A0A087YD45_POEFO Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB (A0A3B3UVE0), UniProt , Accession A0A087YD45, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 70 aa.

						>A0A087YD45_POEFO|A0A087YD45
MARDMSDKEILKMELEQLKKEVSTPRTAVSANCADTIAYVEGLLPSDPLIKGVPDDKNPYKGDKGGCTVT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.1	Low	81	Confident	202 Å²	202	119.5 Å²	119.5	100%	0.995	60%	0.6	S	S	*	*				0	-71.5	0	-66.9	-144.3	-103.9	0	0	111.4	D4	M1-D4 PolarHBondContact N-OD2 3.31Å
2	A	60.3	Low	82.2	Confident	71 Å²	71	119.3 Å²	119.3	59%	0.587	59%	0.592	S	S	*	*			trans	-83.1	-22.2	173.9	0	0	0	0	0	114.4
3	R	64.4	Low	83.1	Confident	244 Å²	244	118 Å²	118	92%	0.921	59%	0.586	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.1	-10.7	-176.8	-69	-173.6	174	171.1	-1.6	114.7
4	D	79.1	Confident	83.9	Confident	136 Å²	136	117.1 Å²	117.1	73%	0.727	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	-105.3	2.9	-174.6	-46.9	-64.3	0	0	0	112.7	M1	M1-D4 PolarHBondContact N-OD2 3.31Å
5	M	79.3	Confident	84.7	Confident	59 Å²	59	115.3 Å²	115.3	29%	0.291	57%	0.572	S	S	.	*	S	Bend	trans	-99.8	148.3	-179	-66.9	-166.3	-58.6	0	0	110.9	E9 I10 M13	M5-E9 HydrophobicContact CB-CB 4.2Å; M5-E9 HydrophobicContact SD-CB 4.49Å; M5-I10 HydrophobicContact CB-CG1 4.05Å; M5-I10 HydrophobicContact CE-CG1 3.98Å; M5-M13 HydrophobicContact CE-CE 4.16Å; M5-M13 HydrophobicContact CE-SD 3.43Å; M5-M13 WeakPolarHBondContact CE-SD 3.47Å; M5-M13 HydrophobicContact SD-SD 3.52Å
6	S	88.1	Confident	85.4	Confident	58 Å²	58	115.3 Å²	115.3	41%	0.406	57%	0.57	S	S	.	*			trans	-68.6	152.9	171.9	65.4	0	0	0	0	111.2	K8 E9 I10	S6-K8 PolarHBondContact O-N 2.73Å; S6-E9 WeakPolarHBondContact CB-OE2 3.35Å; S6-E9 PolarHBondContact N-OE2 3.01Å; S6-E9 WeakPolarHBondContact O-CB 3.46Å; S6-E9 PolarHBondContact O-N 3.08Å; S6-E9 VanDerWaalsContact OG-CD 3.24Å; S6-E9 WeakPolarHBondContact OG-CG 3.37Å; S6-E9 PolarHBondContact OG-N 3.41Å; S6-E9 PolarHBondContact OG-OE2 3.29Å; S6-I10 PolarHBondContact O-N 2.97Å; S6-I10 VanDerWaalsContact O-N 3.08Å
7	D	90.3	Very high	86.1	Confident	130 Å²	130	113.8 Å²	113.8	70%	0.695	56%	0.561	S	S	*	*	H	α-helix	trans	-52.2	-35.6	176.8	-62.3	-17.4	0	0	0	112.3	E9 I10 L11	D7-E9 PolarHBondContact O-N 3.27Å; D7-I10 PolarHBondContact O-N 3.42Å; D7-L11 WeakPolarHBondContact O-CB 3.39Å; D7-L11 VanDerWaalsContact O-CG 3.27Å; D7-L11 WeakPolarHBondContact O-CG 3.48Å; D7-L11 PolarHBondContact O-N 2.94Å
8	K	91.7	Very high	86.8	Confident	144 Å²	144	112.7 Å²	112.7	63%	0.626	56%	0.557	S	S	*	*	H	α-helix	trans	-65.5	-37.2	177.1	-173.8	177.3	-176.8	176.8	0	112.7	S6 K12	S6-K8 PolarHBondContact O-N 2.73Å; K8-K12 WeakPolarHBondContact O-CG 3.45Å; K8-K12 PolarHBondContact O-N 3.33Å; K8-K12 VanDerWaalsContact O-N 3.13Å
9	E	91.9	Very high	87.3	Confident	97 Å²	97	114.2 Å²	114.2	45%	0.453	56%	0.56	S	S	.	*	H	α-helix	trans	-73.2	-40.6	178.5	-71.7	162.3	143.9	0	0	110.9	M5 S6 D7 L11 K12 M13	M5-E9 HydrophobicContact CB-CB 4.2Å; M5-E9 HydrophobicContact SD-CB 4.49Å; S6-E9 WeakPolarHBondContact CB-OE2 3.35Å; S6-E9 PolarHBondContact N-OE2 3.01Å; S6-E9 WeakPolarHBondContact O-CB 3.46Å; S6-E9 PolarHBondContact O-N 3.08Å; S6-E9 VanDerWaalsContact OG-CD 3.24Å; S6-E9 WeakPolarHBondContact OG-CG 3.37Å; S6-E9 PolarHBondContact OG-N 3.41Å; S6-E9 PolarHBondContact OG-OE2 3.29Å; D7-E9 PolarHBondContact O-N 3.27Å; E9-L11 PolarHBondContact O-N 3.34Å; E9-K12 PolarHBondContact O-N 3.48Å; E9-M13 WeakPolarHBondContact O-CG 3.32Å; E9-M13 PolarHBondContact O-N 2.69Å
