A0A087YDH2_POEFO Loading...

Ubiquinol-cytochrome c reductase, complex III subunit XI

AlphaFold DB (A0A3B3UF21), UniProt , Accession A0A087YDH2, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 56 aa.

						>A0A087YDH2_POEFO|A0A087YDH2
MIGKLIGQKYMAIAKSWVPTMTFWGTTGGVALVYFTDWRVILDYVPYINGKFKKDE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	66.9	Low	78.6	Confident	221 Å²	221	127.2 Å²	127.2	100%	1.089	65%	0.645	S	S	*	*				0	-40.1	0	-73	-173.8	-91.7	0	0	113.2	G3 K4	M1-G3 VanDerWaalsContact C-N 3.3Å; M1-G3 PolarHBondContact O-N 2.92Å; M1-K4 PolarHBondContact O-N 3.23Å
2	I	73	Confident	79.9	Confident	129 Å²	129	121.7 Å²	121.7	66%	0.662	63%	0.633	S	S	*	*	G	3₁₀ helix	trans	-58.8	-34.1	178.1	-66.1	169.1	0	0	0	113.7	K4 L5 I6	I2-K4 PolarHBondContact O-N 3.41Å; I2-L5 WeakPolarHBondContact O-CB 3.32Å; I2-L5 PolarHBondContact O-N 3.03Å; I2-I6 HydrophobicContact CG2-CD1 4.19Å
3	G	71.3	Confident	81	Confident	60 Å²	60	117.8 Å²	117.8	62%	0.619	61%	0.613	S	S	*	*	G	3₁₀ helix	trans	-57.7	-22.2	179	0	0	0	0	0	115.3	M1 L5 I6	M1-G3 VanDerWaalsContact C-N 3.3Å; M1-G3 PolarHBondContact O-N 2.92Å; G3-L5 VanDerWaalsContact C-N 3.26Å; G3-L5 PolarHBondContact O-N 3.09Å; G3-I6 PolarHBondContact O-N 3.35Å
4	K	69.3	Low	81.9	Confident	178 Å²	178	113.2 Å²	113.2	77%	0.774	60%	0.6	S	S	*	*	G	3₁₀ helix	trans	-70.9	-19.4	174	-71.5	-172.3	176.7	-177.2	0	113.3	M1 I2 Y10	M1-K4 PolarHBondContact O-N 3.23Å; I2-K4 PolarHBondContact O-N 3.41Å; K4-Y10 WeakPolarHBondContact O-CD2 3.43Å; K4-Y10 WeakPolarHBondContact O-CE2 3.49Å
5	L	68.4	Low	82.7	Confident	115 Å²	115	115.5 Å²	115.5	60%	0.602	60%	0.603	S	S	*	*	G	3₁₀ helix	trans	-89.1	-12.6	179.3	-64.6	166.9	0	0	0	112.7	I2 G3 G7 Y10	I2-L5 WeakPolarHBondContact O-CB 3.32Å; I2-L5 PolarHBondContact O-N 3.03Å; G3-L5 VanDerWaalsContact C-N 3.26Å; G3-L5 PolarHBondContact O-N 3.09Å; L5-G7 VanDerWaalsContact C-N 3.34Å; L5-G7 PolarHBondContact O-N 2.99Å; L5-Y10 WeakPolarHBondContact O-CB 3.4Å
6	I	75.4	Confident	83.6	Confident	124 Å²	124	113.3 Å²	113.3	64%	0.636	60%	0.6	S	S	*	*	S	Bend	trans	-100.3	53.2	-176.5	-43.5	177	0	0	0	109.4	I2 G3	I2-I6 HydrophobicContact CG2-CD1 4.19Å; G3-I6 PolarHBondContact O-N 3.35Å
7	G	84.1	Confident	84.4	Confident	26 Å²	26	115.2 Å²	115.2	27%	0.268	60%	0.597	S	S	.	*	S	Bend	trans	-112.6	151.9	177.4	0	0	0	0	0	111.7	L5 K9 Y10 M11	L5-G7 VanDerWaalsContact C-N 3.34Å; L5-G7 PolarHBondContact O-N 2.99Å; G7-K9 PolarHBondContact O-N 3.41Å; G7-K9 VanDerWaalsContact O-N 3.09Å; G7-Y10 PolarHBondContact O-N 3.05Å; G7-M11 PolarHBondContact O-N 3.28Å
8	Q	87.1	Confident	85.1	Confident	180 Å²	180	112.7 Å²	112.7	84%	0.841	59%	0.588	S	S	*	*	H	α-helix	trans	-52.8	-36	-178.8	-160.8	-177.8	-60.8	0	0	112.7	A12	Q8-A12 PolarHBondContact O-N 3.42Å
9	K	89.1	Confident	85.8	Confident	147 Å²	147	111.4 Å²	111.4	64%	0.639	59%	0.587	S	S	*	*	H	α-helix	trans	-60.3	-49.2	173.5	179.3	-178.6	175	-179.1	0	112.6	G7 M11 A12 I13	G7-K9 PolarHBondContact O-N 3.41Å; G7-K9 VanDerWaalsContact O-N 3.09Å; K9-M11 VanDerWaalsContact C-N 3.34Å; K9-A12 PolarHBondContact O-N 2.85Å; K9-I13 HydrophobicContact CG-CD1 4.12Å; K9-I13 WeakPolarHBondContact O-CG1 3.35Å; K9-I13 PolarHBondContact O-N 3.23Å
