A0A087YDI1_POEFO Loading...

U6 snRNA-associated Sm-like protein LSm1

Plays a role in the degradation of histone mRNAs, the only eukaryotic mRNAs that are not polyadenylated. Probably also part of an LSm subunits-containing complex involved in the general process of mRNA degradation. Probably involved with other LSm subunits in the general process of degradation of mRNAs.

AlphaFold DB (A0A3B3TZT1), UniProt , Accession A0A087YDI1, Species POEFO (Poecilia formosa, Amazon molly), Gene LSM1, Length 133 aa.

						>A0A087YDI1_POEFO|A0A087YDI1|LSM1
MNYVPGTASLIDDIDKKHLVLLRDGRTLIGYLRSIDQFANLVFHQTVERIHVGKKFGDIPRGIFIVRGENVVLLGEMDVDKPCDTILQQVSIEEILEEQRLQQQAKQETEKVKMQVLKDRGLSIPKADNLDEY
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	50.8	Low	74.6	Confident	237 Å²	237	97.5 Å²	97.5	100%	1.167	54%	0.543	S	S	*	.				0	132.1	0	-82.5	-176.3	177.4	0	0	108	Y3	M1-Y3 PolarHBondContact O-N 3.45Å
2	N	64.3	Low	75.8	Confident	160 Å²	160	98.4 Å²	98.4	86%	0.856	55%	0.546	S	S	*	.			trans	-73	122	173.8	-74.2	-19.7	0	0	0	108.1	V4	N2-V4 PolarHBondContact O-N 3.09Å; N2-V4 VanDerWaalsContact O-N 3.13Å
3	Y	71.6	Confident	76.8	Confident	201 Å²	201	92.9 Å²	92.9	79%	0.788	52%	0.515	S	S	*	.			trans	-61.2	113.5	173	174.8	-102.2	0	0	0	109	M1 P5	M1-Y3 PolarHBondContact O-N 3.45Å; Y3-P5 HydrophobicContact CD1-CB 4.41Å; Y3-P5 HydrophobicContact CE1-CB 3.77Å
4	V	69.4	Low	77.9	Confident	62 Å²	62	90.9 Å²	90.9	38%	0.376	50%	0.502	S	S	.	.			trans	-93.1	113.5	170.2	-87.2	0	0	0	0	107.7	N2 A8	N2-V4 PolarHBondContact O-N 3.09Å; N2-V4 VanDerWaalsContact O-N 3.13Å; V4-A8 HydrophobicContact CB-CB 4.08Å
5	P	76.4	Confident	79	Confident	89 Å²	89	91.2 Å²	91.2	58%	0.578	50%	0.502	S	S	*	.			trans	-73	147.6	-174.7	27.7	-33.5	0	0	0	112.4	Y3	Y3-P5 HydrophobicContact CD1-CB 4.41Å; Y3-P5 HydrophobicContact CE1-CB 3.77Å
6	G	77.6	Confident	79.9	Confident	52 Å²	52	89.5 Å²	89.5	54%	0.536	49%	0.488	S	S	.	.	G	3₁₀ helix	trans	66.2	-142.1	169.2	0	0	0	0	0	113	A8 S9	G6-A8 PolarHBondContact O-N 3.44Å; G6-A8 VanDerWaalsContact O-N 3.08Å; G6-S9 PolarHBondContact O-N 3.3Å; G6-S9 PolarHBondContact O-OG 3.14Å
7	T	78.3	Confident	80.7	Confident	43 Å²	43	87.9 Å²	87.9	26%	0.264	48%	0.476	S	S	.	.	G	3₁₀ helix	trans	-61.9	-21.1	-173.3	-32.2	0	0	0	0	113.9	S9 L10 I35 D36 Q37 A39	T7-S9 PolarHBondContact O-N 3.4Å; T7-L10 HydrophobicContact CG2-CD1 4Å; T7-L10 WeakPolarHBondContact O-CB 3.34Å; T7-L10 PolarHBondContact O-N 3.4Å; T7-L10 VanDerWaalsContact O-N 3.09Å; T7-I35 HydrophobicContact CG2-CG2 3.76Å; T7-D36 WeakPolarHBondContact CG2-O 3.46Å; T7-Q37 PolarHBondContact OG1-O 3.41Å; T7-Q37 VanDerWaalsContact OG1-O 3.09Å; T7-A39 HydrophobicContact CG2-CB 4.21Å
8	A	78.1	Confident	81.5	Confident	44 Å²	44	83.1 Å²	83.1	36%	0.364	45%	0.449	S	S	.	.	G	3₁₀ helix	trans	-64.5	-25.6	176.3	0	0	0	0	0	112.8	V4 G6 L10 I11	V4-A8 HydrophobicContact CB-CB 4.08Å; G6-A8 PolarHBondContact O-N 3.44Å; G6-A8 VanDerWaalsContact O-N 3.08Å; A8-L10 PolarHBondContact O-N 3.01Å; A8-I11 PolarHBondContact O-N 3.4Å
9	S	83.1	Confident	82.2	Confident	49 Å²	49	81.3 Å²	81.3	34%	0.343	44%	0.439	S	S	.	.	G	3₁₀ helix	trans	-67.1	-27.5	173.9	72	0	0	0	0	112.6	G6 T7 I11 D12	G6-S9 PolarHBondContact O-N 3.3Å; G6-S9 PolarHBondContact O-OG 3.14Å; T7-S9 PolarHBondContact O-N 3.4Å; S9-I11 PolarHBondContact O-N 3.24Å; S9-D12 PolarHBondContact O-N 3.45Å
10	L	84.4	Confident	82.8	Confident	27 Å²	27	77.2 Å²	77.2	14%	0.141	42%	0.417	C	S	.	.	G	3₁₀ helix	trans	-77.5	-8	-176.5	-56	175.4	0	0	0	113	T7 A8 D12 D13 I35 L74	T7-L10 HydrophobicContact CG2-CD1 4Å; T7-L10 WeakPolarHBondContact O-CB 3.34Å; T7-L10 PolarHBondContact O-N 3.4Å; T7-L10 VanDerWaalsContact O-N 3.09Å; A8-L10 PolarHBondContact O-N 3.01Å; L10-D12 PolarHBondContact O-N 3.35Å; L10-D13 WeakPolarHBondContact O-CB 3.45Å; L10-D13 PolarHBondContact O-N 3.44Å; L10-D13 VanDerWaalsContact O-N 3.08Å; L10-I35 HydrophobicContact CB-CD1 3.33Å; L10-I35 HydrophobicContact CD1-CD1 4.31Å; L10-I35 HydrophobicContact CD1-CG2 4.3Å; L10-I35 HydrophobicContact CG-CD1 4.43Å; L10-I35 WeakPolarHBondContact O-CD1 3.4Å; L10-L74 HydrophobicContact CD2-CD2 3.71Å
11	I	86.9	Confident	83.4	Confident	109 Å²	109	76 Å²	76	56%	0.559	41%	0.41	S	S	*	.	G	3₁₀ helix	trans	-63.4	-36.5	174.3	-63.3	171.5	0	0	0	109.9	A8 S9 D13 I14	A8-I11 PolarHBondContact O-N 3.4Å; S9-I11 PolarHBondContact O-N 3.24Å; I11-D13 PolarHBondContact O-N 3.04Å; I11-I14 HydrophobicContact CG2-CD1 4.41Å; I11-I14 WeakPolarHBondContact O-CG1 3.41Å; I11-I14 PolarHBondContact O-N 2.95Å
12	D	88.2	Confident	85.5	Confident	108 Å²	108	65.2 Å²	65.2	58%	0.578	36%	0.357	S	S	*	.	G	3₁₀ helix	trans	-71.3	-10.1	176.9	-65.5	-25.7	0	0	0	112.5	S9 L10 K16	S9-D12 PolarHBondContact O-N 3.45Å; L10-D12 PolarHBondContact O-N 3.35Å; D12-K16 WeakPolarHBondContact O-CE 3.4Å; D12-K16 PolarHBondContact O-NZ 2.92Å