10	I	92.2	Very high	87.8	Confident	66 Å²	66	114.8 Å²	114.8	34%	0.338	56%	0.56	S	S	.	*	H	α-helix	trans	-57.6	-49.6	173.7	-64.8	168.8	0	0	0	110.3	M5 S6 D7 K12 M13 E14	M5-I10 HydrophobicContact CB-CG1 4.05Å; M5-I10 HydrophobicContact CE-CG1 3.98Å; S6-I10 PolarHBondContact O-N 2.97Å; S6-I10 VanDerWaalsContact O-N 3.08Å; D7-I10 PolarHBondContact O-N 3.42Å; I10-K12 VanDerWaalsContact C-N 3.33Å; I10-K12 PolarHBondContact O-N 2.89Å; I10-M13 PolarHBondContact O-N 3.38Å; I10-E14 PolarHBondContact O-N 2.92Å
11	L	93.6	Very high	88.3	Confident	107 Å²	107	113.3 Å²	113.3	56%	0.56	55%	0.552	S	S	*	*	H	α-helix	trans	-64	-36.4	179.7	-72.6	170.8	0	0	0	112.8	D7 E9 L15	D7-L11 WeakPolarHBondContact O-CB 3.39Å; D7-L11 VanDerWaalsContact O-CG 3.27Å; D7-L11 WeakPolarHBondContact O-CG 3.48Å; D7-L11 PolarHBondContact O-N 2.94Å; E9-L11 PolarHBondContact O-N 3.34Å; L11-L15 WeakPolarHBondContact O-CB 3.44Å; L11-L15 PolarHBondContact O-N 3.13Å
12	K	94.9	Very high	90	Very high	117 Å²	117	109 Å²	109	51%	0.509	54%	0.536	S	S	.	.	H	α-helix	trans	-64.5	-43.2	174.4	-79.1	177	177.3	-174.1	0	111.6	K8 E9 I10 L15 E16	K8-K12 WeakPolarHBondContact O-CG 3.45Å; K8-K12 PolarHBondContact O-N 3.33Å; K8-K12 VanDerWaalsContact O-N 3.13Å; E9-K12 PolarHBondContact O-N 3.48Å; I10-K12 VanDerWaalsContact C-N 3.33Å; I10-K12 PolarHBondContact O-N 2.89Å; K12-L15 PolarHBondContact O-N 3.34Å; K12-E16 WeakPolarHBondContact O-CG 3.45Å; K12-E16 PolarHBondContact O-N 2.96Å
13	M	93.9	Very high	91.7	Very high	103 Å²	103	109.9 Å²	109.9	51%	0.507	54%	0.538	S	S	.	.	H	α-helix	trans	-64.3	-41.7	177.7	-73.3	179.7	59.4	0	0	112.1	M5 E9 I10 L15 E16 Q17	M5-M13 HydrophobicContact CE-CE 4.16Å; M5-M13 HydrophobicContact CE-SD 3.43Å; M5-M13 WeakPolarHBondContact CE-SD 3.47Å; M5-M13 HydrophobicContact SD-SD 3.52Å; E9-M13 WeakPolarHBondContact O-CG 3.32Å; E9-M13 PolarHBondContact O-N 2.69Å; I10-M13 PolarHBondContact O-N 3.38Å; M13-L15 VanDerWaalsContact C-N 3.35Å; M13-E16 PolarHBondContact O-N 3.32Å; M13-Q17 WeakPolarHBondContact O-CB 3.5Å; M13-Q17 PolarHBondContact O-N 2.78Å
14	E	94.2	Very high	93.2	Very high	106 Å²	106	101.7 Å²	101.7	50%	0.495	52%	0.515	S	S	.	.	H	α-helix	trans	-60.5	-45.2	174.2	-175	177.7	-178.6	0	0	111.2	I10 E16 Q17 L18	I10-E14 PolarHBondContact O-N 2.92Å; E14-E16 VanDerWaalsContact C-N 3.34Å; E14-E16 PolarHBondContact O-N 3.35Å; E14-Q17 PolarHBondContact O-N 2.88Å; E14-Q17 VanDerWaalsContact O-N 3.16Å; E14-L18 HydrophobicContact CG-CD1 4.13Å; E14-L18 HydrophobicContact CG-CG 4.49Å; E14-L18 WeakPolarHBondContact O-CG 3.33Å; E14-L18 PolarHBondContact O-N 3.16Å
15	L	96.5	Very high	94.1	Very high	89 Å²	89	101.1 Å²	101.1	47%	0.466	52%	0.519	S	S	.	.	H	α-helix	trans	-62.4	-41.8	178.2	-152.6	178.1	0	0	0	111.5	L11 K12 M13 Q17 L18 K19	L11-L15 WeakPolarHBondContact O-CB 3.44Å; L11-L15 PolarHBondContact O-N 3.13Å; K12-L15 PolarHBondContact O-N 3.34Å; M13-L15 VanDerWaalsContact C-N 3.35Å; L15-Q17 VanDerWaalsContact C-N 3.33Å; L15-L18 PolarHBondContact O-N 3.03Å; L15-K19 HydrophobicContact CD2-CD 3.63Å; L15-K19 HydrophobicContact CD2-CG 3.92Å; L15-K19 WeakPolarHBondContact O-CB 3.49Å; L15-K19 WeakPolarHBondContact O-CG 3.35Å; L15-K19 PolarHBondContact O-N 3Å
16	E	96.6	Very high	94.9	Very high	115 Å²	115	106.9 Å²	106.9	54%	0.537	54%	0.537	S	S	.	.	H	α-helix	trans	-62.8	-39	174.3	-75.5	-177.1	-177.1	0	0	112.6	K12 M13 E14 K20	K12-E16 WeakPolarHBondContact O-CG 3.45Å; K12-E16 PolarHBondContact O-N 2.96Å; M13-E16 PolarHBondContact O-N 3.32Å; E14-E16 VanDerWaalsContact C-N 3.34Å; E14-E16 PolarHBondContact O-N 3.35Å; E16-K20 WeakPolarHBondContact O-CG 3.4Å; E16-K20 PolarHBondContact O-N 3.4Å