10	Y	89.3	Confident	86.4	Confident	114 Å²	114	108.8 Å²	108.8	45%	0.447	58%	0.576	S	S	.	*	H	α-helix	trans	-70.1	-33.3	-178.2	-65	-73.4	0	0	0	111.8	K4 L5 G7 I13 A14	K4-Y10 WeakPolarHBondContact O-CD2 3.43Å; K4-Y10 WeakPolarHBondContact O-CE2 3.49Å; L5-Y10 WeakPolarHBondContact O-CB 3.4Å; G7-Y10 PolarHBondContact O-N 3.05Å; Y10-I13 PolarHBondContact O-N 3.31Å; Y10-A14 WeakPolarHBondContact O-CB 3.39Å; Y10-A14 PolarHBondContact O-N 3.04Å
11	M	90.6	Very high	86.9	Confident	105 Å²	105	108.9 Å²	108.9	52%	0.517	57%	0.574	S	S	.	*	H	α-helix	trans	-64.9	-40.2	171.4	-68.3	-176.3	68.7	0	0	112.4	G7 K9 A14 K15	G7-M11 PolarHBondContact O-N 3.28Å; K9-M11 VanDerWaalsContact C-N 3.34Å; M11-A14 PolarHBondContact O-N 3.02Å; M11-K15 WeakPolarHBondContact O-CB 3.33Å; M11-K15 WeakPolarHBondContact O-CG 3.12Å; M11-K15 PolarHBondContact O-N 3.41Å
12	A	93.8	Very high	88.4	Confident	61 Å²	61	102.2 Å²	102.2	50%	0.504	55%	0.546	S	S	.	.	H	α-helix	trans	-64.2	-41.7	175.9	0	0	0	0	0	111.6	Q8 K9 K15 S16	Q8-A12 PolarHBondContact O-N 3.42Å; K9-A12 PolarHBondContact O-N 2.85Å; A12-K15 PolarHBondContact O-N 3.43Å; A12-S16 PolarHBondContact O-N 3.03Å
13	I	94.1	Very high	89.6	Confident	72 Å²	72	102.4 Å²	102.4	37%	0.369	54%	0.542	S	S	.	.	H	α-helix	trans	-62.9	-49.7	173.8	-65.4	166.2	0	0	0	110.2	K9 Y10 K15 S16 W17	K9-I13 HydrophobicContact CG-CD1 4.12Å; K9-I13 WeakPolarHBondContact O-CG1 3.35Å; K9-I13 PolarHBondContact O-N 3.23Å; Y10-I13 PolarHBondContact O-N 3.31Å; I13-K15 PolarHBondContact O-N 3.3Å; I13-S16 PolarHBondContact O-N 3.26Å; I13-S16 PolarHBondContact O-OG 3.22Å; I13-W17 VanDerWaalsContact O-CD1 3.24Å; I13-W17 PolarHBondContact O-N 3.49Å; I13-W17 VanDerWaalsContact O-N 3.15Å
14	A	93.9	Very high	90.9	Very high	53 Å²	53	107.6 Å²	107.6	44%	0.438	54%	0.543	S	S	.	.	H	α-helix	trans	-55.8	-42.7	178.9	0	0	0	0	0	111.7	Y10 M11 S16 W17 V18	Y10-A14 WeakPolarHBondContact O-CB 3.39Å; Y10-A14 PolarHBondContact O-N 3.04Å; M11-A14 PolarHBondContact O-N 3.02Å; A14-S16 PolarHBondContact O-N 2.84Å; A14-W17 PolarHBondContact O-N 3.04Å; A14-V18 WeakPolarHBondContact O-CG2 3.48Å; A14-V18 PolarHBondContact O-N 3.29Å
15	K	94.4	Very high	92.3	Very high	148 Å²	148	101.4 Å²	101.4	64%	0.643	53%	0.53	S	S	*	.	H	α-helix	trans	-61.1	-41.7	175.1	-75.1	176.8	-179.6	-175.8	0	112.9	M11 A12 I13 W17 V18	M11-K15 WeakPolarHBondContact O-CB 3.33Å; M11-K15 WeakPolarHBondContact O-CG 3.12Å; M11-K15 PolarHBondContact O-N 3.41Å; A12-K15 PolarHBondContact O-N 3.43Å; I13-K15 PolarHBondContact O-N 3.3Å; K15-W17 PolarHBondContact O-N 2.9Å; K15-V18 WeakPolarHBondContact O-CB 3.44Å; K15-V18 PolarHBondContact O-N 3.05Å
16	S	96.8	Very high	93.7	Very high	79 Å²	79	99.9 Å²	99.9	55%	0.552	53%	0.526	S	S	*	.	H	α-helix	trans	-66.5	-25.3	178.6	72.4	0	0	0	0	112.9	A12 I13 A14	A12-S16 PolarHBondContact O-N 3.03Å; I13-S16 PolarHBondContact O-N 3.26Å; I13-S16 PolarHBondContact O-OG 3.22Å; A14-S16 PolarHBondContact O-N 2.84Å
17	W	97.3	Very high	94.8	Very high	146 Å²	146	96.7 Å²	96.7	55%	0.553	51%	0.512	S	S	*	.	H	α-helix	trans	-88.4	-7.9	177.8	-78.3	90.4	0	0	0	114.2	I13 A14 K15 T20 M21	I13-W17 VanDerWaalsContact O-CD1 3.24Å; I13-W17 PolarHBondContact O-N 3.49Å; I13-W17 VanDerWaalsContact O-N 3.15Å; A14-W17 PolarHBondContact O-N 3.04Å; K15-W17 PolarHBondContact O-N 2.9Å; W17-T20 HydrophobicContact CE3-CG2 4.03Å; W17-T20 HydrophobicContact CZ3-CG2 4.03Å; W17-T20 PolarHBondContact O-N 3.23Å; W17-M21 HydrophobicContact CB-CE 4.3Å; W17-M21 PolarHBondContact O-N 3.29Å