13	D	89.6	Confident	86.8	Confident	27 Å²	27	65.4 Å²	65.4	14%	0.144	35%	0.346	C	S	.	.	G	3₁₀ helix	trans	-99	-0.2	-176.8	-75	-26.6	0	0	0	113.5	L10 I11 K16 H18 L32	L10-D13 WeakPolarHBondContact O-CB 3.45Å; L10-D13 PolarHBondContact O-N 3.44Å; L10-D13 VanDerWaalsContact O-N 3.08Å; I11-D13 PolarHBondContact O-N 3.04Å; D13-K16 PolarHBondContact O-N 3.35Å; D13-K16 IonicContact OD1-NZ 2.9Å; D13-K16 PolarHBondContact OD1-NZ 3.03Å; D13-H18 WeakPolarHBondContact CB-CE1 3.26Å; D13-H18 WeakPolarHBondContact CB-NE2 3.47Å; D13-H18 PolarHBondContact O-CE1 2.93Å; D13-H18 VanDerWaalsContact O-CE1 3.23Å; D13-H18 IonicContact OD1-CE1 3.74Å; D13-H18 IonicContact OD1-NE2 3.6Å; D13-H18 IonicContact OD2-NE2 3.57Å; D13-L32 HydrophobicContact CB-CD2 4.2Å
14	I	92.4	Very high	87.6	Confident	65 Å²	65	60.8 Å²	60.8	33%	0.333	34%	0.335	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60.9	141.8	172.6	-63.7	173.5	0	0	0	109.9	I11 K16	I11-I14 HydrophobicContact CG2-CD1 4.41Å; I11-I14 WeakPolarHBondContact O-CG1 3.41Å; I11-I14 PolarHBondContact O-N 2.95Å; I14-K16 PolarHBondContact O-N 3.33Å; I14-K16 VanDerWaalsContact O-N 3.08Å
15	D	93.5	Very high	88.5	Confident	95 Å²	95	60.3 Å²	60.3	51%	0.508	34%	0.342	S	S	.	.	T	Hydrogen-bonded Turn	trans	64.6	1.9	-178.6	-61.3	-30.5	0	0	0	115.9	L32 R33	D15-L32 WeakPolarHBondContact CA-O 3.38Å; D15-L32 PolarHBondContact N-O 2.91Å; D15-R33 WeakPolarHBondContact OD1-CD 3.39Å; D15-R33 IonicContact OD1-CZ 3.5Å; D15-R33 IonicContact OD1-NH1 2.78Å; D15-R33 PolarHBondContact OD1-NH1 3.34Å
16	K	93.6	Very high	89.3	Confident	64 Å²	64	59.3 Å²	59.3	28%	0.278	33%	0.327	S	S	.	.	S	Bend	trans	-92	155.4	172.2	-50.4	-173.3	-164.8	151.2	0	112	D12 D13 I14 H18 L32 E76	D12-K16 WeakPolarHBondContact O-CE 3.4Å; D12-K16 PolarHBondContact O-NZ 2.92Å; D13-K16 PolarHBondContact O-N 3.35Å; D13-K16 IonicContact OD1-NZ 2.9Å; D13-K16 PolarHBondContact OD1-NZ 3.03Å; I14-K16 PolarHBondContact O-N 3.33Å; I14-K16 VanDerWaalsContact O-N 3.08Å; K16-H18 PolarHBondContact O-ND1 3.36Å; K16-H18 VanDerWaalsContact O-ND1 3.07Å; K16-L32 PolarHBondContact O-N 3.33Å; K16-L32 VanDerWaalsContact O-N 3.1Å; K16-E76 HydrophobicContact CB-CG 4.33Å; K16-E76 HydrophobicContact CD-CG 3.92Å; K16-E76 WeakPolarHBondContact CD-OE1 3.43Å; K16-E76 VanDerWaalsContact CD-OE2 3.3Å; K16-E76 WeakPolarHBondContact CD-OE2 3.45Å; K16-E76 IonicContact NZ-OE2 2.78Å; K16-E76 PolarHBondContact NZ-OE2 3.39Å
17	K	93.9	Very high	90.1	Very high	63 Å²	63	57.7 Å²	57.7	27%	0.274	31%	0.307	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.5	132.2	175.8	-165.5	174	-174.4	175.1	0	109.6	I29 G30 Y31 M77 V79	K17-I29 HydrophobicContact CD-CG2 4.46Å; K17-I29 VanDerWaalsContact CE-CG2 3.47Å; K17-I29 HydrophobicContact CG-CG2 4.3Å; K17-G30 CarbonylContact C-O 3.59Å; K17-G30 WeakPolarHBondContact CA-O 3.45Å; K17-Y31 HydrophobicContact CB-CD1 4.23Å; K17-Y31 HydrophobicContact CB-CE1 3.96Å; K17-M77 HydrophobicContact CB-CB 4.44Å; K17-M77 HydrophobicContact CG-CB 4.32Å; K17-M77 PolarHBondContact O-N 3.35Å; K17-V79 HydrophobicContact CB-CG2 4.26Å; K17-V79 HydrophobicContact CD-CG2 4.02Å
18	H	94.3	Very high	90.9	Very high	0 Å²	0	55.7 Å²	55.7	0%	0	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	149	-177.4	-77.4	81.1	0	0	0	111.3	D13 K16 I29 G30 F43 L74 G75 E76	D13-H18 WeakPolarHBondContact CB-CE1 3.26Å; D13-H18 WeakPolarHBondContact CB-NE2 3.47Å; D13-H18 PolarHBondContact O-CE1 2.93Å; D13-H18 VanDerWaalsContact O-CE1 3.23Å; D13-H18 IonicContact OD1-CE1 3.74Å; D13-H18 IonicContact OD1-NE2 3.6Å; D13-H18 IonicContact OD2-NE2 3.57Å; K16-H18 PolarHBondContact O-ND1 3.36Å; K16-H18 VanDerWaalsContact O-ND1 3.07Å; H18-I29 VanDerWaalsContact O-CA 3.31Å; H18-I29 WeakPolarHBondContact O-CA 3.36Å; H18-G30 PolarHBondContact N-O 3.2Å; H18-G30 PolarHBondContact O-N 3.47Å; H18-F43 HydrophobicContact CB-CE1 3.94Å; H18-F43 HydrophobicContact CB-CZ 4.38Å; H18-L74 HydrophobicContact CB-CG 4.44Å; H18-L74 WeakPolarHBondContact CD2-CD2 3.32Å; H18-G75 WeakPolarHBondContact CA-O 3.42Å; H18-G75 VanDerWaalsContact CD2-C 3.43Å; H18-G75 PolarHBondContact CD2-O 3.03Å; H18-E76 VanDerWaalsContact CD2-CA 3.44Å; H18-E76 WeakPolarHBondContact CD2-CA 3.43Å; H18-E76 PolarHBondContact CD2-N 3.45Å; H18-E76 VanDerWaalsContact CD2-N 3.33Å
19	L	94.4	Very high	91.8	Very high	49 Å²	49	54 Å²	54	26%	0.257	28%	0.279	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.3	133.3	164.8	-177.5	149.5	0	0	0	109	T27 L28 I29 L73 L74 G75 M77	L19-T27 HydrophobicContact CD1-CG2 3.69Å; L19-T27 HydrophobicContact CD2-CG2 3.89Å; L19-T27 HydrophobicContact CG-CG2 3.62Å; L19-L28 CarbonylContact C-O 3.57Å; L19-L28 WeakPolarHBondContact CA-O 3.5Å; L19-I29 HydrophobicContact CB-CG1 4.38Å; L19-I29 HydrophobicContact CD1-CD1 4.3Å; L19-I29 HydrophobicContact CD1-CG1 4.2Å; L19-I29 HydrophobicContact CG-CG1 4.24Å; L19-L73 HydrophobicContact CD2-CD1 4.3Å; L19-L74 WeakPolarHBondContact O-CA 3.25Å; L19-G75 PolarHBondContact N-O 3.49Å; L19-G75 PolarHBondContact O-N 3.01Å; L19-M77 HydrophobicContact CB-CG 3.94Å; L19-M77 HydrophobicContact CB-SD 3.88Å; L19-M77 HydrophobicContact CD1-SD 4.38Å