17	Q	97.3	Very high	95.3	Very high	90 Å²	90	108.5 Å²	108.5	42%	0.421	55%	0.545	S	S	.	.	H	α-helix	trans	-67.2	-46.6	176.6	-176.9	59.7	21.5	0	0	111.5	M13 E14 L15 K19 K20 E21	M13-Q17 WeakPolarHBondContact O-CB 3.5Å; M13-Q17 PolarHBondContact O-N 2.78Å; E14-Q17 PolarHBondContact O-N 2.88Å; E14-Q17 VanDerWaalsContact O-N 3.16Å; L15-Q17 VanDerWaalsContact C-N 3.33Å; Q17-K19 VanDerWaalsContact C-N 3.29Å; Q17-K19 PolarHBondContact O-N 2.93Å; Q17-K20 WeakPolarHBondContact O-CA 3.42Å; Q17-K20 WeakPolarHBondContact O-CB 3.46Å; Q17-K20 PolarHBondContact O-N 3.26Å; Q17-E21 HydrophobicContact CG-CG 4.49Å; Q17-E21 WeakPolarHBondContact CG-OE1 3.34Å; Q17-E21 PolarHBondContact NE2-OE1 2.95Å; Q17-E21 PolarHBondContact O-N 3.19Å
18	L	97.7	Very high	95.6	Very high	94 Å²	94	105.1 Å²	105.1	49%	0.492	54%	0.535	S	S	.	.	H	α-helix	trans	-60.5	-38.4	177.3	-70.6	172.2	0	0	0	112.2	E14 L15 K20 E21 V22	E14-L18 HydrophobicContact CG-CD1 4.13Å; E14-L18 HydrophobicContact CG-CG 4.49Å; E14-L18 WeakPolarHBondContact O-CG 3.33Å; E14-L18 PolarHBondContact O-N 3.16Å; L15-L18 PolarHBondContact O-N 3.03Å; L18-K20 PolarHBondContact O-N 3.32Å; L18-E21 PolarHBondContact O-N 2.99Å; L18-V22 PolarHBondContact O-N 3.47Å
19	K	97.3	Very high	95.9	Very high	141 Å²	141	103.6 Å²	103.6	61%	0.613	54%	0.538	S	S	*	.	H	α-helix	trans	-62.5	-28.9	173.3	-81.2	173	171.4	169.6	0	113.2	L15 Q17 V22	L15-K19 HydrophobicContact CD2-CD 3.63Å; L15-K19 HydrophobicContact CD2-CG 3.92Å; L15-K19 WeakPolarHBondContact O-CB 3.49Å; L15-K19 WeakPolarHBondContact O-CG 3.35Å; L15-K19 PolarHBondContact O-N 3Å; Q17-K19 VanDerWaalsContact C-N 3.29Å; Q17-K19 PolarHBondContact O-N 2.93Å; K19-V22 WeakPolarHBondContact O-CG1 3.43Å
20	K	97.1	Very high	96.1	Very high	127 Å²	127	103.3 Å²	103.3	55%	0.552	55%	0.547	S	S	*	.	H	α-helix	trans	-77.2	-49.3	173.1	-66.9	170.4	-173.7	171.4	0	110.2	E16 Q17 L18 V22 S23	E16-K20 WeakPolarHBondContact O-CG 3.4Å; E16-K20 PolarHBondContact O-N 3.4Å; Q17-K20 WeakPolarHBondContact O-CA 3.42Å; Q17-K20 WeakPolarHBondContact O-CB 3.46Å; Q17-K20 PolarHBondContact O-N 3.26Å; L18-K20 PolarHBondContact O-N 3.32Å; K20-V22 VanDerWaalsContact C-N 3.29Å; K20-V22 PolarHBondContact O-N 3.13Å; K20-S23 PolarHBondContact O-N 3.49Å; K20-S23 VanDerWaalsContact O-N 3.08Å; K20-S23 PolarHBondContact O-OG 3.47Å
21	E	96.8	Very high	96.4	Very high	84 Å²	84	102.3 Å²	102.3	39%	0.393	55%	0.548	S	S	.	.	H	α-helix	trans	-64.8	-27.3	-174.5	-70.6	179.6	-167.7	0	0	114.7	Q17 L18 S23 T24 R26	Q17-E21 HydrophobicContact CG-CG 4.49Å; Q17-E21 WeakPolarHBondContact CG-OE1 3.34Å; Q17-E21 PolarHBondContact NE2-OE1 2.95Å; Q17-E21 PolarHBondContact O-N 3.19Å; L18-E21 PolarHBondContact O-N 2.99Å; E21-S23 PolarHBondContact O-N 2.88Å; E21-T24 WeakPolarHBondContact CA-OG1 3.43Å; E21-T24 WeakPolarHBondContact O-CB 3.33Å; E21-T24 PolarHBondContact O-N 2.72Å; E21-T24 PolarHBondContact O-OG1 2.86Å; E21-R26 PolarHBondContact O-NH2 3.09Å
22	V	97.1	Very high	96.5	Very high	110 Å²	110	100.6 Å²	100.6	67%	0.667	54%	0.539	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.5	-34.9	175.2	73.6	0	0	0	0	111.5	L18 K19 K20 T24	L18-V22 PolarHBondContact O-N 3.47Å; K19-V22 WeakPolarHBondContact O-CG1 3.43Å; K20-V22 VanDerWaalsContact C-N 3.29Å; K20-V22 PolarHBondContact O-N 3.13Å; V22-T24 VanDerWaalsContact C-N 3.33Å
23	S	95.7	Very high	96.7	Very high	91 Å²	91	98 Å²	98	64%	0.636	54%	0.535	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.5	-5.1	-178.7	69.4	0	0	0	0	114	K20 E21 P25	K20-S23 PolarHBondContact O-N 3.49Å; K20-S23 VanDerWaalsContact O-N 3.08Å; K20-S23 PolarHBondContact O-OG 3.47Å; E21-S23 PolarHBondContact O-N 2.88Å; S23-P25 WeakPolarHBondContact O-CD 3.46Å
