact O-N 2.99Å; N5-Q9 VanDerWaalsContact O-CG 3.31Å; N5-Q9 WeakPolarHBondContact O-CG 3.39Å; N5-Q9 PolarHBondContact O-N 3.46Å
6	N	91.2	Very high	88.1	Confident	104 Å²	104	108.3 Å²	108.3	56%	0.556	57%	0.572	S	S	*	*	H	α-helix	trans	-63.4	-42.6	177.7	-164.5	-7.6	0	0	0	111.6	S2 T3 T4 A8 Q9 A10	S2-N6 PolarHBondContact O-N 3.07Å; T3-N6 PolarHBondContact O-N 3.12Å; T4-N6 VanDerWaalsContact C-N 3.34Å; N6-A8 PolarHBondContact O-N 3.41Å; N6-Q9 PolarHBondContact O-N 3.32Å; N6-A10 WeakPolarHBondContact O-CB 3.31Å; N6-A10 PolarHBondContact O-N 3.08Å
7	I	92.7	Very high	88.7	Confident	95 Å²	95	107.2 Å²	107.2	49%	0.487	57%	0.566	S	S	.	*	H	α-helix	trans	-63.2	-42.2	176.4	-64.4	166.7	0	0	0	111.3	T3 T4 A10 R11	T3-I7 WeakPolarHBondContact O-CG1 3.43Å; T3-I7 PolarHBondContact O-N 3.3Å; T3-I7 VanDerWaalsContact O-N 3.12Å; T4-I7 PolarHBondContact O-N 3.38Å; I7-A10 PolarHBondContact O-N 3.34Å; I7-R11 WeakPolarHBondContact O-CG 3.49Å; I7-R11 PolarHBondContact O-N 2.89Å
8	A	92.7	Very high	89.2	Confident	59 Å²	59	109.4 Å²	109.4	49%	0.488	57%	0.566	S	S	.	*	H	α-helix	trans	-64	-42.2	177.4	0	0	0	0	0	112.2	T4 N5 N6 R11 K12	T4-A8 PolarHBondContact O-N 2.97Å; T4-A8 VanDerWaalsContact O-N 3.08Å; N5-A8 PolarHBondContact O-N 2.99Å; N6-A8 PolarHBondContact O-N 3.41Å; A8-R11 PolarHBondContact O-N 3.04Å; A8-K12 PolarHBondContact O-N 3.44Å
9	Q	94.1	Very high	89.7	Confident	129 Å²	129	109.6 Å²	109.6	60%	0.603	57%	0.567	S	S	*	*	H	α-helix	trans	-62.8	-44.9	174.7	-72.8	173.8	-39.2	0	0	112	N5 N6 R11 K12 L13	N5-Q9 VanDerWaalsContact O-CG 3.31Å; N5-Q9 WeakPolarHBondContact O-CG 3.39Å; N5-Q9 PolarHBondContact O-N 3.46Å; N6-Q9 PolarHBondContact O-N 3.32Å; Q9-R11 PolarHBondContact O-N 2.9Å; Q9-K12 PolarHBondContact O-N 3.46Å; Q9-L13 PolarHBondContact O-N 3.19Å
10	A	95.6	Very high	90.1	Very high	46 Å²	46	108.4 Å²	108.4	38%	0.38	56%	0.558	S	S	.	*	H	α-helix	trans	-61.5	-42.1	177.6	0	0	0	0	0	111.9	N6 I7 L13 V14	N6-A10 WeakPolarHBondContact O-CB 3.31Å; N6-A10 PolarHBondContact O-N 3.08Å; I7-A10 PolarHBondContact O-N 3.34Å; A10-L13 PolarHBondContact O-N 2.62Å; A10-V14 WeakPolarHBondContact O-CG2 3.38Å; A10-V14 PolarHBondContact O-N 3.31Å
11	R	96.3	Very high	90.5	Very high	176 Å²	176	106.5 Å²	106.5	66%	0.664	56%	0.559	S	S	*	*	H	α-helix	trans	-60.6	-46.5	173.8	-73.5	176.6	-178.9	-179.3	-0	111.6	I7 A8 Q9 L13 V14 E15	I7-R11 WeakPolarHBondContact O-CG 3.49Å; I7-R11 PolarHBondContact O-N 2.89Å; A8-R11 PolarHBondContact O-N 3.04Å; Q9-R11 PolarHBondContact O-N 2.9Å; R11-L13 VanDerWaalsContact C-N 3.32Å; R11-L13 PolarHBondContact O-N 2.91Å; R11-V14 PolarHBondContact O-N 3.42Å; R11-E15 WeakPolarHBondContact O-CG 3.32Å; R11-E15 PolarHBondContact O-N 3.22Å
12	K	96.5	Very high	92.2	Very high	167 Å²	167	100 Å²	100	73%	0.726	54%	0.544	S	S	*	.	H	α-helix	trans	-59	-42.6	176.3	-174	-179.2	178.1	-177.7	0	111.9	A8 Q9 E15 Q16	A8-K12 PolarHBondContact O-N 3.44Å; Q9-K12 PolarHBondContact O-N 3.46Å; K12-E15 PolarHBondContact O-N 2.94Å; K12-Q16 PolarHBondContact O-N 2.95Å