18	V	97.2	Very high	95.5	Very high	70 Å²	70	97.4 Å²	97.4	42%	0.424	52%	0.52	S	S	.	.	H	α-helix	trans	-52.7	-50	179.6	170.9	0	0	0	0	112.1	A14 K15 T20 M21 T22	A14-V18 WeakPolarHBondContact O-CG2 3.48Å; A14-V18 PolarHBondContact O-N 3.29Å; K15-V18 WeakPolarHBondContact O-CB 3.44Å; K15-V18 PolarHBondContact O-N 3.05Å; V18-T20 VanDerWaalsContact C-N 3.3Å; V18-T20 PolarHBondContact O-N 2.99Å; V18-M21 HydrophobicContact CG2-CE 4.33Å; V18-M21 PolarHBondContact O-N 3.21Å; V18-T22 WeakPolarHBondContact O-CB 3.41Å; V18-T22 PolarHBondContact O-N 2.93Å; V18-T22 PolarHBondContact O-OG1 3.28Å; V18-T22 VanDerWaalsContact O-OG1 3.05Å
19	P	97.6	Very high	96	Very high	89 Å²	89	90.6 Å²	90.6	58%	0.578	50%	0.497	S	S	*	.	H	α-helix	trans	-59	-42	-178.4	-23.6	34.8	0	0	0	112.7	T22 F23	P19-T22 PolarHBondContact O-N 3.44Å; P19-F23 WeakPolarHBondContact O-CB 3.49Å; P19-F23 PolarHBondContact O-N 2.88Å
20	T	98	Very high	96.4	Very high	58 Å²	58	88 Å²	88	36%	0.356	49%	0.494	S	S	.	.	H	α-helix	trans	-64.8	-45.6	178.8	-54.4	0	0	0	0	111.7	W17 V18 F23 W24	W17-T20 HydrophobicContact CE3-CG2 4.03Å; W17-T20 HydrophobicContact CZ3-CG2 4.03Å; W17-T20 PolarHBondContact O-N 3.23Å; V18-T20 VanDerWaalsContact C-N 3.3Å; V18-T20 PolarHBondContact O-N 2.99Å; T20-F23 PolarHBondContact O-N 3.07Å; T20-W24 PolarHBondContact O-N 3.39Å
21	M	98	Very high	96.8	Very high	111 Å²	111	84.3 Å²	84.3	55%	0.547	49%	0.487	S	S	.	.	H	α-helix	trans	-64.6	-41.7	177.6	-70.7	-173.2	-66.3	0	0	111.7	W17 V18 G25	W17-M21 HydrophobicContact CB-CE 4.3Å; W17-M21 PolarHBondContact O-N 3.29Å; V18-M21 HydrophobicContact CG2-CE 4.33Å; V18-M21 PolarHBondContact O-N 3.21Å; M21-G25 WeakPolarHBondContact O-CA 3.48Å; M21-G25 PolarHBondContact O-N 3.15Å
22	T	98.1	Very high	97.1	Very high	82 Å²	82	83.4 Å²	83.4	50%	0.503	48%	0.484	S	S	.	.	H	α-helix	trans	-60.5	-48.8	175.6	-60.4	0	0	0	0	110.4	V18 P19 G25 T26	V18-T22 WeakPolarHBondContact O-CB 3.41Å; V18-T22 PolarHBondContact O-N 2.93Å; V18-T22 PolarHBondContact O-OG1 3.28Å; V18-T22 VanDerWaalsContact O-OG1 3.05Å; P19-T22 PolarHBondContact O-N 3.44Å; T22-G25 PolarHBondContact O-N 2.98Å; T22-T26 WeakPolarHBondContact O-CB 3.13Å; T22-T26 PolarHBondContact O-N 2.9Å; T22-T26 PolarHBondContact O-OG1 3.05Å
23	F	98.4	Very high	97.3	Very high	132 Å²	132	81.4 Å²	81.4	58%	0.579	47%	0.465	S	S	*	.	H	α-helix	trans	-60.5	-51.4	-179.3	-173.6	-98.9	0	0	0	112.2	P19 T20 G25 T26 T27	P19-F23 WeakPolarHBondContact O-CB 3.49Å; P19-F23 PolarHBondContact O-N 2.88Å; T20-F23 PolarHBondContact O-N 3.07Å; F23-G25 VanDerWaalsContact C-N 3.33Å; F23-G25 PolarHBondContact O-N 3.45Å; F23-T26 PolarHBondContact O-N 2.85Å; F23-T27 PolarHBondContact O-N 3.34Å; F23-T27 PolarHBondContact O-OG1 3Å; F23-T27 VanDerWaalsContact O-OG1 3.07Å
24	W	98	Very high	97.2	Very high	169 Å²	169	85.9 Å²	85.9	64%	0.64	48%	0.478	S	S	*	.	H	α-helix	trans	-67.7	-33.6	179.1	-74.2	114.2	0	0	0	113	T20 T27 G28	T20-W24 PolarHBondContact O-N 3.39Å; W24-T27 HydrophobicContact CE3-CG2 4.42Å; W24-T27 HydrophobicContact CZ3-CG2 4.45Å; W24-T27 PolarHBondContact O-N 2.89Å; W24-G28 PolarHBondContact O-N 3.49Å