24	T	96.6	Very high	96.8	Very high	71 Å²	71	95.8 Å²	95.8	44%	0.436	53%	0.533	S	S	.	.			trans	-63.8	121.6	-179.9	-57.8	0	0	0	0	110.3	E21 V22 R26	E21-T24 WeakPolarHBondContact CA-OG1 3.43Å; E21-T24 WeakPolarHBondContact O-CB 3.33Å; E21-T24 PolarHBondContact O-N 2.72Å; E21-T24 PolarHBondContact O-OG1 2.86Å; V22-T24 VanDerWaalsContact C-N 3.33Å; T24-R26 PolarHBondContact O-N 3.36Å; T24-R26 PolarHBondContact O-NH1 3.04Å; T24-R26 VanDerWaalsContact O-NH1 3.13Å
25	P	96.4	Very high	97	Very high	124 Å²	124	96 Å²	96	81%	0.805	54%	0.538	S	S	*	.			trans	-65.4	130.2	176.5	27	-33	0	0	0	109.5	S23	S23-P25 WeakPolarHBondContact O-CD 3.46Å
26	R	96.3	Very high	97.1	Very high	180 Å²	180	95.8 Å²	95.8	68%	0.679	54%	0.541	S	S	*	.			trans	-113.8	135.2	178.9	-65.3	176.6	-175.9	76.7	0.5	109.1	E21 T24	E21-R26 PolarHBondContact O-NH2 3.09Å; T24-R26 PolarHBondContact O-N 3.36Å; T24-R26 PolarHBondContact O-NH1 3.04Å; T24-R26 VanDerWaalsContact O-NH1 3.13Å
27	T	96.7	Very high	97.1	Very high	93 Å²	93	94.7 Å²	94.7	57%	0.571	54%	0.538	S	S	*	.			trans	-86.7	155.7	169.7	50.3	0	0	0	0	110	V29 N32	T27-V29 PolarHBondContact O-N 3.23Å; T27-N32 WeakPolarHBondContact CB-OD1 3.42Å; T27-N32 PolarHBondContact OG1-ND2 3.24Å; T27-N32 PolarHBondContact OG1-OD1 2.89Å
28	A	97.6	Very high	97.2	Very high	59 Å²	59	93.4 Å²	93.4	49%	0.488	54%	0.542	S	S	.	.			trans	-62.7	136.4	177.5	0	0	0	0	0	110.3	S30 A31 N32	A28-S30 PolarHBondContact O-N 3.33Å; A28-A31 HydrophobicContact CB-CB 4.44Å; A28-A31 WeakPolarHBondContact O-CB 3.47Å; A28-A31 PolarHBondContact O-N 3.46Å; A28-N32 PolarHBondContact O-N 3.29Å
29	V	97.2	Very high	97.2	Very high	112 Å²	112	96.8 Å²	96.8	68%	0.679	55%	0.55	S	S	*	.	H	α-helix	trans	-56.2	-40.1	179.1	176.8	0	0	0	0	110.9	T27 A31 N32 C33	T27-V29 PolarHBondContact O-N 3.23Å; V29-A31 VanDerWaalsContact C-N 3.31Å; V29-A31 PolarHBondContact O-N 3.08Å; V29-N32 PolarHBondContact O-N 3.47Å; V29-C33 WeakPolarHBondContact O-CB 3.27Å; V29-C33 PolarHBondContact O-N 3.2Å; V29-C33 PolarHBondContact O-SG 3.03Å
30	S	97.3	Very high	97.2	Very high	91 Å²	91	93.7 Å²	93.7	64%	0.636	54%	0.542	S	S	*	.	H	α-helix	trans	-58.9	-39.4	177.5	51	0	0	0	0	113.3	A28 A34	A28-S30 PolarHBondContact O-N 3.33Å; S30-A34 PolarHBondContact O-N 3Å; S30-A34 VanDerWaalsContact O-N 3.09Å
31	A	97	Very high	97.1	Very high	45 Å²	45	93.8 Å²	93.8	37%	0.372	55%	0.545	S	S	.	.	H	α-helix	trans	-66.8	-49.4	177.2	0	0	0	0	0	110.8	A28 V29 C33 A34 D35	A28-A31 HydrophobicContact CB-CB 4.44Å; A28-A31 WeakPolarHBondContact O-CB 3.47Å; A28-A31 PolarHBondContact O-N 3.46Å; V29-A31 VanDerWaalsContact C-N 3.31Å; V29-A31 PolarHBondContact O-N 3.08Å; A31-C33 VanDerWaalsContact C-N 3.3Å; A31-C33 PolarHBondContact O-N 3.06Å; A31-A34 PolarHBondContact O-N 3.15Å; A31-A34 VanDerWaalsContact O-N 3.15Å; A31-D35 PolarHBondContact O-N 3.29Å
32	N	97.1	Very high	97.1	Very high	70 Å²	70	92.4 Å²	92.4	37%	0.374	55%	0.553	S	S	.	*	H	α-helix	trans	-62.4	-37.8	179.3	-64.1	-11	0	0	0	112.3	T27 A28 V29 T36	T27-N32 WeakPolarHBondContact CB-OD1 3.42Å; T27-N32 PolarHBondContact OG1-ND2 3.24Å; T27-N32 PolarHBondContact OG1-OD1 2.89Å; A28-N32 PolarHBondContact O-N 3.29Å; V29-N32 PolarHBondContact O-N 3.47Å; N32-T36 WeakPolarHBondContact O-CB 3.49Å; N32-T36 PolarHBondContact O-N 3.4Å; N32-T36 PolarHBondContact O-OG1 2.99Å