13	L	96.8	Very high	93.7	Very high	105 Å²	105	100 Å²	100	55%	0.55	54%	0.535	S	S	.	.	H	α-helix	trans	-62.2	-43.7	175.8	178.3	62.8	0	0	0	111.5	Q9 A10 R11 Q16 L17	Q9-L13 PolarHBondContact O-N 3.19Å; A10-L13 PolarHBondContact O-N 2.62Å; R11-L13 VanDerWaalsContact C-N 3.32Å; R11-L13 PolarHBondContact O-N 2.91Å; L13-Q16 WeakPolarHBondContact O-CB 3.43Å; L13-Q16 PolarHBondContact O-N 2.91Å; L13-L17 HydrophobicContact CD1-CD1 4.39Å; L13-L17 HydrophobicContact CD1-CG 4.33Å; L13-L17 HydrophobicContact CG-CD1 4.12Å; L13-L17 HydrophobicContact CG-CG 4.48Å; L13-L17 WeakPolarHBondContact O-CG 3.25Å; L13-L17 PolarHBondContact O-N 3.15Å
14	V	97.9	Very high	94.8	Very high	62 Å²	62	103.9 Å²	103.9	38%	0.376	55%	0.545	S	S	.	.	H	α-helix	trans	-63.7	-42.4	177.9	170.7	0	0	0	0	111.5	A10 R11 Q16 L17 R18	A10-V14 WeakPolarHBondContact O-CG2 3.38Å; A10-V14 PolarHBondContact O-N 3.31Å; R11-V14 PolarHBondContact O-N 3.42Å; V14-Q16 VanDerWaalsContact C-N 3.32Å; V14-Q16 PolarHBondContact O-N 3.33Å; V14-L17 PolarHBondContact O-N 3.46Å; V14-R18 VanDerWaalsContact CG1-CZ 3.44Å; V14-R18 WeakPolarHBondContact O-CG 3.4Å; V14-R18 PolarHBondContact O-N 3.01Å
15	E	97.7	Very high	95.9	Very high	104 Å²	104	108 Å²	108	49%	0.486	55%	0.551	S	S	.	*	H	α-helix	trans	-60.6	-42.6	174.3	-64.2	-46.9	145.4	0	0	111.7	R11 K12 L17 R18 I19	R11-E15 WeakPolarHBondContact O-CG 3.32Å; R11-E15 PolarHBondContact O-N 3.22Å; K12-E15 PolarHBondContact O-N 2.94Å; E15-L17 PolarHBondContact O-N 3.25Å; E15-R18 PolarHBondContact O-N 3.04Å; E15-R18 IonicContact OE1-CZ 3.87Å; E15-R18 IonicContact OE1-NH1 2.62Å; E15-R18 PolarHBondContact OE1-NH1 2.85Å; E15-R18 IonicContact OE2-NH1 2.91Å; E15-R18 PolarHBondContact OE2-NH1 3.43Å; E15-I19 WeakPolarHBondContact O-CG1 3.32Å; E15-I19 PolarHBondContact O-N 3.41Å; E15-I19 VanDerWaalsContact O-N 3.16Å
16	Q	97.7	Very high	96.6	Very high	86 Å²	86	107.8 Å²	107.8	40%	0.402	55%	0.549	S	S	.	.	H	α-helix	trans	-61	-46	176.2	-177.7	59.9	34.6	0	0	111.9	K12 L13 V14 R18 I19 E20	K12-Q16 PolarHBondContact O-N 2.95Å; L13-Q16 WeakPolarHBondContact O-CB 3.43Å; L13-Q16 PolarHBondContact O-N 2.91Å; V14-Q16 VanDerWaalsContact C-N 3.32Å; V14-Q16 PolarHBondContact O-N 3.33Å; Q16-R18 VanDerWaalsContact C-N 3.29Å; Q16-R18 PolarHBondContact O-N 3.5Å; Q16-I19 WeakPolarHBondContact O-CB 3.44Å; Q16-I19 PolarHBondContact O-N 3Å; Q16-I19 VanDerWaalsContact O-N 3.15Å; Q16-E20 WeakPolarHBondContact CG-OE1 3.48Å; Q16-E20 PolarHBondContact NE2-OE1 3.44Å; Q16-E20 PolarHBondContact O-N 3.36Å
17	L	98.3	Very high	96.9	Very high	90 Å²	90	110.6 Å²	110.6	47%	0.471	56%	0.556	S	S	.	*	H	α-helix	trans	-63.1	-34.2	178.2	-70.9	172.2	0	0	0	112.3	L13 V14 E15 E20 A21	L13-L17 HydrophobicContact CD1-CD1 4.39Å; L13-L17 HydrophobicContact CD1-CG 4.33Å; L13-L17 HydrophobicContact CG-CD1 4.12Å; L13-L17 HydrophobicContact CG-CG 4.48Å; L13-L17 WeakPolarHBondContact O-CG 3.25Å; L13-L17 PolarHBondContact O-N 3.15Å; V14-L17 PolarHBondContact O-N 3.46Å; E15-L17 PolarHBondContact O-N 3.25Å; L17-E20 PolarHBondContact O-N 3.16Å; L17-A21 VanDerWaalsContact O-CB 3.25Å; L17-A21 WeakPolarHBondContact O-CB 3.43Å; L17-A21 PolarHBondContact O-N 3Å
18	R	98.1	Very high	97.2	Very high	147 Å²	147	112 Å²	112	56%	0.555	57%	0.569	S	S	*	*	H	α-helix	trans	-65.6	-39.7	174.3	-72.7	-177.3	-168.2	128.8	1.2	112	V14 E15 Q16 G22	V14-R18 VanDerWaalsContact CG1-CZ 3.44Å; V14-R18 WeakPolarHBondContact O-CG 3.4Å; V14-R18 PolarHBondContact O-N 3.01Å; E15-R18 PolarHBondContact O-N 3.04Å; E15-R18 IonicContact OE1-CZ 3.87Å; E15-R18 IonicContact OE1-NH1 2.62Å; E15-R18 PolarHBondContact OE1-NH1 2.85Å; E15-R18 IonicContact OE2-NH1 2.91Å; E15-R18 PolarHBondContact OE2-NH1 3.43Å; Q16-R18 VanDerWaalsContact C-N 3.29Å; Q16-R18 PolarHBondContact O-N 3.5Å; R18-G22 PolarHBondContact O-N 3.27Å