20	V	95.1	Very high	92.4	Very high	0 Å²	0	51.7 Å²	51.7	0%	0	26%	0.264	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.1	128.2	177.5	-178.1	0	0	0	0	109.7	L22 T27 L28 L41 F43 V71 L73 L74	V20-L22 HydrophobicContact CG1-CD2 3.94Å; V20-T27 CarbonylContact O-C 3.6Å; V20-T27 WeakPolarHBondContact O-CA 3.44Å; V20-L28 HydrophobicContact CB-CB 4.48Å; V20-L28 PolarHBondContact N-O 2.98Å; V20-L28 PolarHBondContact O-N 2.98Å; V20-L41 HydrophobicContact CG2-CD1 4.29Å; V20-F43 HydrophobicContact CB-CE2 4.5Å; V20-F43 HydrophobicContact CG2-CE1 4.25Å; V20-F43 HydrophobicContact CG2-CE2 3.56Å; V20-F43 HydrophobicContact CG2-CZ 3.28Å; V20-V71 HydrophobicContact CG1-CG1 4.08Å; V20-V71 HydrophobicContact CG1-CG2 4.35Å; V20-L73 WeakPolarHBondContact CA-O 3.25Å; V20-L74 HydrophobicContact CG2-CB 4.3Å; V20-L74 HydrophobicContact CG2-CD1 3.81Å; V20-L74 HydrophobicContact CG2-CG 4.12Å
21	L	95.4	Very high	92.9	Very high	51 Å²	51	53.6 Å²	53.6	27%	0.267	27%	0.269	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.6	128.1	169	-171.6	65.4	0	0	0	109.2	V72 L73	L21-V72 HydrophobicContact CB-CB 4.44Å; L21-V72 HydrophobicContact CD2-CB 4.47Å; L21-V72 HydrophobicContact CD2-CG1 4.27Å; L21-V72 HydrophobicContact CG-CB 4.46Å; L21-V72 WeakPolarHBondContact O-CB 3.29Å; L21-V72 PolarHBondContact O-N 3.36Å; L21-L73 HydrophobicContact CB-CD1 4.26Å; L21-L73 HydrophobicContact CB-CD2 4.09Å; L21-L73 HydrophobicContact CB-CG 3.72Å; L21-L73 HydrophobicContact CD2-CD2 3.8Å; L21-L73 HydrophobicContact CD2-CG 4.35Å; L21-L73 PolarHBondContact N-O 2.76Å
22	L	94.5	Very high	93.3	Very high	12 Å²	12	48.4 Å²	48.4	6%	0.063	24%	0.243	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-94.7	160.8	176.4	-59.1	-175.2	0	0	0	111.7	V20 D24 G25 R26 L28 V66 N70	V20-L22 HydrophobicContact CG1-CD2 3.94Å; L22-D24 VanDerWaalsContact CB-OD1 3.23Å; L22-D24 WeakPolarHBondContact CB-OD1 3.32Å; L22-D24 PolarHBondContact O-N 3.42Å; L22-G25 WeakPolarHBondContact O-CA 3.2Å; L22-G25 PolarHBondContact O-N 2.77Å; L22-R26 HydrophobicContact CB-CB 4.46Å; L22-R26 HydrophobicContact CD1-CB 4.27Å; L22-R26 PolarHBondContact N-O 3.48Å; L22-L28 HydrophobicContact CD1-CD1 3.87Å; L22-L28 HydrophobicContact CD1-CG 4.23Å; L22-L28 HydrophobicContact CG-CD1 4.4Å; L22-V66 HydrophobicContact CD2-CG1 3.52Å; L22-V66 HydrophobicContact CD2-CG2 4.49Å; L22-N70 CarbonylContact C-O 3.53Å; L22-N70 VanDerWaalsContact CA-O 3.25Å; L22-N70 WeakPolarHBondContact CA-O 3.34Å
23	R	92.3	Very high	93.7	Very high	164 Å²	164	48.1 Å²	48.1	62%	0.619	23%	0.234	S	C	*	.	T	Hydrogen-bonded Turn	trans	-59.4	-31.3	178.2	-174.1	-177.4	-63	-91.7	-2.7	113.3	G25 E69 N70 V72	R23-G25 PolarHBondContact O-N 3.03Å; R23-E69 PolarHBondContact NE-O 2.94Å; R23-E69 PolarHBondContact NH2-O 3.33Å; R23-N70 PolarHBondContact N-O 2.85Å; R23-V72 HydrophobicContact CB-CG2 4.27Å
24	D	87.7	Confident	93.9	Very high	103 Å²	103	49.7 Å²	49.7	55%	0.551	25%	0.247	S	C	*	.	T	Hydrogen-bonded Turn	trans	-77.6	0.8	175.5	64.5	5.5	0	0	0	113.5	L22 R26	L22-D24 VanDerWaalsContact CB-OD1 3.23Å; L22-D24 WeakPolarHBondContact CB-OD1 3.32Å; L22-D24 PolarHBondContact O-N 3.42Å; D24-R26 VanDerWaalsContact CG-CD 3.41Å; D24-R26 VanDerWaalsContact OD1-CB 3.3Å; D24-R26 WeakPolarHBondContact OD1-CB 3.37Å; D24-R26 WeakPolarHBondContact OD1-CD 3.44Å; D24-R26 VanDerWaalsContact OD1-CG 3.29Å; D24-R26 WeakPolarHBondContact OD1-CG 3.23Å; D24-R26 PolarHBondContact OD1-N 2.94Å; D24-R26 WeakPolarHBondContact OD2-CD 3.35Å; D24-R26 IonicContact OD2-NH1 2.83Å
25	G	88.9	Confident	93.9	Very high	52 Å²	52	48.3 Å²	48.3	54%	0.536	24%	0.24	S	C	.	.	S	Bend	trans	85.7	2.4	179.1	0	0	0	0	0	114.4	L22 R23	L22-G25 WeakPolarHBondContact O-CA 3.2Å; L22-G25 PolarHBondContact O-N 2.77Å; R23-G25 PolarHBondContact O-N 3.03Å
26	R	92.3	Very high	93.9	Very high	69 Å²	69	46.2 Å²	46.2	26%	0.26	23%	0.228	S	C	.	.			trans	-73.6	143.6	176	-64.2	164.3	74	-160.1	-4.4	110.7	L22 D24 E48	L22-R26 HydrophobicContact CB-CB 4.46Å; L22-R26 HydrophobicContact CD1-CB 4.27Å; L22-R26 PolarHBondContact N-O 3.48Å; D24-R26 VanDerWaalsContact CG-CD 3.41Å; D24-R26 VanDerWaalsContact OD1-CB 3.3Å; D24-R26 WeakPolarHBondContact OD1-CB 3.37Å; D24-R26 WeakPolarHBondContact OD1-CD 3.44Å; D24-R26 VanDerWaalsContact OD1-CG 3.29Å; D24-R26 WeakPolarHBondContact OD1-CG 3.23Å; D24-R26 PolarHBondContact OD1-N 2.94Å; D24-R26 WeakPolarHBondContact OD2-CD 3.35Å; D24-R26 IonicContact OD2-NH1 2.83Å; R26-E48 IonicContact CZ-OE1 2.73Å; R26-E48 IonicContact CZ-OE2 2.76Å; R26-E48 VanDerWaalsContact NE-CD 3.34Å; R26-E48 IonicContact NE-OE1 3.39Å; R26-E48 PolarHBondContact NE-OE1 2.71Å; R26-E48 IonicContact NE-OE2 3.49Å; R26-E48 PolarHBondContact NE-OE2 2.69Å; R26-E48 IonicContact NH2-OE1 3.9Å; R26-E48 IonicContact NH2-OE2 3.64Å; R26-E48 PolarHBondContact NH2-OE2 3.18Å