33	C	97.6	Very high	97.1	Very high	63 Å²	63	91.4 Å²	91.4	43%	0.426	54%	0.543	S	S	.	.	H	α-helix	trans	-64.1	-44.1	175.5	-71.4	0	0	0	0	111.5	V29 A31 T36 I37	V29-C33 WeakPolarHBondContact O-CB 3.27Å; V29-C33 PolarHBondContact O-N 3.2Å; V29-C33 PolarHBondContact O-SG 3.03Å; A31-C33 VanDerWaalsContact C-N 3.3Å; A31-C33 PolarHBondContact O-N 3.06Å; C33-T36 PolarHBondContact O-N 2.96Å; C33-I37 WeakPolarHBondContact O-CB 3.37Å; C33-I37 WeakPolarHBondContact O-CD1 3.42Å; C33-I37 VanDerWaalsContact O-CG1 3.22Å; C33-I37 WeakPolarHBondContact O-CG1 3.35Å; C33-I37 PolarHBondContact O-N 3.35Å
34	A	97.9	Very high	97	Very high	56 Å²	56	90.2 Å²	90.2	46%	0.463	53%	0.529	S	S	.	.	H	α-helix	trans	-60.8	-45.7	177.5	0	0	0	0	0	111.8	S30 A31 T36 I37 A38	S30-A34 PolarHBondContact O-N 3Å; S30-A34 VanDerWaalsContact O-N 3.09Å; A31-A34 PolarHBondContact O-N 3.15Å; A31-A34 VanDerWaalsContact O-N 3.15Å; A34-T36 VanDerWaalsContact C-N 3.35Å; A34-T36 PolarHBondContact O-N 3.03Å; A34-I37 PolarHBondContact O-N 2.95Å; A34-A38 WeakPolarHBondContact O-CB 3.46Å; A34-A38 PolarHBondContact O-N 3.47Å
35	D	97.6	Very high	96.8	Very high	112 Å²	112	90.6 Å²	90.6	60%	0.599	53%	0.533	S	S	*	.	H	α-helix	trans	-63.5	-41.6	178.4	-67.3	-18.5	0	0	0	111.8	A31 A38 Y39	A31-D35 PolarHBondContact O-N 3.29Å; D35-A38 PolarHBondContact O-N 3.36Å; D35-Y39 WeakPolarHBondContact O-CB 3.49Å; D35-Y39 PolarHBondContact O-N 2.71Å
36	T	97.8	Very high	96.6	Very high	84 Å²	84	89.5 Å²	89.5	52%	0.515	53%	0.528	S	S	.	.	H	α-helix	trans	-64.4	-43.7	178.3	-56.5	0	0	0	0	111.2	N32 C33 A34 Y39 V40	N32-T36 WeakPolarHBondContact O-CB 3.49Å; N32-T36 PolarHBondContact O-N 3.4Å; N32-T36 PolarHBondContact O-OG1 2.99Å; C33-T36 PolarHBondContact O-N 2.96Å; A34-T36 VanDerWaalsContact C-N 3.35Å; A34-T36 PolarHBondContact O-N 3.03Å; T36-Y39 PolarHBondContact O-N 2.82Å; T36-V40 HydrophobicContact CG2-CG2 4.48Å; T36-V40 WeakPolarHBondContact O-CG2 3.32Å; T36-V40 PolarHBondContact O-N 3.44Å
37	I	97.9	Very high	96.3	Very high	92 Å²	92	83.6 Å²	83.6	47%	0.472	51%	0.511	S	S	.	.	H	α-helix	trans	-61	-51	177.1	-70.3	164.5	0	0	0	109.8	C33 A34 Y39 V40 E41	C33-I37 WeakPolarHBondContact O-CB 3.37Å; C33-I37 WeakPolarHBondContact O-CD1 3.42Å; C33-I37 VanDerWaalsContact O-CG1 3.22Å; C33-I37 WeakPolarHBondContact O-CG1 3.35Å; C33-I37 PolarHBondContact O-N 3.35Å; A34-I37 PolarHBondContact O-N 2.95Å; I37-Y39 VanDerWaalsContact C-N 3.27Å; I37-Y39 PolarHBondContact O-N 3.34Å; I37-V40 PolarHBondContact O-N 2.98Å; I37-E41 HydrophobicContact CG2-CG 4.09Å; I37-E41 WeakPolarHBondContact O-CB 3.21Å; I37-E41 WeakPolarHBondContact O-CG 3.29Å; I37-E41 PolarHBondContact O-N 3.49Å
38	A	98.1	Very high	96	Very high	63 Å²	63	82.7 Å²	82.7	52%	0.521	51%	0.506	S	S	.	.	H	α-helix	trans	-58.6	-40.5	-179.7	0	0	0	0	0	112.2	A34 D35 G42	A34-A38 WeakPolarHBondContact O-CB 3.46Å; A34-A38 PolarHBondContact O-N 3.47Å; D35-A38 PolarHBondContact O-N 3.36Å; A38-G42 PolarHBondContact O-N 2.98Å
39	Y	97.6	Very high	95.6	Very high	165 Å²	165	87.9 Å²	87.9	65%	0.647	53%	0.525	S	S	*	.	H	α-helix	trans	-63.1	-49.2	176	178.5	-99.4	0	0	0	112.3	D35 T36 I37 G42 L43	D35-Y39 WeakPolarHBondContact O-CB 3.49Å; D35-Y39 PolarHBondContact O-N 2.71Å; T36-Y39 PolarHBondContact O-N 2.82Å; I37-Y39 VanDerWaalsContact C-N 3.27Å; I37-Y39 PolarHBondContact O-N 3.34Å; Y39-G42 PolarHBondContact O-N 3.18Å; Y39-L43 HydrophobicContact CD1-CD1 4.27Å; Y39-L43 HydrophobicContact CD2-CD1 4.36Å; Y39-L43 HydrophobicContact CE1-CD1 3.63Å; Y39-L43 HydrophobicContact CE2-CD1 3.74Å; Y39-L43 PolarHBondContact O-N 3.3Å; Y39-L43 WeakPolarHBondContact OH-CD1 3.22Å