25	G	98.2	Very high	97.4	Very high	48 Å²	48	91.3 Å²	91.3	50%	0.495	49%	0.492	S	S	.	.	H	α-helix	trans	-63.3	-43.8	172.8	0	0	0	0	0	112	M21 T22 F23 G29	M21-G25 WeakPolarHBondContact O-CA 3.48Å; M21-G25 PolarHBondContact O-N 3.15Å; T22-G25 PolarHBondContact O-N 2.98Å; F23-G25 VanDerWaalsContact C-N 3.33Å; F23-G25 PolarHBondContact O-N 3.45Å; G25-G29 PolarHBondContact O-N 3.45Å
26	T	98.1	Very high	97.4	Very high	83 Å²	83	88.3 Å²	88.3	51%	0.509	49%	0.487	S	S	.	.	H	α-helix	trans	-63.8	-47.1	173.9	-57.7	0	0	0	0	111.3	T22 F23 G28 G29 V30	T22-T26 WeakPolarHBondContact O-CB 3.13Å; T22-T26 PolarHBondContact O-N 2.9Å; T22-T26 PolarHBondContact O-OG1 3.05Å; F23-T26 PolarHBondContact O-N 2.85Å; T26-G28 PolarHBondContact O-N 3.19Å; T26-G29 PolarHBondContact O-N 2.87Å; T26-V30 HydrophobicContact CG2-CG2 4.38Å; T26-V30 WeakPolarHBondContact O-CG2 3.31Å; T26-V30 PolarHBondContact O-N 2.83Å
27	T	98.4	Very high	97.2	Very high	58 Å²	58	87.6 Å²	87.6	36%	0.356	48%	0.477	S	S	.	.	H	α-helix	trans	-58.8	-47.2	177.8	-61.5	0	0	0	0	111.8	F23 W24 G29 V30 A31	F23-T27 PolarHBondContact O-N 3.34Å; F23-T27 PolarHBondContact O-OG1 3Å; F23-T27 VanDerWaalsContact O-OG1 3.07Å; W24-T27 HydrophobicContact CE3-CG2 4.42Å; W24-T27 HydrophobicContact CZ3-CG2 4.45Å; W24-T27 PolarHBondContact O-N 2.89Å; T27-G29 VanDerWaalsContact C-N 3.34Å; T27-G29 PolarHBondContact O-N 3.44Å; T27-V30 PolarHBondContact O-N 3.01Å; T27-A31 WeakPolarHBondContact O-CB 3.47Å; T27-A31 PolarHBondContact O-N 3.09Å
28	G	98.3	Very high	97	Very high	41 Å²	41	86.4 Å²	86.4	42%	0.423	47%	0.472	S	S	.	.	H	α-helix	trans	-63	-39.9	175.7	0	0	0	0	0	112.6	W24 T26 A31 L32	W24-G28 PolarHBondContact O-N 3.49Å; T26-G28 PolarHBondContact O-N 3.19Å; G28-A31 PolarHBondContact O-N 3.03Å; G28-L32 WeakPolarHBondContact O-CB 3.18Å; G28-L32 PolarHBondContact O-N 3.2Å
29	G	97.9	Very high	96.7	Very high	36 Å²	36	88.8 Å²	88.8	37%	0.371	47%	0.473	S	S	.	.	H	α-helix	trans	-61.9	-46.4	175.2	0	0	0	0	0	112.6	G25 T26 T27 L32 V33	G25-G29 PolarHBondContact O-N 3.45Å; T26-G29 PolarHBondContact O-N 2.87Å; T27-G29 VanDerWaalsContact C-N 3.34Å; T27-G29 PolarHBondContact O-N 3.44Å; G29-L32 PolarHBondContact O-N 2.86Å; G29-V33 WeakPolarHBondContact O-CG2 3.34Å; G29-V33 PolarHBondContact O-N 3.37Å
30	V	97.3	Very high	96.5	Very high	94 Å²	94	89.2 Å²	89.2	57%	0.57	47%	0.474	S	S	*	.	H	α-helix	trans	-63.5	-42.2	175.8	173	0	0	0	0	111	T26 T27 L32 V33 Y34	T26-V30 HydrophobicContact CG2-CG2 4.38Å; T26-V30 WeakPolarHBondContact O-CG2 3.31Å; T26-V30 PolarHBondContact O-N 2.83Å; T27-V30 PolarHBondContact O-N 3.01Å; V30-L32 VanDerWaalsContact C-N 3.34Å; V30-L32 PolarHBondContact O-N 2.85Å; V30-V33 PolarHBondContact O-N 2.97Å; V30-Y34 WeakPolarHBondContact O-CB 3.11Å; V30-Y34 PolarHBondContact O-N 3.19Å
31	A	98.1	Very high	96.3	Very high	36 Å²	36	90 Å²	90	30%	0.298	48%	0.476	S	S	.	.	H	α-helix	trans	-60.8	-42.9	176.2	0	0	0	0	0	111.6	T27 G28 Y34 F35	T27-A31 WeakPolarHBondContact O-CB 3.47Å; T27-A31 PolarHBondContact O-N 3.09Å; G28-A31 PolarHBondContact O-N 3.03Å; A31-Y34 PolarHBondContact O-N 3Å; A31-F35 HydrophobicContact CB-CD2 4.42Å; A31-F35 HydrophobicContact CB-CE2 4.32Å; A31-F35 WeakPolarHBondContact O-CD2 3.37Å; A31-F35 PolarHBondContact O-N 3.3Å