27	T	95	Very high	93.7	Very high	17 Å²	17	49.6 Å²	49.6	10%	0.104	25%	0.245	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-109.3	121	174.9	-55.3	0	0	0	0	109.2	L19 V20 E48 R49	L19-T27 HydrophobicContact CD1-CG2 3.69Å; L19-T27 HydrophobicContact CD2-CG2 3.89Å; L19-T27 HydrophobicContact CG-CG2 3.62Å; V20-T27 CarbonylContact O-C 3.6Å; V20-T27 WeakPolarHBondContact O-CA 3.44Å; T27-E48 CarbonylContact O-C 3.6Å; T27-E48 WeakPolarHBondContact O-CA 3.17Å; T27-R49 WeakPolarHBondContact CB-O 3.38Å; T27-R49 PolarHBondContact O-N 3.08Å
28	L	96.2	Very high	93.4	Very high	1 Å²	1	53.4 Å²	53.4	1%	0.005	26%	0.262	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.4	140.6	175	-62	-178.8	0	0	0	109.6	L19 V20 L22 T46 V47 E48 F64 V66	L19-L28 CarbonylContact C-O 3.57Å; L19-L28 WeakPolarHBondContact CA-O 3.5Å; V20-L28 HydrophobicContact CB-CB 4.48Å; V20-L28 PolarHBondContact N-O 2.98Å; V20-L28 PolarHBondContact O-N 2.98Å; L22-L28 HydrophobicContact CD1-CD1 3.87Å; L22-L28 HydrophobicContact CD1-CG 4.23Å; L22-L28 HydrophobicContact CG-CD1 4.4Å; L28-T46 HydrophobicContact CB-CG2 4.07Å; L28-T46 HydrophobicContact CD1-CG2 4.48Å; L28-T46 HydrophobicContact CD2-CG2 4.17Å; L28-T46 HydrophobicContact CG-CG2 4.47Å; L28-V47 CarbonylContact C-O 3.57Å; L28-E48 HydrophobicContact CD2-CB 3.79Å; L28-E48 HydrophobicContact CD2-CG 4.08Å; L28-F64 HydrophobicContact CD1-CD1 3.55Å; L28-F64 HydrophobicContact CD1-CE1 3.6Å; L28-F64 HydrophobicContact CD1-CG 4.33Å; L28-F64 HydrophobicContact CD1-CZ 4.41Å; L28-V66 HydrophobicContact CD1-CG2 3.78Å
29	I	95.5	Very high	93.2	Very high	9 Å²	9	54.6 Å²	54.6	5%	0.046	27%	0.271	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	124.7	175.9	-60.4	173	0	0	0	107.5	K17 H18 L19 T46 V47 R49 M77	K17-I29 HydrophobicContact CD-CG2 4.46Å; K17-I29 VanDerWaalsContact CE-CG2 3.47Å; K17-I29 HydrophobicContact CG-CG2 4.3Å; H18-I29 VanDerWaalsContact O-CA 3.31Å; H18-I29 WeakPolarHBondContact O-CA 3.36Å; L19-I29 HydrophobicContact CB-CG1 4.38Å; L19-I29 HydrophobicContact CD1-CD1 4.3Å; L19-I29 HydrophobicContact CD1-CG1 4.2Å; L19-I29 HydrophobicContact CG-CG1 4.24Å; I29-T46 CarbonylContact O-C 3.51Å; I29-T46 VanDerWaalsContact O-CA 3.29Å; I29-T46 WeakPolarHBondContact O-CA 3.39Å; I29-V47 PolarHBondContact N-O 3.25Å; I29-V47 PolarHBondContact O-N 3.21Å; I29-R49 HydrophobicContact CD1-CB 3.98Å; I29-M77 HydrophobicContact CB-SD 4.47Å; I29-M77 HydrophobicContact CD1-SD 4.07Å; I29-M77 HydrophobicContact CG1-SD 4.08Å; I29-M77 HydrophobicContact CG2-CE 4.48Å; I29-M77 HydrophobicContact CG2-SD 3.61Å
30	G	95.7	Very high	93.1	Very high	1 Å²	1	54.3 Å²	54.3	1%	0.01	27%	0.27	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-168.5	179.3	-179.1	0	0	0	0	0	112.7	K17 H18	K17-G30 CarbonylContact C-O 3.59Å; K17-G30 WeakPolarHBondContact CA-O 3.45Å; H18-G30 PolarHBondContact N-O 3.2Å; H18-G30 PolarHBondContact O-N 3.47Å
31	Y	95.7	Very high	93.1	Very high	66 Å²	66	54.4 Å²	54.4	26%	0.259	27%	0.271	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.1	123.2	173.9	-68.3	-89	0	0	0	109.9	K17 R33 F43 H44 Q45	K17-Y31 HydrophobicContact CB-CD1 4.23Å; K17-Y31 HydrophobicContact CB-CE1 3.96Å; Y31-R33 PolarHBondContact O-N 2.84Å; Y31-F43 CarbonylContact O-C 3.57Å; Y31-F43 WeakPolarHBondContact O-CA 3.06Å; Y31-H44 PolarHBondContact N-O 3.33Å; Y31-H44 PolarHBondContact O-N 3.06Å; Y31-Q45 HydrophobicContact CD2-CB 4.21Å
32	L	95.6	Very high	93.1	Very high	0 Å²	0	54 Å²	54	0%	0	27%	0.271	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.5	122.5	179.1	-172.2	52.2	0	0	0	109.5	D13 D15 K16 I35 L41 F43 L74	D13-L32 HydrophobicContact CB-CD2 4.2Å; D15-L32 WeakPolarHBondContact CA-O 3.38Å; D15-L32 PolarHBondContact N-O 2.91Å; K16-L32 PolarHBondContact O-N 3.33Å; K16-L32 VanDerWaalsContact O-N 3.1Å; L32-I35 HydrophobicContact CD1-CD1 4.23Å; L32-I35 HydrophobicContact CD1-CG1 3.85Å; L32-I35 HydrophobicContact CD2-CD1 3.37Å; L32-I35 HydrophobicContact CD2-CG1 3.96Å; L32-I35 HydrophobicContact CG-CD1 3.89Å; L32-I35 HydrophobicContact CG-CG1 3.95Å; L32-L41 HydrophobicContact CD1-CB 4Å; L32-L41 HydrophobicContact CD1-CD2 4.08Å; L32-F43 HydrophobicContact CB-CD1 4.35Å; L32-F43 HydrophobicContact CB-CE1 3.83Å; L32-F43 HydrophobicContact CD1-CD1 4.36Å; L32-F43 HydrophobicContact CD1-CE1 3.82Å; L32-F43 HydrophobicContact CD1-CE2 4.32Å; L32-F43 HydrophobicContact CD1-CZ 3.79Å; L32-F43 HydrophobicContact CG-CE1 4.36Å; L32-L74 HydrophobicContact CD2-CD1 4.32Å