19	I	97.8	Very high	97.5	Very high	113 Å²	113	113.3 Å²	113.3	58%	0.579	58%	0.575	S	S	*	*	H	α-helix	trans	-62.1	-48.7	174.3	-64.7	166.8	0	0	0	109.9	E15 Q16 A21 G22	E15-I19 WeakPolarHBondContact O-CG1 3.32Å; E15-I19 PolarHBondContact O-N 3.41Å; E15-I19 VanDerWaalsContact O-N 3.16Å; Q16-I19 WeakPolarHBondContact O-CB 3.44Å; Q16-I19 PolarHBondContact O-N 3Å; Q16-I19 VanDerWaalsContact O-N 3.15Å; I19-A21 VanDerWaalsContact C-N 3.34Å; I19-A21 PolarHBondContact O-N 3.15Å; I19-G22 PolarHBondContact O-N 3.41Å; I19-G22 VanDerWaalsContact O-N 3.15Å
20	E	97.9	Very high	97.7	Very high	85 Å²	85	112.7 Å²	112.7	40%	0.397	57%	0.57	S	S	.	*	H	α-helix	trans	-67.5	-31.2	-179.4	-70.4	173.7	-163.6	0	0	113.7	Q16 L17 G22 I23 R25	Q16-E20 WeakPolarHBondContact CG-OE1 3.48Å; Q16-E20 PolarHBondContact NE2-OE1 3.44Å; Q16-E20 PolarHBondContact O-N 3.36Å; L17-E20 PolarHBondContact O-N 3.16Å; E20-G22 VanDerWaalsContact C-N 3.3Å; E20-I23 PolarHBondContact O-N 3.22Å; E20-R25 PolarHBondContact O-NH2 2.83Å
21	A	98	Very high	97.8	Very high	69 Å²	69	112.2 Å²	112.2	57%	0.57	57%	0.566	S	S	*	*	H	α-helix	trans	-65.3	-36.2	173.2	0	0	0	0	0	111.5	L17 I19 I23	L17-A21 VanDerWaalsContact O-CB 3.25Å; L17-A21 WeakPolarHBondContact O-CB 3.43Å; L17-A21 PolarHBondContact O-N 3Å; I19-A21 VanDerWaalsContact C-N 3.34Å; I19-A21 PolarHBondContact O-N 3.15Å; A21-I23 VanDerWaalsContact C-N 3.26Å; A21-I23 PolarHBondContact O-N 3.41Å
22	G	97.6	Very high	97.9	Very high	67 Å²	67	106.4 Å²	106.4	69%	0.691	56%	0.556	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.2	-5.6	179.2	0	0	0	0	0	115.6	R18 I19 E20 E24	R18-G22 PolarHBondContact O-N 3.27Å; I19-G22 PolarHBondContact O-N 3.41Å; I19-G22 VanDerWaalsContact O-N 3.15Å; E20-G22 VanDerWaalsContact C-N 3.3Å; G22-E24 PolarHBondContact O-N 2.99Å
23	I	97.9	Very high	98	Very high	101 Å²	101	100.8 Å²	100.8	52%	0.518	54%	0.54	S	S	.	.	S	Bend	trans	-71	122.3	176.7	-60.5	173.3	0	0	0	109.6	E20 A21 R25	E20-I23 PolarHBondContact O-N 3.22Å; A21-I23 VanDerWaalsContact C-N 3.26Å; A21-I23 PolarHBondContact O-N 3.41Å; I23-R25 PolarHBondContact O-N 3.34Å; I23-R25 PolarHBondContact O-NH1 3.37Å
24	E	97.7	Very high	98.1	Very high	186 Å²	186	99.9 Å²	99.9	87%	0.869	54%	0.536	S	S	*	.			trans	-65.4	126.8	172.4	-170.6	-179.3	-178.4	0	0	110.2	G22	G22-E24 PolarHBondContact O-N 2.99Å
25	R	97.9	Very high	98.1	Very high	172 Å²	172	102.4 Å²	102.4	65%	0.649	55%	0.547	S	S	*	.			trans	-105.9	139	-179.4	-66	171.7	-177.4	73	2	109.6	E20 I23	E20-R25 PolarHBondContact O-NH2 2.83Å; I23-R25 PolarHBondContact O-N 3.34Å; I23-R25 PolarHBondContact O-NH1 3.37Å
26	I	98	Very high	98.1	Very high	100 Å²	100	102.7 Å²	102.7	51%	0.513	55%	0.55	S	S	.	.			trans	-83	160.5	169.8	63.4	172.5	0	0	0	110.8	K30 A31	I26-K30 HydrophobicContact CB-CD 4.49Å; I26-K30 HydrophobicContact CD1-CG 4.41Å; I26-A31 HydrophobicContact CD1-CB 3.84Å; I26-A31 HydrophobicContact CG1-CB 4.28Å