40	V	97.1	Very high	95.2	Very high	75 Å²	75	87 Å²	87	46%	0.455	52%	0.516	S	S	.	.	H	α-helix	trans	-64.8	-47.9	-179.4	172	0	0	0	0	110.6	T36 I37 G42 L43 L44	T36-V40 HydrophobicContact CG2-CG2 4.48Å; T36-V40 WeakPolarHBondContact O-CG2 3.32Å; T36-V40 PolarHBondContact O-N 3.44Å; I37-V40 PolarHBondContact O-N 2.98Å; V40-G42 VanDerWaalsContact C-N 3.28Å; V40-G42 PolarHBondContact O-N 3.15Å; V40-L43 PolarHBondContact O-N 2.86Å; V40-L43 VanDerWaalsContact O-N 3.15Å; V40-L44 VanDerWaalsContact O-CB 3.29Å; V40-L44 WeakPolarHBondContact O-CB 3.36Å; V40-L44 PolarHBondContact O-N 3.43Å
41	E	96.7	Very high	94.8	Very high	130 Å²	130	89.4 Å²	89.4	61%	0.607	51%	0.514	S	S	*	.	H	α-helix	trans	-62.2	-34.5	179.7	-71.4	-178.1	159.8	0	0	112.6	I37 L43 P45	I37-E41 HydrophobicContact CG2-CG 4.09Å; I37-E41 WeakPolarHBondContact O-CB 3.21Å; I37-E41 WeakPolarHBondContact O-CG 3.29Å; I37-E41 PolarHBondContact O-N 3.49Å; E41-L43 VanDerWaalsContact C-N 3.33Å; E41-L43 PolarHBondContact O-N 2.85Å; E41-P45 WeakPolarHBondContact O-CD 3.39Å
42	G	96.8	Very high	94.1	Very high	55 Å²	55	89.5 Å²	89.5	57%	0.567	52%	0.52	S	S	*	.	H	α-helix	trans	-67.4	-31.1	175.9	0	0	0	0	0	113.8	A38 Y39 V40	A38-G42 PolarHBondContact O-N 2.98Å; Y39-G42 PolarHBondContact O-N 3.18Å; V40-G42 VanDerWaalsContact C-N 3.28Å; V40-G42 PolarHBondContact O-N 3.15Å
43	L	95.6	Very high	93.5	Very high	89 Å²	89	89 Å²	89	47%	0.466	52%	0.519	S	S	.	.	H	α-helix	trans	-94.4	-23.8	-179.4	-65.9	178.8	0	0	0	113.5	Y39 V40 E41 P45 S46 D47	Y39-L43 HydrophobicContact CD1-CD1 4.27Å; Y39-L43 HydrophobicContact CD2-CD1 4.36Å; Y39-L43 HydrophobicContact CE1-CD1 3.63Å; Y39-L43 HydrophobicContact CE2-CD1 3.74Å; Y39-L43 PolarHBondContact O-N 3.3Å; Y39-L43 WeakPolarHBondContact OH-CD1 3.22Å; V40-L43 PolarHBondContact O-N 2.86Å; V40-L43 VanDerWaalsContact O-N 3.15Å; E41-L43 VanDerWaalsContact C-N 3.33Å; E41-L43 PolarHBondContact O-N 2.85Å; L43-P45 VanDerWaalsContact C-CD 3.41Å; L43-P45 VanDerWaalsContact C-N 3.34Å; L43-S46 PolarHBondContact O-N 3.32Å; L43-D47 PolarHBondContact O-N 3.25Å
44	L	94.7	Very high	92.9	Very high	65 Å²	65	89.3 Å²	89.3	34%	0.34	52%	0.52	S	S	.	.	G	3₁₀ helix	trans	-52.3	-39.4	-177.6	-175.2	149.6	0	0	0	114.4	V40 S46 D47 I50	V40-L44 VanDerWaalsContact O-CB 3.29Å; V40-L44 WeakPolarHBondContact O-CB 3.36Å; V40-L44 PolarHBondContact O-N 3.43Å; L44-S46 PolarHBondContact O-N 3.19Å; L44-D47 PolarHBondContact O-N 2.93Å; L44-I50 HydrophobicContact CD1-CD1 4.12Å; L44-I50 HydrophobicContact CD2-CG2 4.32Å; L44-I50 HydrophobicContact CG-CD1 3.83Å; L44-I50 HydrophobicContact CG-CG2 4.26Å
45	P	92.8	Very high	91.9	Very high	80 Å²	80	91.8 Å²	91.8	52%	0.519	53%	0.526	S	S	.	.	G	3₁₀ helix	trans	-65.3	-22.1	177.3	-23.2	34.5	0	0	0	114.1	E41 L43 K51	E41-P45 WeakPolarHBondContact O-CD 3.39Å; L43-P45 VanDerWaalsContact C-CD 3.41Å; L43-P45 VanDerWaalsContact C-N 3.34Å; P45-K51 WeakPolarHBondContact O-CG 3.47Å
46	S	91.1	Very high	91.1	Very high	100 Å²	100	92.4 Å²	92.4	70%	0.699	53%	0.529	S	S	*	.	G	3₁₀ helix	trans	-103	-3.3	-177.7	-58	0	0	0	0	112.5	L43 L44 P48	L43-S46 PolarHBondContact O-N 3.32Å; L44-S46 PolarHBondContact O-N 3.19Å; S46-P48 WeakPolarHBondContact O-CD 3.2Å
47	D	91.6	Very high	90.4	Very high	57 Å²	57	95.3 Å²	95.3	31%	0.305	53%	0.534	S	S	.	.			trans	-73.8	114.4	-177.4	-170.3	-38.5	0	0	0	110.7	L43 L44 L49 I50 K51	L43-D47 PolarHBondContact O-N 3.25Å; L44-D47 PolarHBondContact O-N 2.93Å; D47-L49 VanDerWaalsContact C-N 3.25Å; D47-L49 PolarHBondContact O-N 3.43Å; D47-L49 WeakPolarHBondContact OD1-CA 3.38Å; D47-L49 WeakPolarHBondContact OD1-CB 3.48Å; D47-L49 PolarHBondContact OD1-N 3.18Å; D47-I50 HydrophobicContact CB-CB 4.06Å; D47-I50 HydrophobicContact CB-CD1 3.91Å; D47-I50 HydrophobicContact CB-CG1 3.97Å; D47-I50 PolarHBondContact O-N 2.8Å; D47-I50 PolarHBondContact OD1-N 3.28Å; D47-K51 PolarHBondContact O-N 2.95Å