32	L	98.2	Very high	96	Very high	86 Å²	86	85.4 Å²	85.4	45%	0.45	45%	0.453	S	S	.	.	H	α-helix	trans	-60	-50.1	175.4	-173.1	163.6	0	0	0	110.8	G28 G29 V30 Y34 F35 T36 W38	G28-L32 WeakPolarHBondContact O-CB 3.18Å; G28-L32 PolarHBondContact O-N 3.2Å; G29-L32 PolarHBondContact O-N 2.86Å; V30-L32 VanDerWaalsContact C-N 3.34Å; V30-L32 PolarHBondContact O-N 2.85Å; L32-Y34 PolarHBondContact O-N 3.28Å; L32-F35 PolarHBondContact O-N 3.2Å; L32-T36 HydrophobicContact CD2-CG2 4.12Å; L32-T36 HydrophobicContact CG-CG2 4.5Å; L32-T36 PolarHBondContact O-N 3.31Å; L32-T36 PolarHBondContact O-OG1 2.94Å; L32-W38 HydrophobicContact CD2-CE3 3.51Å; L32-W38 HydrophobicContact CD2-CZ3 3.63Å
33	V	96.4	Very high	95.7	Very high	18 Å²	18	84.2 Å²	84.2	11%	0.109	44%	0.444	C	S	.	.	H	α-helix	trans	-54.7	-42.3	177.3	168.2	0	0	0	0	111.7	G29 V30 D37 W38 I41 L42	G29-V33 WeakPolarHBondContact O-CG2 3.34Å; G29-V33 PolarHBondContact O-N 3.37Å; V30-V33 PolarHBondContact O-N 2.97Å; V33-D37 PolarHBondContact O-N 3.06Å; V33-W38 HydrophobicContact CB-CB 4.39Å; V33-W38 HydrophobicContact CG1-CB 4.19Å; V33-W38 HydrophobicContact CG2-CB 4.33Å; V33-W38 HydrophobicContact CG2-CE3 4Å; V33-W38 PolarHBondContact O-N 3.46Å; V33-I41 HydrophobicContact CG1-CB 4.14Å; V33-I41 HydrophobicContact CG1-CG2 3.91Å; V33-I41 HydrophobicContact CG2-CB 4.36Å; V33-I41 HydrophobicContact CG2-CD1 3.48Å; V33-I41 VanDerWaalsContact CG2-CD1 3.48Å; V33-I41 HydrophobicContact CG2-CG2 4.24Å; V33-L42 HydrophobicContact CG1-CD2 3.76Å; V33-L42 HydrophobicContact CG1-CG 3.88Å
34	Y	93.6	Very high	95.3	Very high	166 Å²	166	87 Å²	87	65%	0.651	45%	0.452	S	S	*	.	H	α-helix	trans	-66.2	-48.5	177.5	176.1	-101.5	0	0	0	112.2	V30 A31 L32 T36 D37	V30-Y34 WeakPolarHBondContact O-CB 3.11Å; V30-Y34 PolarHBondContact O-N 3.19Å; A31-Y34 PolarHBondContact O-N 3Å; L32-Y34 PolarHBondContact O-N 3.28Å; Y34-T36 PolarHBondContact O-N 3.41Å; Y34-D37 PolarHBondContact O-N 3.04Å
35	F	96.6	Very high	95	Very high	167 Å²	167	81.4 Å²	81.4	73%	0.732	44%	0.436	S	S	*	.	H	α-helix	trans	-70.8	-32.4	-176.1	-75.7	-56.9	0	0	0	113.9	A31 L32	A31-F35 HydrophobicContact CB-CD2 4.42Å; A31-F35 HydrophobicContact CB-CE2 4.32Å; A31-F35 WeakPolarHBondContact O-CD2 3.37Å; A31-F35 PolarHBondContact O-N 3.3Å; L32-F35 PolarHBondContact O-N 3.2Å
36	T	95.3	Very high	94.6	Very high	85 Å²	85	84.5 Å²	84.5	52%	0.521	45%	0.448	S	S	.	.	T	Hydrogen-bonded Turn	trans	-92	-0.4	179.5	63.5	0	0	0	0	113.2	L32 Y34 W38	L32-T36 HydrophobicContact CD2-CG2 4.12Å; L32-T36 HydrophobicContact CG-CG2 4.5Å; L32-T36 PolarHBondContact O-N 3.31Å; L32-T36 PolarHBondContact O-OG1 2.94Å; Y34-T36 PolarHBondContact O-N 3.41Å; T36-W38 VanDerWaalsContact C-N 3.28Å; T36-W38 PolarHBondContact O-N 3.4Å
37	D	92.1	Very high	94.1	Very high	65 Å²	65	91.1 Å²	91.1	35%	0.348	47%	0.465	S	S	.	.	T	Hydrogen-bonded Turn	trans	49	52.1	-172.4	-84.9	-39.6	0	0	0	111.5	V33 Y34 R39 K51 F52	V33-D37 PolarHBondContact O-N 3.06Å; Y34-D37 PolarHBondContact O-N 3.04Å; D37-R39 VanDerWaalsContact C-N 3.34Å; D37-R39 PolarHBondContact O-N 2.91Å; D37-K51 IonicContact OD1-NZ 2.68Å; D37-K51 PolarHBondContact OD1-NZ 2.94Å; D37-K51 IonicContact OD2-NZ 3.95Å; D37-K51 PolarHBondContact OD2-NZ 2.62Å; D37-F52 HydrophobicContact CB-CE1 4.42Å; D37-F52 HydrophobicContact CB-CZ 4.05Å