33	R	95.4	Very high	93.2	Very high	103 Å²	103	53.5 Å²	53.5	39%	0.389	27%	0.268	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.9	-32.4	-177.2	-66.1	-56.8	-172.9	-160.4	-4.3	113.6	D15 Y31 V42 H44	D15-R33 WeakPolarHBondContact OD1-CD 3.39Å; D15-R33 IonicContact OD1-CZ 3.5Å; D15-R33 IonicContact OD1-NH1 2.78Å; D15-R33 PolarHBondContact OD1-NH1 3.34Å; Y31-R33 PolarHBondContact O-N 2.84Å; R33-V42 PolarHBondContact N-O 3.43Å; R33-H44 HydrophobicContact CG-CB 3.65Å
34	S	94.1	Very high	93.4	Very high	60 Å²	60	48.8 Å²	48.8	42%	0.42	25%	0.252	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.1	150.2	-178.3	-168.1	0	0	0	0	110.6	V42	S34-V42 PolarHBondContact O-N 3.49Å
35	I	93.8	Very high	93.8	Very high	36 Å²	36	49.3 Å²	49.3	19%	0.185	25%	0.252	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.9	145.4	-177	-50.9	176.7	0	0	0	107.2	T7 L10 L32 N40 L41	T7-I35 HydrophobicContact CG2-CG2 3.76Å; L10-I35 HydrophobicContact CB-CD1 3.33Å; L10-I35 HydrophobicContact CD1-CD1 4.31Å; L10-I35 HydrophobicContact CD1-CG2 4.3Å; L10-I35 HydrophobicContact CG-CD1 4.43Å; L10-I35 WeakPolarHBondContact O-CD1 3.4Å; L32-I35 HydrophobicContact CD1-CD1 4.23Å; L32-I35 HydrophobicContact CD1-CG1 3.85Å; L32-I35 HydrophobicContact CD2-CD1 3.37Å; L32-I35 HydrophobicContact CD2-CG1 3.96Å; L32-I35 HydrophobicContact CG-CD1 3.89Å; L32-I35 HydrophobicContact CG-CG1 3.95Å; I35-N40 WeakPolarHBondContact CA-O 3.42Å; I35-L41 HydrophobicContact CB-CD2 4.42Å; I35-L41 HydrophobicContact CD1-CD2 4.38Å; I35-L41 HydrophobicContact CG1-CD2 3.95Å; I35-L41 HydrophobicContact CG2-CD2 3.95Å
36	D	92.3	Very high	94.2	Very high	51 Å²	51	46.9 Å²	46.9	27%	0.273	23%	0.227	S	C	.	.			trans	-114.5	176	166.8	74.8	6.4	0	0	0	111.8	T7 F38 A39 N40	T7-D36 WeakPolarHBondContact CG2-O 3.46Å; D36-F38 PolarHBondContact O-N 2.96Å; D36-F38 VanDerWaalsContact O-N 3.09Å; D36-F38 WeakPolarHBondContact OD1-CA 3.15Å; D36-F38 PolarHBondContact OD1-N 2.99Å; D36-A39 PolarHBondContact O-N 2.82Å; D36-A39 PolarHBondContact OD1-N 3.41Å; D36-A39 VanDerWaalsContact OD1-N 3.13Å; D36-N40 PolarHBondContact N-O 3.27Å; D36-N40 WeakPolarHBondContact OD1-CB 3.49Å; D36-N40 PolarHBondContact OD1-N 3.44Å; D36-N40 PolarHBondContact OD1-ND2 2.95Å; D36-N40 WeakPolarHBondContact OD2-CB 3.31Å; D36-N40 PolarHBondContact OD2-ND2 3.43Å
37	Q	88.7	Confident	94.3	Very high	135 Å²	135	45.6 Å²	45.6	63%	0.631	23%	0.226	S	C	*	.	T	Hydrogen-bonded Turn	trans	-61.9	-18.8	-178.7	67.3	-85.7	13.6	0	0	114.5	T7 A39	T7-Q37 PolarHBondContact OG1-O 3.41Å; T7-Q37 VanDerWaalsContact OG1-O 3.09Å; Q37-A39 VanDerWaalsContact C-N 3.32Å
38	F	89	Confident	94.4	Very high	143 Å²	143	45.4 Å²	45.4	63%	0.627	22%	0.224	S	C	*	.	T	Hydrogen-bonded Turn	trans	-93.2	7.9	178.4	-56.8	-69	0	0	0	112.5	D36 N40 G68	D36-F38 PolarHBondContact O-N 2.96Å; D36-F38 VanDerWaalsContact O-N 3.09Å; D36-F38 WeakPolarHBondContact OD1-CA 3.15Å; D36-F38 PolarHBondContact OD1-N 2.99Å; F38-N40 VanDerWaalsContact C-N 3.26Å; F38-N40 PolarHBondContact O-N 3.02Å; F38-G68 WeakPolarHBondContact O-CA 3.37Å
39	A	89.1	Confident	94.3	Very high	24 Å²	24	48.2 Å²	48.2	20%	0.198	24%	0.235	C	C	.	.			trans	60.8	31.8	-175.2	0	0	0	0	0	113	T7 D36 Q37 L41 G68	T7-A39 HydrophobicContact CG2-CB 4.21Å; D36-A39 PolarHBondContact O-N 2.82Å; D36-A39 PolarHBondContact OD1-N 3.41Å; D36-A39 VanDerWaalsContact OD1-N 3.13Å; Q37-A39 VanDerWaalsContact C-N 3.32Å; A39-L41 WeakPolarHBondContact O-CG 3.24Å; A39-L41 PolarHBondContact O-N 2.92Å; A39-G68 WeakPolarHBondContact O-CA 3.38Å
40	N	93.4	Very high	94.1	Very high	43 Å²	43	48.2 Å²	48.2	23%	0.23	24%	0.235	C	C	.	.			trans	-70.6	126.6	162.6	-62.6	-48.9	0	0	0	108.2	I35 D36 F38 V66 R67 G68	I35-N40 WeakPolarHBondContact CA-O 3.42Å; D36-N40 PolarHBondContact N-O 3.27Å; D36-N40 WeakPolarHBondContact OD1-CB 3.49Å; D36-N40 PolarHBondContact OD1-N 3.44Å; D36-N40 PolarHBondContact OD1-ND2 2.95Å; D36-N40 WeakPolarHBondContact OD2-CB 3.31Å; D36-N40 PolarHBondContact OD2-ND2 3.43Å; F38-N40 VanDerWaalsContact C-N 3.26Å; F38-N40 PolarHBondContact O-N 3.02Å; N40-V66 CarbonylContact C-O 3.59Å; N40-V66 WeakPolarHBondContact CA-O 3.34Å; N40-R67 VanDerWaalsContact OD1-CA 3.28Å; N40-R67 WeakPolarHBondContact OD1-CA 3.41Å; N40-R67 VanDerWaalsContact OD1-CG 3.28Å; N40-R67 WeakPolarHBondContact OD1-CG 3.29Å; N40-G68 PolarHBondContact OD1-N 3.18Å