48	P	88.9	Confident	89.6	Confident	74 Å²	74	93.6 Å²	93.6	48%	0.481	53%	0.526	S	S	.	.	H	α-helix	trans	-59.6	-31	179.3	-27.2	39.4	0	0	0	114.5	S46 I50 G52 V53	S46-P48 WeakPolarHBondContact O-CD 3.2Å; P48-I50 VanDerWaalsContact C-N 3.35Å; P48-G52 CarbonylContact O-C 3.38Å; P48-G52 WeakPolarHBondContact O-CA 3.11Å; P48-G52 PolarHBondContact O-N 2.91Å; P48-V53 HydrophobicContact CB-CG2 3.51Å
49	L	88.9	Confident	88.7	Confident	167 Å²	167	95.9 Å²	95.9	87%	0.874	54%	0.536	S	S	*	.	H	α-helix	trans	-81.2	-19.8	-178.1	-60.5	178.7	0	0	0	111.9	D47	D47-L49 VanDerWaalsContact C-N 3.25Å; D47-L49 PolarHBondContact O-N 3.43Å; D47-L49 WeakPolarHBondContact OD1-CA 3.38Å; D47-L49 WeakPolarHBondContact OD1-CB 3.48Å; D47-L49 PolarHBondContact OD1-N 3.18Å
50	I	89	Confident	87.8	Confident	95 Å²	95	96.5 Å²	96.5	49%	0.487	54%	0.538	S	S	.	.	H	α-helix	trans	-93.9	-47.6	176.2	-59.2	178.5	0	0	0	110.9	L44 D47 P48	L44-I50 HydrophobicContact CD1-CD1 4.12Å; L44-I50 HydrophobicContact CD2-CG2 4.32Å; L44-I50 HydrophobicContact CG-CD1 3.83Å; L44-I50 HydrophobicContact CG-CG2 4.26Å; D47-I50 HydrophobicContact CB-CB 4.06Å; D47-I50 HydrophobicContact CB-CD1 3.91Å; D47-I50 HydrophobicContact CB-CG1 3.97Å; D47-I50 PolarHBondContact O-N 2.8Å; D47-I50 PolarHBondContact OD1-N 3.28Å; P48-I50 VanDerWaalsContact C-N 3.35Å
51	K	88.5	Confident	86.3	Confident	141 Å²	141	99.5 Å²	99.5	61%	0.613	55%	0.545	S	S	*	.	H	α-helix	trans	-87.5	-16.5	-177.3	-69.2	-62.8	-174	-177.7	0	114.2	P45 D47	P45-K51 WeakPolarHBondContact O-CG 3.47Å; D47-K51 PolarHBondContact O-N 2.95Å
52	G	82.6	Confident	84.6	Confident	47 Å²	47	96.6 Å²	96.6	49%	0.485	55%	0.55	S	S	.	*			trans	82.1	154.6	-171.4	0	0	0	0	0	112	P48	P48-G52 CarbonylContact O-C 3.38Å; P48-G52 WeakPolarHBondContact O-CA 3.11Å; P48-G52 PolarHBondContact O-N 2.91Å
53	V	85.1	Confident	82.9	Confident	58 Å²	58	100.3 Å²	100.3	35%	0.352	56%	0.557	S	S	.	*			trans	-104.2	128.6	176.9	-176.2	0	0	0	0	108.8	P48 K57 N58	P48-V53 HydrophobicContact CB-CG2 3.51Å; V53-K57 HydrophobicContact CG1-CB 4.04Å; V53-N58 HydrophobicContact CB-CB 4.42Å; V53-N58 HydrophobicContact CG1-CB 3.95Å
54	P	84.8	Confident	81.2	Confident	70 Å²	70	106.3 Å²	106.3	46%	0.455	58%	0.579	S	S	.	*			trans	-54.9	140.2	170.2	-26.5	35.9	0	0	0	111.6	D56 K57 N58	P54-D56 WeakPolarHBondContact CB-OD1 3.09Å; P54-D56 PolarHBondContact O-N 3.3Å; P54-D56 VanDerWaalsContact O-N 3.17Å; P54-K57 HydrophobicContact CG-CD 4.46Å; P54-K57 CarbonylContact O-C 3.55Å; P54-K57 WeakPolarHBondContact O-CA 3.28Å; P54-K57 PolarHBondContact O-N 2.88Å; P54-N58 PolarHBondContact O-N 3.04Å
55	D	77.4	Confident	79.4	Confident	109 Å²	109	106.2 Å²	106.2	58%	0.583	59%	0.594	S	S	*	*	G	3₁₀ helix	trans	-53.4	-39.6	-176.4	-85.1	5.1	0	0	0	113.3	K57 N58 K61	D55-K57 PolarHBondContact O-N 3.17Å; D55-N58 PolarHBondContact O-N 3.41Å; D55-K61 HydrophobicContact CB-CD 3.89Å; D55-K61 WeakPolarHBondContact O-CD 3.48Å
56	D	81.1	Confident	77.5	Confident	124 Å²	124	105.2 Å²	105.2	66%	0.663	60%	0.598	S	S	*	*	G	3₁₀ helix	trans	-65.3	-21.2	177.3	59.7	-56.6	0	0	0	114	P54	P54-D56 WeakPolarHBondContact CB-OD1 3.09Å; P54-D56 PolarHBondContact O-N 3.3Å; P54-D56 VanDerWaalsContact O-N 3.17Å
57	K	81.6	Confident	75.5	Confident	145 Å²	145	106.8 Å²	106.8	63%	0.63	61%	0.608	S	S	*	*	G	3₁₀ helix	trans	-107.8	-5.4	-178.6	-60.6	-176.9	-176	177.4	0	113	V53 P54 D55 P59	V53-K57 HydrophobicContact CG1-CB 4.04Å; P54-K57 HydrophobicContact CG-CD 4.46Å; P54-K57 CarbonylContact O-C 3.55Å; P54-K57 WeakPolarHBondContact O-CA 3.28Å; P54-K57 PolarHBondContact O-N 2.88Å; D55-K57 PolarHBondContact O-N 3.17Å; K57-P59 VanDerWaalsContact O-CD 3.28Å; K57-P59 WeakPolarHBondContact O-CD 2.94Å