38	W	94.5	Very high	93.6	Very high	120 Å²	120	91.6 Å²	91.6	46%	0.455	46%	0.464	S	S	.	.			trans	-69.1	91.5	-170	-161.7	-14.8	0	0	0	111.7	L32 V33 T36 V40 I41 L42	L32-W38 HydrophobicContact CD2-CE3 3.51Å; L32-W38 HydrophobicContact CD2-CZ3 3.63Å; V33-W38 HydrophobicContact CB-CB 4.39Å; V33-W38 HydrophobicContact CG1-CB 4.19Å; V33-W38 HydrophobicContact CG2-CB 4.33Å; V33-W38 HydrophobicContact CG2-CE3 4Å; V33-W38 PolarHBondContact O-N 3.46Å; T36-W38 VanDerWaalsContact C-N 3.28Å; T36-W38 PolarHBondContact O-N 3.4Å; W38-V40 VanDerWaalsContact C-N 3.32Å; W38-V40 PolarHBondContact O-N 3.32Å; W38-I41 HydrophobicContact CD2-CD1 4.03Å; W38-I41 HydrophobicContact CE3-CD1 4.02Å; W38-I41 HydrophobicContact CG-CD1 4.4Å; W38-I41 HydrophobicContact CZ3-CD1 4.46Å; W38-I41 PolarHBondContact O-N 3.45Å; W38-L42 WeakPolarHBondContact O-CG 3.46Å; W38-L42 PolarHBondContact O-N 3.19Å
39	R	90.9	Very high	93	Very high	120 Å²	120	92.3 Å²	92.3	45%	0.453	46%	0.458	S	S	.	.	H	α-helix	trans	-51.3	-44.1	-174.2	-177.2	177	175.7	163.8	10.5	114.3	D37 I41 L42 D43 F52	D37-R39 VanDerWaalsContact C-N 3.34Å; D37-R39 PolarHBondContact O-N 2.91Å; R39-I41 PolarHBondContact O-N 3.36Å; R39-I41 VanDerWaalsContact O-N 3.09Å; R39-L42 PolarHBondContact O-N 2.92Å; R39-D43 WeakPolarHBondContact CG-OD1 3.36Å; R39-D43 WeakPolarHBondContact CG-OD2 3.35Å; R39-D43 IonicContact CZ-OD2 3.85Å; R39-D43 IonicContact NE-OD1 3.01Å; R39-D43 IonicContact NE-OD2 3.99Å; R39-D43 PolarHBondContact NE-OD2 3.38Å; R39-D43 IonicContact NH2-OD2 2.62Å; R39-D43 WeakPolarHBondContact O-CB 3.15Å; R39-D43 VanDerWaalsContact O-CG 3.27Å; R39-D43 PolarHBondContact O-N 3.44Å; R39-F52 HydrophobicContact CB-CD2 4.34Å; R39-F52 HydrophobicContact CB-CE2 4.31Å; R39-F52 HydrophobicContact CB-CZ 4.5Å; R39-F52 HydrophobicContact CG-CB 4.34Å; R39-F52 HydrophobicContact CG-CD2 3.91Å; R39-F52 HydrophobicContact CG-CE2 4.36Å; R39-F52 HydrophobicContact CG-CG 4.03Å; R39-F52 PolarHBondContact NH2-O 2.75Å
40	V	91.9	Very high	92.3	Very high	98 Å²	98	92.5 Å²	92.5	59%	0.594	46%	0.46	S	S	*	.	H	α-helix	trans	-54.9	-33.8	-179	179.8	0	0	0	0	112	W38 Y44	W38-V40 VanDerWaalsContact C-N 3.32Å; W38-V40 PolarHBondContact O-N 3.32Å; V40-Y44 WeakPolarHBondContact O-CD2 3.46Å; V40-Y44 WeakPolarHBondContact O-CE2 3.39Å
41	I	93.3	Very high	91.6	Very high	75 Å²	75	93.4 Å²	93.4	39%	0.385	46%	0.457	S	S	.	.	H	α-helix	trans	-91.2	-43.8	178.5	-66.1	167.9	0	0	0	110.2	V33 W38 R39 D43 Y44	V33-I41 HydrophobicContact CG1-CB 4.14Å; V33-I41 HydrophobicContact CG1-CG2 3.91Å; V33-I41 HydrophobicContact CG2-CB 4.36Å; V33-I41 HydrophobicContact CG2-CD1 3.48Å; V33-I41 VanDerWaalsContact CG2-CD1 3.48Å; V33-I41 HydrophobicContact CG2-CG2 4.24Å; W38-I41 HydrophobicContact CD2-CD1 4.03Å; W38-I41 HydrophobicContact CE3-CD1 4.02Å; W38-I41 HydrophobicContact CG-CD1 4.4Å; W38-I41 HydrophobicContact CZ3-CD1 4.46Å; W38-I41 PolarHBondContact O-N 3.45Å; R39-I41 PolarHBondContact O-N 3.36Å; R39-I41 VanDerWaalsContact O-N 3.09Å; I41-D43 VanDerWaalsContact C-N 3.32Å; I41-D43 PolarHBondContact O-N 3.46Å; I41-Y44 PolarHBondContact O-N 3.01Å