27	K	98.4	Very high	98.2	Very high	163 Å²	163	100.8 Å²	100.8	71%	0.709	55%	0.546	S	S	*	.			trans	-62.1	139.6	172.6	-66.6	-175.2	179.7	176.8	0	110.2	S29 K30 A31	K27-S29 PolarHBondContact O-N 2.98Å; K27-K30 HydrophobicContact CB-CB 4.48Å; K27-K30 WeakPolarHBondContact O-CB 3.36Å; K27-K30 PolarHBondContact O-N 3.24Å; K27-A31 PolarHBondContact O-N 3.31Å; K27-A31 VanDerWaalsContact O-N 3.08Å
28	V	98.5	Very high	98.2	Very high	124 Å²	124	103.5 Å²	103.5	75%	0.752	55%	0.551	S	S	*	*	H	α-helix	trans	-56.4	-37.7	175.9	179.5	0	0	0	0	111.5	K30 A31 A32	V28-K30 VanDerWaalsContact C-N 3.31Å; V28-K30 PolarHBondContact O-N 3.38Å; V28-A31 PolarHBondContact O-N 2.87Å; V28-A32 WeakPolarHBondContact O-CB 3.42Å; V28-A32 PolarHBondContact O-N 3.3Å
29	S	98.4	Very high	98.2	Very high	87 Å²	87	100.3 Å²	100.3	61%	0.608	55%	0.55	S	S	*	*	H	α-helix	trans	-61.5	-36.5	176	56	0	0	0	0	113.3	K27 A33	K27-S29 PolarHBondContact O-N 2.98Å; S29-A33 WeakPolarHBondContact O-CB 3.39Å; S29-A33 PolarHBondContact O-N 3.13Å; S29-A33 VanDerWaalsContact O-N 3.08Å
30	K	98.4	Very high	98.1	Very high	117 Å²	117	101 Å²	101	51%	0.509	55%	0.551	S	S	.	*	H	α-helix	trans	-68.8	-49.7	174.6	178.1	174.8	176.5	176.8	0	110.6	I26 K27 V28 A32 A33 D34	I26-K30 HydrophobicContact CB-CD 4.49Å; I26-K30 HydrophobicContact CD1-CG 4.41Å; K27-K30 HydrophobicContact CB-CB 4.48Å; K27-K30 WeakPolarHBondContact O-CB 3.36Å; K27-K30 PolarHBondContact O-N 3.24Å; V28-K30 VanDerWaalsContact C-N 3.31Å; V28-K30 PolarHBondContact O-N 3.38Å; K30-A32 VanDerWaalsContact C-N 3.27Å; K30-A32 PolarHBondContact O-N 3.08Å; K30-A33 PolarHBondContact O-N 3.08Å; K30-A33 VanDerWaalsContact O-N 3.13Å; K30-D34 VanDerWaalsContact O-CG 3.29Å; K30-D34 PolarHBondContact O-N 3.43Å
31	A	98.6	Very high	98.1	Very high	35 Å²	35	103.4 Å²	103.4	29%	0.289	56%	0.562	S	S	.	*	H	α-helix	trans	-56.3	-42.6	177.5	0	0	0	0	0	112.1	I26 K27 V28 D34 L35	I26-A31 HydrophobicContact CD1-CB 3.84Å; I26-A31 HydrophobicContact CG1-CB 4.28Å; K27-A31 PolarHBondContact O-N 3.31Å; K27-A31 VanDerWaalsContact O-N 3.08Å; V28-A31 PolarHBondContact O-N 2.87Å; A31-D34 PolarHBondContact O-N 3.45Å; A31-L35 WeakPolarHBondContact O-CG 3.37Å; A31-L35 PolarHBondContact O-N 3.04Å
32	A	98.6	Very high	98	Very high	55 Å²	55	103.9 Å²	103.9	46%	0.455	55%	0.553	S	S	.	*	H	α-helix	trans	-65.1	-42	177	0	0	0	0	0	112.5	V28 K30 L35 M36	V28-A32 WeakPolarHBondContact O-CB 3.42Å; V28-A32 PolarHBondContact O-N 3.3Å; K30-A32 VanDerWaalsContact C-N 3.27Å; K30-A32 PolarHBondContact O-N 3.08Å; A32-L35 PolarHBondContact O-N 2.98Å; A32-M36 WeakPolarHBondContact O-CB 3.32Å; A32-M36 PolarHBondContact O-N 3.39Å
33	A	98.5	Very high	97.9	Very high	48 Å²	48	101.9 Å²	101.9	40%	0.397	53%	0.529	S	S	.	.	H	α-helix	trans	-64.5	-41.1	176.4	0	0	0	0	0	112.2	S29 K30 M36 S37	S29-A33 WeakPolarHBondContact O-CB 3.39Å; S29-A33 PolarHBondContact O-N 3.13Å; S29-A33 VanDerWaalsContact O-N 3.08Å; K30-A33 PolarHBondContact O-N 3.08Å; K30-A33 VanDerWaalsContact O-N 3.13Å; A33-M36 PolarHBondContact O-N 2.91Å; A33-S37 VanDerWaalsContact O-CB 3.31Å; A33-S37 WeakPolarHBondContact O-CB 3.42Å; A33-S37 PolarHBondContact O-N 3.29Å