41	L	94.8	Very high	93.9	Very high	2 Å²	2	51.9 Å²	51.9	1%	0.01	25%	0.252	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.4	134.8	-169.7	-50	174.9	0	0	0	110.5	V20 L32 I35 A39 F43 I65 V66 V71 L74	V20-L41 HydrophobicContact CG2-CD1 4.29Å; L32-L41 HydrophobicContact CD1-CB 4Å; L32-L41 HydrophobicContact CD1-CD2 4.08Å; I35-L41 HydrophobicContact CB-CD2 4.42Å; I35-L41 HydrophobicContact CD1-CD2 4.38Å; I35-L41 HydrophobicContact CG1-CD2 3.95Å; I35-L41 HydrophobicContact CG2-CD2 3.95Å; A39-L41 WeakPolarHBondContact O-CG 3.24Å; A39-L41 PolarHBondContact O-N 2.92Å; L41-F43 HydrophobicContact CB-CD2 4.07Å; L41-F43 HydrophobicContact CB-CE2 3.53Å; L41-F43 HydrophobicContact CB-CZ 4.23Å; L41-F43 HydrophobicContact CD1-CE2 3.64Å; L41-F43 HydrophobicContact CD1-CZ 3.93Å; L41-F43 HydrophobicContact CG-CE2 4.23Å; L41-I65 WeakPolarHBondContact O-CA 3.28Å; L41-V66 HydrophobicContact CB-CB 4.33Å; L41-V66 PolarHBondContact N-O 3.5Å; L41-V66 PolarHBondContact O-N 3.23Å; L41-V71 HydrophobicContact CD1-CG2 3.88Å; L41-V71 HydrophobicContact CG-CG2 4.47Å; L41-L74 HydrophobicContact CD1-CD1 3.54Å; L41-L74 HydrophobicContact CD2-CD1 4.45Å
42	V	96.3	Very high	93.7	Very high	44 Å²	44	49.6 Å²	49.6	27%	0.267	24%	0.244	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-107.6	115.8	169.8	-176.5	0	0	0	0	108.7	R33 S34 I63 I65	R33-V42 PolarHBondContact N-O 3.43Å; S34-V42 PolarHBondContact O-N 3.49Å; V42-I63 HydrophobicContact CG1-CG2 4.5Å; V42-I65 HydrophobicContact CG2-CG1 4.38Å
43	F	96.6	Very high	93.3	Very high	1 Å²	1	53 Å²	53	0%	0.004	28%	0.279	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.3	142.6	175.4	-73	-76.4	0	0	0	112	H18 V20 Y31 L32 L41 T46 I63 F64 V66 L74	H18-F43 HydrophobicContact CB-CE1 3.94Å; H18-F43 HydrophobicContact CB-CZ 4.38Å; V20-F43 HydrophobicContact CB-CE2 4.5Å; V20-F43 HydrophobicContact CG2-CE1 4.25Å; V20-F43 HydrophobicContact CG2-CE2 3.56Å; V20-F43 HydrophobicContact CG2-CZ 3.28Å; Y31-F43 CarbonylContact O-C 3.57Å; Y31-F43 WeakPolarHBondContact O-CA 3.06Å; L32-F43 HydrophobicContact CB-CD1 4.35Å; L32-F43 HydrophobicContact CB-CE1 3.83Å; L32-F43 HydrophobicContact CD1-CD1 4.36Å; L32-F43 HydrophobicContact CD1-CE1 3.82Å; L32-F43 HydrophobicContact CD1-CE2 4.32Å; L32-F43 HydrophobicContact CD1-CZ 3.79Å; L32-F43 HydrophobicContact CG-CE1 4.36Å; L41-F43 HydrophobicContact CB-CD2 4.07Å; L41-F43 HydrophobicContact CB-CE2 3.53Å; L41-F43 HydrophobicContact CB-CZ 4.23Å; L41-F43 HydrophobicContact CD1-CE2 3.64Å; L41-F43 HydrophobicContact CD1-CZ 3.93Å; L41-F43 HydrophobicContact CG-CE2 4.23Å; F43-T46 HydrophobicContact CB-CG2 4.35Å; F43-T46 WeakPolarHBondContact CB-OG1 3.24Å; F43-I63 WeakPolarHBondContact O-CA 3.49Å; F43-F64 PolarHBondContact N-O 2.74Å; F43-F64 PolarHBondContact O-N 2.83Å; F43-V66 HydrophobicContact CD2-CG2 4.13Å; F43-V66 HydrophobicContact CE2-CG2 4.36Å; F43-L74 HydrophobicContact CZ-CD1 4.1Å
44	H	96.2	Very high	93	Very high	64 Å²	64	55.4 Å²	55.4	30%	0.296	29%	0.292	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.1	149.5	171.9	179.1	-98.8	0	0	0	110.4	Y31 R33 T46	Y31-H44 PolarHBondContact N-O 3.33Å; Y31-H44 PolarHBondContact O-N 3.06Å; R33-H44 HydrophobicContact CG-CB 3.65Å; H44-T46 PolarHBondContact O-N 2.96Å
45	Q	95.6	Very high	92.8	Very high	115 Å²	115	54.8 Å²	54.8	54%	0.537	28%	0.282	S	S	.	.	E	Extended strand (participates in β ladder)	trans	51.4	40.2	-175	-77.5	167.1	-12	0	0	112.1	Y31 G62	Y31-Q45 HydrophobicContact CD2-CB 4.21Å; Q45-G62 PolarHBondContact N-O 3.34Å
46	T	96.3	Very high	92.8	Very high	1 Å²	1	54 Å²	54	1%	0.006	28%	0.277	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.6	133.6	-178.3	-45.4	0	0	0	0	110.1	L28 I29 F43 H44 R61 G62 F64	L28-T46 HydrophobicContact CB-CG2 4.07Å; L28-T46 HydrophobicContact CD1-CG2 4.48Å; L28-T46 HydrophobicContact CD2-CG2 4.17Å; L28-T46 HydrophobicContact CG-CG2 4.47Å; I29-T46 CarbonylContact O-C 3.51Å; I29-T46 VanDerWaalsContact O-CA 3.29Å; I29-T46 WeakPolarHBondContact O-CA 3.39Å; F43-T46 HydrophobicContact CB-CG2 4.35Å; F43-T46 WeakPolarHBondContact CB-OG1 3.24Å; H44-T46 PolarHBondContact O-N 2.96Å; T46-R61 WeakPolarHBondContact O-CA 3.5Å; T46-R61 PolarHBondContact O-N 2.8Å; T46-G62 WeakPolarHBondContact CB-O 3.23Å; T46-G62 PolarHBondContact N-O 2.94Å; T46-G62 PolarHBondContact O-N 2.88Å; T46-G62 VanDerWaalsContact O-N 3.13Å; T46-G62 PolarHBondContact OG1-O 2.87Å; T46-F64 HydrophobicContact CG2-CB 3.96Å
47	V	95.9	Very high	92.8	Very high	42 Å²	42	51.6 Å²	51.6	26%	0.255	27%	0.265	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.2	131.9	170.3	175.3	0	0	0	0	107.3	L28 I29 D58 I59	L28-V47 CarbonylContact C-O 3.57Å; I29-V47 PolarHBondContact N-O 3.25Å; I29-V47 PolarHBondContact O-N 3.21Å; V47-D58 HydrophobicContact CG1-CB 3.42Å; V47-D58 VanDerWaalsContact CG1-CB 3.42Å; V47-I59 CarbonylContact C-O 3.52Å; V47-I59 WeakPolarHBondContact CA-O 3.3Å