42	L	92.4	Very high	90.8	Very high	14 Å²	14	93.7 Å²	93.7	7%	0.073	45%	0.451	C	S	.	.	H	α-helix	trans	-67.6	-26.6	-175.7	-68.2	177.6	0	0	0	114	V33 W38 R39 Y44 V45 I48 F52	V33-L42 HydrophobicContact CG1-CD2 3.76Å; V33-L42 HydrophobicContact CG1-CG 3.88Å; W38-L42 WeakPolarHBondContact O-CG 3.46Å; W38-L42 PolarHBondContact O-N 3.19Å; R39-L42 PolarHBondContact O-N 2.92Å; L42-Y44 PolarHBondContact O-N 3.41Å; L42-V45 HydrophobicContact CD2-CG2 4.49Å; L42-V45 WeakPolarHBondContact O-CB 3.47Å; L42-V45 PolarHBondContact O-N 3.22Å; L42-I48 HydrophobicContact CD2-CG2 4.34Å; L42-F52 HydrophobicContact CB-CE2 3.87Å; L42-F52 HydrophobicContact CD1-CE2 3.99Å; L42-F52 HydrophobicContact CD1-CZ 4.1Å
43	D	91.1	Very high	90.1	Very high	58 Å²	58	96.7 Å²	96.7	31%	0.31	46%	0.461	S	S	.	.	T	Hydrogen-bonded Turn	trans	-64.5	-24.2	175.6	-76.5	-8.3	0	0	0	112	R39 I41 N49 F52	R39-D43 WeakPolarHBondContact CG-OD1 3.36Å; R39-D43 WeakPolarHBondContact CG-OD2 3.35Å; R39-D43 IonicContact CZ-OD2 3.85Å; R39-D43 IonicContact NE-OD1 3.01Å; R39-D43 IonicContact NE-OD2 3.99Å; R39-D43 PolarHBondContact NE-OD2 3.38Å; R39-D43 IonicContact NH2-OD2 2.62Å; R39-D43 WeakPolarHBondContact O-CB 3.15Å; R39-D43 VanDerWaalsContact O-CG 3.27Å; R39-D43 PolarHBondContact O-N 3.44Å; I41-D43 VanDerWaalsContact C-N 3.32Å; I41-D43 PolarHBondContact O-N 3.46Å; D43-N49 WeakPolarHBondContact O-CB 3.45Å; D43-F52 WeakPolarHBondContact OD1-CD2 3.07Å
44	Y	91.1	Very high	89.2	Confident	191 Å²	191	104.7 Å²	104.7	75%	0.749	49%	0.494	S	S	*	.	T	Hydrogen-bonded Turn	trans	-82.8	-10.7	174.4	-65.9	-76.2	0	0	0	113.6	V40 I41 L42 P46	V40-Y44 WeakPolarHBondContact O-CD2 3.46Å; V40-Y44 WeakPolarHBondContact O-CE2 3.39Å; I41-Y44 PolarHBondContact O-N 3.01Å; L42-Y44 PolarHBondContact O-N 3.41Å; Y44-P46 VanDerWaalsContact O-CD 3.31Å; Y44-P46 WeakPolarHBondContact O-CD 3.49Å
45	V	91.6	Very high	88.3	Confident	51 Å²	51	104.3 Å²	104.3	31%	0.309	50%	0.503	S	S	.	.	S	Bend	trans	-84.9	112.5	-178.4	-179.5	0	0	0	0	109.3	L42 Y47 I48 N49	L42-V45 HydrophobicContact CD2-CG2 4.49Å; L42-V45 WeakPolarHBondContact O-CB 3.47Å; L42-V45 PolarHBondContact O-N 3.22Å; V45-Y47 PolarHBondContact O-N 2.98Å; V45-I48 HydrophobicContact CB-CB 4.22Å; V45-I48 HydrophobicContact CG1-CB 4.06Å; V45-I48 HydrophobicContact CG1-CD1 3.97Å; V45-I48 HydrophobicContact CG1-CG1 3.91Å; V45-I48 PolarHBondContact O-N 2.95Å; V45-N49 WeakPolarHBondContact O-CB 3.4Å; V45-N49 PolarHBondContact O-N 3.5Å
46	P	88.8	Confident	86.6	Confident	113 Å²	113	109.2 Å²	109.2	73%	0.734	53%	0.528	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.3	-30.8	-168.5	-27.3	35.4	0	0	0	115.2	Y44 N49	Y44-P46 VanDerWaalsContact O-CD 3.31Å; Y44-P46 WeakPolarHBondContact O-CD 3.49Å; P46-N49 PolarHBondContact O-OD1 3.29Å
47	Y	88.8	Confident	86.2	Confident	222 Å²	222	110.4 Å²	110.4	87%	0.871	53%	0.529	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86	-25.3	-179.4	-172	-104.4	0	0	0	113.5	V45	V45-Y47 PolarHBondContact O-N 2.98Å