34	D	98.2	Very high	97.7	Very high	86 Å²	86	108 Å²	108	46%	0.46	55%	0.546	S	S	.	.	H	α-helix	trans	-63.4	-43.5	177.2	-66	-19.4	0	0	0	110.8	K30 A31 Y38	K30-D34 VanDerWaalsContact O-CG 3.29Å; K30-D34 PolarHBondContact O-N 3.43Å; A31-D34 PolarHBondContact O-N 3.45Å; D34-Y38 WeakPolarHBondContact O-CB 3.31Å; D34-Y38 PolarHBondContact O-N 3.19Å
35	L	98.5	Very high	97.4	Very high	116 Å²	116	103.1 Å²	103.1	61%	0.607	53%	0.532	S	S	*	.	H	α-helix	trans	-64	-44.8	175.1	-72.2	173.8	0	0	0	112.4	A31 A32 Y38 C39	A31-L35 WeakPolarHBondContact O-CG 3.37Å; A31-L35 PolarHBondContact O-N 3.04Å; A32-L35 PolarHBondContact O-N 2.98Å; L35-Y38 WeakPolarHBondContact O-CB 3.35Å; L35-Y38 PolarHBondContact O-N 2.88Å; L35-C39 PolarHBondContact O-N 3.43Å; L35-C39 PolarHBondContact O-SG 2.91Å
36	M	98	Very high	97.3	Very high	110 Å²	110	98.2 Å²	98.2	54%	0.542	52%	0.519	S	S	.	.	H	α-helix	trans	-60.9	-47.9	177.7	-175.4	-179.5	75.9	0	0	111.1	A32 A33 Y38 C39 E40	A32-M36 WeakPolarHBondContact O-CB 3.32Å; A32-M36 PolarHBondContact O-N 3.39Å; A33-M36 PolarHBondContact O-N 2.91Å; M36-Y38 VanDerWaalsContact C-N 3.3Å; M36-Y38 PolarHBondContact O-N 3.39Å; M36-C39 PolarHBondContact O-N 2.97Å; M36-E40 HydrophobicContact CG-CG 4.49Å; M36-E40 WeakPolarHBondContact O-CG 3.49Å; M36-E40 PolarHBondContact O-N 2.92Å
37	S	98.1	Very high	97.1	Very high	46 Å²	46	96.8 Å²	96.8	32%	0.322	52%	0.516	S	S	.	.	H	α-helix	trans	-59.3	-41.4	176.7	-176.9	0	0	0	0	111.8	A33 E40 Q41	A33-S37 VanDerWaalsContact O-CB 3.31Å; A33-S37 WeakPolarHBondContact O-CB 3.42Å; A33-S37 PolarHBondContact O-N 3.29Å; S37-E40 PolarHBondContact O-N 3.2Å; S37-Q41 WeakPolarHBondContact O-CB 3.45Å; S37-Q41 WeakPolarHBondContact O-CG 3.47Å; S37-Q41 PolarHBondContact O-N 2.86Å; S37-Q41 PolarHBondContact O-NE2 3.34Å; S37-Q41 PolarHBondContact OG-NE2 2.81Å
38	Y	98.5	Very high	96.9	Very high	146 Å²	146	97 Å²	97	57%	0.573	52%	0.524	S	S	*	.	H	α-helix	trans	-60.7	-48.1	175.1	-176.6	-94.4	0	0	0	111.7	D34 L35 M36 Q41 H42	D34-Y38 WeakPolarHBondContact O-CB 3.31Å; D34-Y38 PolarHBondContact O-N 3.19Å; L35-Y38 WeakPolarHBondContact O-CB 3.35Å; L35-Y38 PolarHBondContact O-N 2.88Å; M36-Y38 VanDerWaalsContact C-N 3.3Å; M36-Y38 PolarHBondContact O-N 3.39Å; Y38-Q41 PolarHBondContact O-N 3.04Å; Y38-H42 AromaticContact CD2-CE1 3.67Å; Y38-H42 AromaticContact CD2-ND1 3.82Å; Y38-H42 AromaticContact CE2-CE1 3.38Å; Y38-H42 WeakPolarHBondContact CE2-CE1 3.38Å; Y38-H42 AromaticContact CE2-ND1 3.73Å; Y38-H42 AromaticContact CZ-CE1 3.88Å; Y38-H42 AromaticContact CZ-ND1 3.92Å; Y38-H42 PolarHBondContact O-N 2.83Å; Y38-H42 PolarHBondContact O-ND1 3.45Å
39	C	98.1	Very high	96.7	Very high	81 Å²	81	96.5 Å²	96.5	55%	0.547	52%	0.517	S	S	.	.	H	α-helix	trans	-61.7	-45	177.4	-71.4	0	0	0	0	112.1	L35 M36 Q41 H42 A43	L35-C39 PolarHBondContact O-N 3.43Å; L35-C39 PolarHBondContact O-SG 2.91Å; M36-C39 PolarHBondContact O-N 2.97Å; C39-Q41 PolarHBondContact O-N 3.15Å; C39-H42 PolarHBondContact O-N 3.45Å; C39-A43 WeakPolarHBondContact O-CA 3.27Å; C39-A43 VanDerWaalsContact O-CB 3.27Å; C39-A43 WeakPolarHBondContact O-CB 3.46Å; C39-A43 PolarHBondContact O-N 3.45Å
40	E	96.8	Very high	96.5	Very high	128 Å²	128	97 Å²	97	60%	0.598	52%	0.516	S	S	*	.	H	α-helix	trans	-62.7	-40.7	179.5	-73.3	175.8	167.8	0	0	112.6	M36 S37 H42	M36-E40 HydrophobicContact CG-CG 4.49Å; M36-E40 WeakPolarHBondContact O-CG 3.49Å; M36-E40 PolarHBondContact O-N 2.92Å; S37-E40 PolarHBondContact O-N 3.2Å; E40-H42 VanDerWaalsContact C-N 3.32Å; E40-H42 PolarHBondContact O-N 3.29Å