48	E	95.6	Very high	93.1	Very high	13 Å²	13	47 Å²	47	6%	0.061	24%	0.244	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-88.6	119.4	167.9	179.3	176.2	174.4	0	0	108.9	R26 T27 L28 I59 R61	R26-E48 IonicContact CZ-OE1 2.73Å; R26-E48 IonicContact CZ-OE2 2.76Å; R26-E48 VanDerWaalsContact NE-CD 3.34Å; R26-E48 IonicContact NE-OE1 3.39Å; R26-E48 PolarHBondContact NE-OE1 2.71Å; R26-E48 IonicContact NE-OE2 3.49Å; R26-E48 PolarHBondContact NE-OE2 2.69Å; R26-E48 IonicContact NH2-OE1 3.9Å; R26-E48 IonicContact NH2-OE2 3.64Å; R26-E48 PolarHBondContact NH2-OE2 3.18Å; T27-E48 CarbonylContact O-C 3.6Å; T27-E48 WeakPolarHBondContact O-CA 3.17Å; L28-E48 HydrophobicContact CD2-CB 3.79Å; L28-E48 HydrophobicContact CD2-CG 4.08Å; E48-I59 HydrophobicContact CB-CB 4.35Å; E48-I59 PolarHBondContact N-O 3.03Å; E48-I59 PolarHBondContact O-N 2.9Å; E48-R61 HydrophobicContact CB-CG 4.03Å; E48-R61 IonicContact OE2-CZ 2.69Å; E48-R61 IonicContact OE2-NE 2.72Å; E48-R61 PolarHBondContact OE2-NE 2.82Å; E48-R61 IonicContact OE2-NH2 3.19Å; E48-R61 PolarHBondContact OE2-NH2 2.82Å
49	R	93.9	Very high	93.3	Very high	59 Å²	59	41.2 Å²	41.2	22%	0.223	22%	0.22	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-101.5	120.4	179.4	-176.2	167	-71.5	-177.4	-7.6	110.3	T27 I29 H51 F56 G57 D58	T27-R49 WeakPolarHBondContact CB-O 3.38Å; T27-R49 PolarHBondContact O-N 3.08Å; I29-R49 HydrophobicContact CD1-CB 3.98Å; R49-H51 WeakPolarHBondContact CD-NE2 3.4Å; R49-H51 VanDerWaalsContact CG-CE1 3.49Å; R49-H51 WeakPolarHBondContact CG-CE1 3.41Å; R49-F56 HydrophobicContact CG-CB 4.26Å; R49-F56 HydrophobicContact CG-CD2 4.12Å; R49-G57 WeakPolarHBondContact CA-O 2.96Å; R49-D58 WeakPolarHBondContact CB-OD1 3.39Å; R49-D58 WeakPolarHBondContact CG-OD1 3.29Å; R49-D58 IonicContact CZ-OD1 3.69Å; R49-D58 IonicContact CZ-OD2 3.84Å; R49-D58 IonicContact NE-OD1 3.73Å; R49-D58 PolarHBondContact NE-OD1 2.88Å; R49-D58 IonicContact NE-OD2 2.88Å; R49-D58 IonicContact NH2-OD1 2.64Å; R49-D58 PolarHBondContact NH2-OD1 2.99Å; R49-D58 IonicContact NH2-OD2 2.9Å; R49-D58 PolarHBondContact NH2-OD2 2.96Å
50	I	93.1	Very high	93.6	Very high	10 Å²	10	44.8 Å²	44.8	5%	0.051	24%	0.241	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-98.5	130.1	174.6	-59.3	166.4	0	0	0	107.9	V52 F56 G57 I59 I95 L96 Q99	I50-V52 HydrophobicContact CG2-CG2 4.14Å; I50-F56 CarbonylContact O-C 3.51Å; I50-F56 WeakPolarHBondContact O-CA 3.47Å; I50-G57 PolarHBondContact N-O 2.92Å; I50-G57 PolarHBondContact O-N 3.43Å; I50-I59 HydrophobicContact CD1-CD1 3.6Å; I50-I59 HydrophobicContact CD1-CG1 4.48Å; I50-I95 HydrophobicContact CB-CG1 3.84Å; I50-I95 HydrophobicContact CB-CG2 4.4Å; I50-I95 HydrophobicContact CD1-CG2 4.23Å; I50-I95 HydrophobicContact CG2-CG1 3.68Å; I50-L96 HydrophobicContact CD1-CD2 3.72Å; I50-Q99 HydrophobicContact CG2-CB 4.2Å; I50-Q99 HydrophobicContact CG2-CG 4.2Å
51	H	91.2	Very high	93.7	Very high	78 Å²	78	48 Å²	48	36%	0.361	25%	0.25	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-113	124.9	177.2	-59.7	99	0	0	0	109.6	R49	R49-H51 WeakPolarHBondContact CD-NE2 3.4Å; R49-H51 VanDerWaalsContact CG-CE1 3.49Å; R49-H51 WeakPolarHBondContact CG-CE1 3.41Å
52	V	90.6	Very high	93.7	Very high	17 Å²	17	49.6 Å²	49.6	10%	0.103	27%	0.267	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.1	109	173.6	-174.7	0	0	0	0	108.8	I50 K54 K55 I95 E98 Q99	I50-V52 HydrophobicContact CG2-CG2 4.14Å; V52-K54 PolarHBondContact O-N 2.9Å; V52-K55 PolarHBondContact N-O 3.44Å; V52-K55 PolarHBondContact O-N 2.72Å; V52-I95 HydrophobicContact CB-CD1 3.87Å; V52-I95 HydrophobicContact CG2-CD1 3.72Å; V52-I95 HydrophobicContact CG2-CG1 4.23Å; V52-E98 HydrophobicContact CB-CB 4.34Å; V52-E98 HydrophobicContact CG1-CB 3.98Å; V52-E98 HydrophobicContact CG2-CB 4.37Å; V52-Q99 HydrophobicContact CG2-CB 4.03Å
53	G	87.3	Confident	93.7	Very high	71 Å²	71	53.4 Å²	53.4	73%	0.732	28%	0.284	S	S	*	.	T	Hydrogen-bonded Turn	trans	59	-110.3	-177.9	0	0	0	0	0	112.4
54	K	88.5	Confident	93.6	Very high	154 Å²	154	55.7 Å²	55.7	67%	0.67	29%	0.294	S	S	*	.	T	Hydrogen-bonded Turn	trans	-104.4	10.6	177.4	-63.4	-174.6	179.4	-178.8	0	113.2	V52 L87 Q88	V52-K54 PolarHBondContact O-N 2.9Å; K54-L87 CarbonylContact O-C 3.6Å; K54-L87 VanDerWaalsContact O-CA 3.28Å; K54-L87 WeakPolarHBondContact O-CA 3.21Å; K54-Q88 PolarHBondContact O-N 2.88Å
55	K	91.6	Very high	93.5	Very high	47 Å²	47	58.7 Å²	58.7	20%	0.204	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.6	152.1	-179	-67.8	171.7	171.6	-170.1	0	110.7	V52 Q88 V90 E94 I95 E98	V52-K55 PolarHBondContact N-O 3.44Å; V52-K55 PolarHBondContact O-N 2.72Å; K55-Q88 CarbonylContact C-O 3.35Å; K55-Q88 VanDerWaalsContact CA-O 3.24Å; K55-Q88 WeakPolarHBondContact CA-O 3.27Å; K55-Q88 HydrophobicContact CG-CB 4.42Å; K55-V90 HydrophobicContact CB-CG1 4.18Å; K55-V90 HydrophobicContact CB-CG2 4.16Å; K55-V90 HydrophobicContact CD-CG1 3.84Å; K55-V90 HydrophobicContact CG-CG1 3.94Å; K55-E94 IonicContact NZ-OE1 3.63Å; K55-E94 PolarHBondContact NZ-OE1 3.18Å; K55-I95 HydrophobicContact CB-CD1 4.21Å; K55-E98 WeakPolarHBondContact CD-OE1 3.36Å; K55-E98 VanDerWaalsContact CD-OE2 3.31Å; K55-E98 WeakPolarHBondContact CD-OE2 3.13Å; K55-E98 IonicContact NZ-OE1 2.71Å; K55-E98 PolarHBondContact NZ-OE1 3.37Å