48	I	88.3	Confident	85.9	Confident	68 Å²	68	112.8 Å²	112.8	35%	0.349	54%	0.538	S	S	.	.	T	Hydrogen-bonded Turn	trans	-104.9	-21.1	-171.3	-56.5	177.6	0	0	0	112	L42 V45 G50 K51	L42-I48 HydrophobicContact CD2-CG2 4.34Å; V45-I48 HydrophobicContact CB-CB 4.22Å; V45-I48 HydrophobicContact CG1-CB 4.06Å; V45-I48 HydrophobicContact CG1-CD1 3.97Å; V45-I48 HydrophobicContact CG1-CG1 3.91Å; V45-I48 PolarHBondContact O-N 2.95Å; I48-G50 PolarHBondContact O-N 2.91Å; I48-K51 VanDerWaalsContact O-CB 3.25Å; I48-K51 WeakPolarHBondContact O-CB 3.25Å; I48-K51 PolarHBondContact O-N 2.93Å
49	N	84.4	Confident	85.4	Confident	55 Å²	55	112.4 Å²	112.4	29%	0.294	54%	0.543	S	S	.	.	G	3₁₀ helix	trans	-58.9	-14.4	-176.4	69.5	14	0	0	0	115.2	D43 V45 P46 K51	D43-N49 WeakPolarHBondContact O-CB 3.45Å; V45-N49 WeakPolarHBondContact O-CB 3.4Å; V45-N49 PolarHBondContact O-N 3.5Å; P46-N49 PolarHBondContact O-OD1 3.29Å; N49-K51 VanDerWaalsContact C-N 3.26Å; N49-K51 PolarHBondContact O-N 3.19Å
50	G	83.4	Confident	85.1	Confident	40 Å²	40	111.9 Å²	111.9	41%	0.412	55%	0.548	S	S	.	.	G	3₁₀ helix	trans	-68	-23.3	171.8	0	0	0	0	0	113.6	I48 F52 K53	I48-G50 PolarHBondContact O-N 2.91Å; G50-F52 PolarHBondContact O-N 2.91Å; G50-K53 PolarHBondContact O-N 3.46Å
51	K	82.5	Confident	84.7	Confident	113 Å²	113	112.8 Å²	112.8	49%	0.491	55%	0.545	S	S	.	.	G	3₁₀ helix	trans	-58.3	-31.8	-175.4	179.8	173.4	175.9	169.3	0	114	D37 I48 N49	D37-K51 IonicContact OD1-NZ 2.68Å; D37-K51 PolarHBondContact OD1-NZ 2.94Å; D37-K51 IonicContact OD2-NZ 3.95Å; D37-K51 PolarHBondContact OD2-NZ 2.62Å; I48-K51 VanDerWaalsContact O-CB 3.25Å; I48-K51 WeakPolarHBondContact O-CB 3.25Å; I48-K51 PolarHBondContact O-N 2.93Å; N49-K51 VanDerWaalsContact C-N 3.26Å; N49-K51 PolarHBondContact O-N 3.19Å
52	F	82.8	Confident	84.1	Confident	42 Å²	42	115.3 Å²	115.3	18%	0.184	56%	0.556	C	S	.	*	G	3₁₀ helix	trans	-111.4	11	-173.4	-52.5	-71.1	0	0	0	113.7	D37 R39 L42 D43 G50 K54	D37-F52 HydrophobicContact CB-CE1 4.42Å; D37-F52 HydrophobicContact CB-CZ 4.05Å; R39-F52 HydrophobicContact CB-CD2 4.34Å; R39-F52 HydrophobicContact CB-CE2 4.31Å; R39-F52 HydrophobicContact CB-CZ 4.5Å; R39-F52 HydrophobicContact CG-CB 4.34Å; R39-F52 HydrophobicContact CG-CD2 3.91Å; R39-F52 HydrophobicContact CG-CE2 4.36Å; R39-F52 HydrophobicContact CG-CG 4.03Å; R39-F52 PolarHBondContact NH2-O 2.75Å; L42-F52 HydrophobicContact CB-CE2 3.87Å; L42-F52 HydrophobicContact CD1-CE2 3.99Å; L42-F52 HydrophobicContact CD1-CZ 4.1Å; D43-F52 WeakPolarHBondContact OD1-CD2 3.07Å; G50-F52 PolarHBondContact O-N 2.91Å; F52-K54 PolarHBondContact O-N 3.29Å
53	K	82.9	Confident	83.5	Confident	150 Å²	150	122.6 Å²	122.6	65%	0.652	59%	0.591	S	S	*	*	P	Polyproline II helix	trans	-65.1	132.6	171.4	-69.9	-176.6	179	179.2	0	108.2	G50	G50-K53 PolarHBondContact O-N 3.46Å
54	K	77.6	Confident	82.9	Confident	185 Å²	185	127.5 Å²	127.5	80%	0.804	61%	0.612	S	S	*	*	P	Polyproline II helix	trans	-83.5	127.2	167.1	-68.7	-179.7	178.3	175.1	0	106	F52 E56	F52-K54 PolarHBondContact O-N 3.29Å; K54-E56 PolarHBondContact O-N 2.68Å
55	D	74.6	Confident	82.2	Confident	159 Å²	159	122.3 Å²	122.3	85%	0.85	60%	0.601	S	S	*	*	P	Polyproline II helix	trans	-64.4	129.4	166.7	-60.1	-41.1	0	0	0	107.2
56	E	61.4	Low	81.4	Confident	269 Å²	269	128.7 Å²	128.7	100%	1.257	63%	0.627	S	S	*	*			trans	-65.8	0	168.6	-73.3	-175.7	164.9	0	0	110.9	K54	K54-E56 PolarHBondContact O-N 2.68Å

Retrieved 56 of 56 residues in 47.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).