58	N	81.1	Confident	73.8	Confident	56 Å²	56	109.4 Å²	109.4	30%	0.299	63%	0.626	S	S	.	*			trans	-79.2	113.3	-179.9	-174.2	-8.9	0	0	0	109.9	V53 P54 D55 Y60 K61	V53-N58 HydrophobicContact CB-CB 4.42Å; V53-N58 HydrophobicContact CG1-CB 3.95Å; P54-N58 PolarHBondContact O-N 3.04Å; D55-N58 PolarHBondContact O-N 3.41Å; N58-Y60 PolarHBondContact O-N 2.99Å; N58-Y60 VanDerWaalsContact O-N 3.08Å; N58-Y60 PolarHBondContact OD1-N 3.08Å; N58-K61 HydrophobicContact CB-CB 4.47Å; N58-K61 WeakPolarHBondContact O-CB 3.43Å; N58-K61 PolarHBondContact O-N 3.11Å; N58-K61 VanDerWaalsContact O-N 3.11Å
59	P	80.1	Confident	71.8	Confident	111 Å²	111	112.8 Å²	112.8	72%	0.721	65%	0.645	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.8	-14.2	-179.3	27.4	-34.5	0	0	0	113.3	K57	K57-P59 VanDerWaalsContact O-CD 3.28Å; K57-P59 WeakPolarHBondContact O-CD 2.94Å
60	Y	78.2	Confident	69.6	Low	178 Å²	178	114 Å²	114	70%	0.698	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.9	10.6	178.7	-56	-74.1	0	0	0	113.6	N58 G62 D63	N58-Y60 PolarHBondContact O-N 2.99Å; N58-Y60 VanDerWaalsContact O-N 3.08Å; N58-Y60 PolarHBondContact OD1-N 3.08Å; Y60-G62 PolarHBondContact O-N 2.85Å; Y60-D63 PolarHBondContact O-N 2.94Å
61	K	65.6	Low	68.6	Low	139 Å²	139	114.9 Å²	114.9	60%	0.604	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.9	98	177.4	-177.6	171.7	175.2	-170.9	0	110.8	D55 N58	D55-K61 HydrophobicContact CB-CD 3.89Å; D55-K61 WeakPolarHBondContact O-CD 3.48Å; N58-K61 HydrophobicContact CB-CB 4.47Å; N58-K61 WeakPolarHBondContact O-CB 3.43Å; N58-K61 PolarHBondContact O-N 3.11Å; N58-K61 VanDerWaalsContact O-N 3.11Å
62	G	60.4	Low	67.5	Low	69 Å²	69	113.5 Å²	113.5	71%	0.711	67%	0.671	S	S	*	*	T	Hydrogen-bonded Turn	trans	139.2	-35	174.6	0	0	0	0	0	112.7	Y60 K64	Y60-G62 PolarHBondContact O-N 2.85Å; G62-K64 PolarHBondContact O-N 3.47Å; G62-K64 VanDerWaalsContact O-N 3.15Å
63	D	61.5	Low	66.7	Low	133 Å²	133	117.2 Å²	117.2	71%	0.711	68%	0.681	S	S	*	*			trans	-83.1	93.4	172	-73.1	-32.1	0	0	0	108.6	Y60 G65	Y60-D63 PolarHBondContact O-N 2.94Å; D63-G65 PolarHBondContact O-N 2.8Å
64	K	59.9	Low	65.6	Low	214 Å²	214	120.7 Å²	120.7	93%	0.93	70%	0.7	S	S	*	*			trans	-69	45.4	160.6	-61.6	-169.2	-178.7	-178.2	0	110.5	G62 G66	G62-K64 PolarHBondContact O-N 3.47Å; G62-K64 VanDerWaalsContact O-N 3.15Å; K64-G66 PolarHBondContact O-N 3.43Å; K64-G66 VanDerWaalsContact O-N 3.13Å
65	G	57.4	Low	64.4	Low	64 Å²	64	123.9 Å²	123.9	66%	0.66	72%	0.716	S	S	*	*			trans	-68.7	105.7	165.6	0	0	0	0	0	106.6	D63	D63-G65 PolarHBondContact O-N 2.8Å
66	G	52.7	Low	63.6	Low	58 Å²	58	124.9 Å²	124.9	60%	0.598	73%	0.725	S	S	*	*			trans	-51.4	147.3	174.3	0	0	0	0	0	110.4	K64 T68	K64-G66 PolarHBondContact O-N 3.43Å; K64-G66 VanDerWaalsContact O-N 3.13Å; G66-T68 PolarHBondContact O-N 3.15Å
67	C	49.9	Very low	62.3	Low	133 Å²	133	124.9 Å²	124.9	90%	0.899	73%	0.729	S	S	*	*			trans	-59.7	99.5	173.2	-171.7	0	0	0	0	108.9
68	T	54.7	Low	60.8	Low	112 Å²	112	123.4 Å²	123.4	69%	0.687	74%	0.737	S	S	*	*			trans	-102.9	112.4	173.2	36.6	0	0	0	0	109.3	G66 T70	G66-T68 PolarHBondContact O-N 3.15Å; T68-T70 PolarHBondContact O-N 3.13Å
69	V	48.2	Very low	59.1	Low	146 Å²	146	129 Å²	129	89%	0.885	77%	0.773	S	S	*	*			trans	-87.6	88.5	160.1	-173.8	0	0	0	0	105.9
70	T	40.9	Very low	57.2	Low	191 Å²	191	130.6 Å²	130.6	100%	1.172	78%	0.778	S	S	*	*			trans	-117.1	0	169.6	38.5	0	0	0	0	109.6	T68	T68-T70 PolarHBondContact O-N 3.13Å

Retrieved 70 of 70 residues in 60.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).