41	Q	97.2	Very high	96.1	Very high	135 Å²	135	93.6 Å²	93.6	63%	0.631	51%	0.514	S	S	*	.	H	α-helix	trans	-64.4	-36.2	178.1	-74.1	173.5	50.5	0	0	112.4	S37 Y38 C39	S37-Q41 WeakPolarHBondContact O-CB 3.45Å; S37-Q41 WeakPolarHBondContact O-CG 3.47Å; S37-Q41 PolarHBondContact O-N 2.86Å; S37-Q41 PolarHBondContact O-NE2 3.34Å; S37-Q41 PolarHBondContact OG-NE2 2.81Å; Y38-Q41 PolarHBondContact O-N 3.04Å; C39-Q41 PolarHBondContact O-N 3.15Å
42	H	96.9	Very high	95.7	Very high	79 Å²	79	94.7 Å²	94.7	37%	0.366	52%	0.517	S	S	.	.	H	α-helix	trans	-99.9	-8.7	-175	-62.2	82.6	0	0	0	113.7	Y38 C39 E40 R44 S45 D46	Y38-H42 AromaticContact CD2-CE1 3.67Å; Y38-H42 AromaticContact CD2-ND1 3.82Å; Y38-H42 AromaticContact CE2-CE1 3.38Å; Y38-H42 WeakPolarHBondContact CE2-CE1 3.38Å; Y38-H42 AromaticContact CE2-ND1 3.73Å; Y38-H42 AromaticContact CZ-CE1 3.88Å; Y38-H42 AromaticContact CZ-ND1 3.92Å; Y38-H42 PolarHBondContact O-N 2.83Å; Y38-H42 PolarHBondContact O-ND1 3.45Å; C39-H42 PolarHBondContact O-N 3.45Å; E40-H42 VanDerWaalsContact C-N 3.32Å; E40-H42 PolarHBondContact O-N 3.29Å; H42-R44 VanDerWaalsContact C-N 3.27Å; H42-R44 PolarHBondContact O-N 3.22Å; H42-S45 PolarHBondContact O-N 3.01Å; H42-S45 PolarHBondContact O-OG 3.37Å; H42-D46 PolarHBondContact O-N 2.9Å
43	A	95.7	Very high	95.3	Very high	24 Å²	24	95.4 Å²	95.4	20%	0.198	52%	0.517	C	S	.	.	H	α-helix	trans	-54.7	-41.4	-177.6	0	0	0	0	0	112.6	C39 S45 D46 L49 V50	C39-A43 WeakPolarHBondContact O-CA 3.27Å; C39-A43 VanDerWaalsContact O-CB 3.27Å; C39-A43 WeakPolarHBondContact O-CB 3.46Å; C39-A43 PolarHBondContact O-N 3.45Å; A43-S45 VanDerWaalsContact C-N 3.28Å; A43-S45 PolarHBondContact O-N 3.43Å; A43-D46 PolarHBondContact O-N 2.91Å; A43-L49 HydrophobicContact CB-CD2 3.61Å; A43-V50 VanDerWaalsContact O-CG2 3.31Å; A43-V50 WeakPolarHBondContact O-CG2 3.18Å
44	R	92	Very high	94.7	Very high	229 Å²	229	98.2 Å²	98.2	86%	0.864	53%	0.529	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.6	-24.6	-179.3	-67.1	-174.5	-177.1	159.1	2.4	114.1	H42	H42-R44 VanDerWaalsContact C-N 3.27Å; H42-R44 PolarHBondContact O-N 3.22Å
45	S	92.5	Very high	94.2	Very high	84 Å²	84	98.1 Å²	98.1	59%	0.587	54%	0.535	S	S	*	.	T	Hydrogen-bonded Turn	trans	-91.3	-5.3	178.3	52.7	0	0	0	0	113.2	H42 A43 P47	H42-S45 PolarHBondContact O-N 3.01Å; H42-S45 PolarHBondContact O-OG 3.37Å; A43-S45 VanDerWaalsContact C-N 3.28Å; A43-S45 PolarHBondContact O-N 3.43Å; S45-P47 WeakPolarHBondContact O-CD 3.2Å
46	D	95.3	Very high	93.7	Very high	69 Å²	69	98.8 Å²	98.8	37%	0.369	54%	0.535	S	S	.	.			trans	-84.7	108	179.4	-174.4	-18.2	0	0	0	110.2	H42 A43 L48 L49 V50	H42-D46 PolarHBondContact O-N 2.9Å; A43-D46 PolarHBondContact O-N 2.91Å; D46-L48 PolarHBondContact O-N 3.19Å; D46-L48 WeakPolarHBondContact OD1-CA 3.41Å; D46-L48 WeakPolarHBondContact OD1-CB 3.42Å; D46-L48 PolarHBondContact OD1-N 3.1Å; D46-L49 HydrophobicContact CB-CB 3.85Å; D46-L49 PolarHBondContact O-N 3.28Å; D46-L49 VanDerWaalsContact O-N 3.15Å; D46-L49 PolarHBondContact OD1-N 3.24Å; D46-V50 PolarHBondContact O-N 3.38Å
47	P	93.9	Very high	93.4	Very high	70 Å²	70	96.2 Å²	96.2	46%	0.455	52%	0.524	S	S	.	.	H	α-helix	trans	-62.8	-24.1	-179.9	-24.3	38.9	0	0	0	113.4	S45 G51 V52	S45-P47 WeakPolarHBondContact O-CD 3.2Å; P47-G51 WeakPolarHBondContact O-CA 3.12Å; P47-G51 PolarHBondContact O-N 3.03Å; P47-G51 VanDerWaalsContact O-N 3.1Å; P47-V52 HydrophobicContact CB-CG1 3.61Å; P47-V52 HydrophobicContact CB-CG2 4.33Å; P47-V52 HydrophobicContact CG-CG1 4.11Å
48	L	94.2	Very high	93	Very high	168 Å²	168	99.5 Å²	99.5	88%	0.88	54%	0.544	S	S	*	.	H	α-helix	trans	-84.8	-21.8	-179	-58.6	177.2	0	0	0	111.8	D46	D46-L48 PolarHBondContact O-N 3.19Å; D46-L48 WeakPolarHBondContact OD1-CA 3.41Å; D46-L48 WeakPolarHBondContact OD1-CB 3.42Å; D46-L48 PolarHBondContact OD1-N 3.1Å
49	L	94.6	Very high	92.6	Very high	114 Å²	114	101.3 Å²	101.3	60%	0.597	56%	0.555	S	S	*	*	H	α-helix	trans	-90.4	-49.9	177.1	-173.8	62.4	0	0	0	112.5	A43 D46	A43-L49 HydrophobicContact CB-CD2 3.61Å; D46-L49 HydrophobicContact CB-CB 3.85Å; D46-L49 PolarHBondContact O-N 3.28Å; D46-L49 VanDerWaalsContact O-N 3.15Å; D46-L49 PolarHBondContact OD1-N 3.24Å
50	V	93	Very high	91.9	Very high	98 Å²	98	102 Å²	102	59%	0.594	55%	0.549	S	S	*	.	H	α-helix	trans	-93.1	-20	-176	176.1	0	0	0	0	112.5	A43 D46	A43-V50 VanDerWaalsContact O-CG2 3.31Å; A43-V50 WeakPolarHBondContact O-CG2 3.18Å; D46-V50 PolarHBondContact O-N 3.38Å
51	G	90.5	Very high	91.1	Very high	45 Å²	45	103.3 Å²	103.3	46%	0.464	56%	0.56	S	S	.	*			trans	79.7	157.8	-167.2	0	0	0	0	0	111.4	P47	P47-G51 WeakPolarHBondContact O-CA 3.12Å; P47-G51 PolarHBondContact O-N 3.03Å; P47-G51 VanDerWaalsContact O-N 3.1Å
52	V	91.1	Very high	90.2	Very high	57 Å²	57	106.5 Å²	106.5	35%	0.345	57%	0.572	S	S	.	*			trans	-123.8	150.6	172.1	-72.9	0	0	0	0	109.6	P47 E56 N57	P47-V52 HydrophobicContact CB-CG1 3.61Å; P47-V52 HydrophobicContact CB-CG2 4.33Å; P47-V52 HydrophobicContact CG-CG1 4.11Å; V52-E56 HydrophobicContact CB-CB 4.48Å; V52-N57 HydrophobicContact CG2-CB 4.13Å
53	P	89.8	Confident	89.1	Confident	70 Å²	70	112.1 Å²	112.1	46%	0.455	60%	0.595	S	S	.	*			trans	-53.5	143.7	172.9	-24.8	34.1	0	0	0	111.3	S55 E56 N57	P53-S55 PolarHBondContact O-N 2.75Å; P53-E56 PolarHBondContact O-N 3.21Å; P53-N57 PolarHBondContact O-N 3.21Å; P53-N57 VanDerWaalsContact O-N 3.15Å
54	T	85.3	Confident	88.1	Confident	107 Å²	107	116.4 Å²	116.4	66%	0.656	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.7	-31.9	177.8	-48.8	0	0	0	0	111.7	E56 K60	T54-E56 VanDerWaalsContact C-N 3.32Å; T54-E56 PolarHBondContact O-N 3.27Å; T54-K60 HydrophobicContact CG2-CB 3.81Å; T54-K60 HydrophobicContact CG2-CD 4.38Å; T54-K60 WeakPolarHBondContact O-CD 3.47Å
55	S	87.3	Confident	87.2	Confident	84 Å²	84	111.1 Å²	111.1	59%	0.587	62%	0.618	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.5	-38.3	176.5	47.2	0	0	0	0	113.7	P53 K60	P53-S55 PolarHBondContact O-N 2.75Å; S55-K60 PolarHBondContact O-NZ 3.02Å
56	E	88.9	Confident	86.4	Confident	131 Å²	131	113.9 Å²	113.9	61%	0.612	63%	0.625	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86	-25	-176.8	-67.4	178.9	-161.2	0	0	112.7	V52 P53 T54 P58	V52-E56 HydrophobicContact CB-CB 4.48Å; P53-E56 PolarHBondContact O-N 3.21Å; T54-E56 VanDerWaalsContact C-N 3.32Å; T54-E56 PolarHBondContact O-N 3.27Å; E56-P58 WeakPolarHBondContact O-CD 3.31Å
57	N	90.8	Very high	85.4	Confident	56 Å²	56	118.1 Å²	118.1	30%	0.299	65%	0.646	S	S	.	*			trans	-66.1	112.8	176.4	-174.5	-4.2	0	0	0	110.9	V52 P53 F59 K60	V52-N57 HydrophobicContact CG2-CB 4.13Å; P53-N57 PolarHBondContact O-N 3.21Å; P53-N57 VanDerWaalsContact O-N 3.15Å; N57-F59 PolarHBondContact O-N 3.15Å; N57-F59 WeakPolarHBondContact OD1-CB 3.44Å; N57-F59 PolarHBondContact OD1-N 3.43Å; N57-K60 WeakPolarHBondContact O-CB 2.89Å; N57-K60 WeakPolarHBondContact O-CG 3.5Å; N57-K60 PolarHBondContact O-N 2.91Å
58	P	90.2	Very high	84.1	Confident	114 Å²	114	125.7 Å²	125.7	74%	0.74	68%	0.681	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.4	-20.7	178.6	-19.7	34.5	0	0	0	113.1	E56	E56-P58 WeakPolarHBondContact O-CD 3.31Å
59	F	89.7	Confident	83.6	Confident	185 Å²	185	123.6 Å²	123.6	81%	0.811	67%	0.671	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.1	13	-178.9	-54.1	-79	0	0	0	113.2	N57	N57-F59 PolarHBondContact O-N 3.15Å; N57-F59 WeakPolarHBondContact OD1-CB 3.44Å; N57-F59 PolarHBondContact OD1-N 3.43Å
60	K	83.6	Confident	83.1	Confident	95 Å²	95	124.1 Å²	124.1	41%	0.413	68%	0.675	S	S	.	*			trans	-61.8	143.8	174.4	74.8	-163.9	-177.9	-169.1	0	111.2	T54 S55 N57 K62	T54-K60 HydrophobicContact CG2-CB 3.81Å; T54-K60 HydrophobicContact CG2-CD 4.38Å; T54-K60 WeakPolarHBondContact O-CD 3.47Å; S55-K60 PolarHBondContact O-NZ 3.02Å; N57-K60 WeakPolarHBondContact O-CB 2.89Å; N57-K60 WeakPolarHBondContact O-CG 3.5Å; N57-K60 PolarHBondContact O-N 2.91Å; K60-K62 PolarHBondContact O-N 3.37Å
61	D	81.4	Confident	82.5	Confident	156 Å²	156	125.5 Å²	125.5	83%	0.834	68%	0.679	S	S	*	*			trans	-59.5	127.1	171.8	-70.9	-47.1	0	0	0	110.5	K63	D61-K63 PolarHBondContact O-N 3.25Å
62	K	77.4	Confident	82	Confident	202 Å²	202	130.2 Å²	130.2	88%	0.878	69%	0.692	S	S	*	*			trans	-72.2	109.2	171.7	-67.6	-179.7	-179.8	177.3	0	107.6	K60 P64	K60-K62 PolarHBondContact O-N 3.37Å; K62-P64 WeakPolarHBondContact O-CD 3.11Å
63	K	73.5	Confident	81.5	Confident	196 Å²	196	134.8 Å²	134.8	85%	0.852	71%	0.713	S	S	*	*			trans	-60.6	123.3	169	-69.7	-169.8	177.6	-174.8	0	108.1	D61 C65	D61-K63 PolarHBondContact O-N 3.25Å; K63-C65 PolarHBondContact O-N 2.94Å
64	P	76	Confident	80.9	Confident	115 Å²	115	139.1 Å²	139.1	75%	0.747	73%	0.731	S	S	*	*			trans	-61.4	126	173.4	24.8	-31.3	0	0	0	108.5	K62 I66	K62-P64 WeakPolarHBondContact O-CD 3.11Å; P64-I66 PolarHBondContact O-N 3.18Å
65	C	72.5	Confident	80.6	Confident	118 Å²	118	141.4 Å²	141.4	80%	0.797	74%	0.736	S	S	*	*			trans	-77.2	112	169.3	-167.5	0	0	0	0	107.1	K63 I67	K63-C65 PolarHBondContact O-N 2.94Å; C65-I67 PolarHBondContact O-N 3.36Å
66	I	76.3	Confident	80.1	Confident	142 Å²	142	145.8 Å²	145.8	73%	0.728	75%	0.747	S	S	*	*			trans	-82.8	110.5	170.9	-40.4	173.9	0	0	0	105.6	P64 L68	P64-I66 PolarHBondContact O-N 3.18Å; I66-L68 PolarHBondContact O-N 3.45Å
67	I	74.2	Confident	79.4	Confident	158 Å²	158	147.1 Å²	147.1	81%	0.81	76%	0.759	S	S	*	*			trans	-76	112.1	167	-57.7	173.1	0	0	0	105.6	C65	C65-I67 PolarHBondContact O-N 3.36Å
68	L	66.7	Low	78.3	Confident	228 Å²	228	155.4 Å²	155.4	100%	1.194	80%	0.801	S	S	*	*			trans	-82.6	0	166	-89.2	144.2	0	0	0	109.5	I66	I66-L68 PolarHBondContact O-N 3.45Å

Retrieved 68 of 68 residues in 44.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).