56	F	92.6	Very high	93.5	Very high	20 Å²	20	53.5 Å²	53.5	9%	0.088	29%	0.287	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.3	151.5	170.4	77.9	-82.2	0	0	0	112	R49 I50 L87 Q88 Q89 V90	R49-F56 HydrophobicContact CG-CB 4.26Å; R49-F56 HydrophobicContact CG-CD2 4.12Å; I50-F56 CarbonylContact O-C 3.51Å; I50-F56 WeakPolarHBondContact O-CA 3.47Å; F56-L87 HydrophobicContact CD1-CB 3.73Å; F56-L87 HydrophobicContact CE1-CB 4.21Å; F56-Q88 WeakPolarHBondContact CD1-O 3.45Å; F56-Q88 PolarHBondContact N-O 3.28Å; F56-Q89 HydrophobicContact CD1-CB 4.42Å; F56-Q89 HydrophobicContact CE1-CB 3.72Å; F56-Q89 HydrophobicContact CE1-CG 4.37Å; F56-Q89 HydrophobicContact CE2-CB 4.12Å; F56-Q89 HydrophobicContact CE2-CG 3.85Å; F56-Q89 HydrophobicContact CZ-CB 3.55Å; F56-Q89 HydrophobicContact CZ-CG 3.79Å; F56-Q89 WeakPolarHBondContact O-CA 3.28Å; F56-V90 WeakPolarHBondContact O-CG2 3.31Å; F56-V90 PolarHBondContact O-N 3.23Å
57	G	93.2	Very high	93.5	Very high	0 Å²	0	61.2 Å²	61.2	0%	0	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.1	146.5	173.8	0	0	0	0	0	111.4	R49 I50	R49-G57 WeakPolarHBondContact CA-O 2.96Å; I50-G57 PolarHBondContact N-O 2.92Å; I50-G57 PolarHBondContact O-N 3.43Å
58	D	94.2	Very high	93.3	Very high	39 Å²	39	59.8 Å²	59.8	21%	0.209	31%	0.31	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	121.2	-170.4	-82	-12.8	0	0	0	110.6	V47 R49	V47-D58 HydrophobicContact CG1-CB 3.42Å; V47-D58 VanDerWaalsContact CG1-CB 3.42Å; R49-D58 WeakPolarHBondContact CB-OD1 3.39Å; R49-D58 WeakPolarHBondContact CG-OD1 3.29Å; R49-D58 IonicContact CZ-OD1 3.69Å; R49-D58 IonicContact CZ-OD2 3.84Å; R49-D58 IonicContact NE-OD1 3.73Å; R49-D58 PolarHBondContact NE-OD1 2.88Å; R49-D58 IonicContact NE-OD2 2.88Å; R49-D58 IonicContact NH2-OD1 2.64Å; R49-D58 PolarHBondContact NH2-OD1 2.99Å; R49-D58 IonicContact NH2-OD2 2.9Å; R49-D58 PolarHBondContact NH2-OD2 2.96Å
59	I	94.1	Very high	93.2	Very high	22 Å²	22	63.4 Å²	63.4	11%	0.113	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.9	117.1	178.8	-56.6	176.6	0	0	0	109.1	V47 E48 I50 R61 I92 L96	V47-I59 CarbonylContact C-O 3.52Å; V47-I59 WeakPolarHBondContact CA-O 3.3Å; E48-I59 HydrophobicContact CB-CB 4.35Å; E48-I59 PolarHBondContact N-O 3.03Å; E48-I59 PolarHBondContact O-N 2.9Å; I50-I59 HydrophobicContact CD1-CD1 3.6Å; I50-I59 HydrophobicContact CD1-CG1 4.48Å; I59-R61 PolarHBondContact O-N 3.38Å; I59-I92 HydrophobicContact CD1-CG2 4.21Å; I59-I92 HydrophobicContact CG1-CG1 4.33Å; I59-I92 HydrophobicContact CG1-CG2 3.99Å; I59-L96 HydrophobicContact CD1-CD2 4.26Å
60	P	95.3	Very high	93.1	Very high	98 Å²	98	63.6 Å²	63.6	64%	0.636	33%	0.332	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.8	128	178.3	28.3	-33.3	0	0	0	110.8
61	R	94.5	Very high	93.1	Very high	112 Å²	112	64.8 Å²	64.8	42%	0.423	34%	0.34	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.9	-22.5	177.3	-62.6	-59	-169.7	-176.6	-1.1	113.2	T46 E48 I59 F64	T46-R61 WeakPolarHBondContact O-CA 3.5Å; T46-R61 PolarHBondContact O-N 2.8Å; E48-R61 HydrophobicContact CB-CG 4.03Å; E48-R61 IonicContact OE2-CZ 2.69Å; E48-R61 IonicContact OE2-NE 2.72Å; E48-R61 PolarHBondContact OE2-NE 2.82Å; E48-R61 IonicContact OE2-NH2 3.19Å; E48-R61 PolarHBondContact OE2-NH2 2.82Å; I59-R61 PolarHBondContact O-N 3.38Å; R61-F64 HydrophobicContact CB-CD2 4.11Å
62	G	94.9	Very high	93.2	Very high	35 Å²	35	65.2 Å²	65.2	36%	0.361	35%	0.348	S	S	.	.	E	Extended strand (participates in β ladder)	trans	81.6	-116.8	177.2	0	0	0	0	0	112.3	Q45 T46	Q45-G62 PolarHBondContact N-O 3.34Å; T46-G62 WeakPolarHBondContact CB-O 3.23Å; T46-G62 PolarHBondContact N-O 2.94Å; T46-G62 PolarHBondContact O-N 2.88Å; T46-G62 VanDerWaalsContact O-N 3.13Å; T46-G62 PolarHBondContact OG1-O 2.87Å
63	I	95.6	Very high	93.3	Very high	123 Å²	123	68.5 Å²	68.5	63%	0.631	36%	0.364	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-91.9	128.8	174	-60.9	174.2	0	0	0	108.2	V42 F43	V42-I63 HydrophobicContact CG1-CG2 4.5Å; F43-I63 WeakPolarHBondContact O-CA 3.49Å
64	F	95.1	Very high	93.6	Very high	50 Å²	50	67.1 Å²	67.1	22%	0.219	34%	0.34	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134	128.8	-176.7	-154.5	-91.1	0	0	0	110.6	L28 F43 T46 R61 V66	L28-F64 HydrophobicContact CD1-CD1 3.55Å; L28-F64 HydrophobicContact CD1-CE1 3.6Å; L28-F64 HydrophobicContact CD1-CG 4.33Å; L28-F64 HydrophobicContact CD1-CZ 4.41Å; F43-F64 PolarHBondContact N-O 2.74Å; F43-F64 PolarHBondContact O-N 2.83Å; T46-F64 HydrophobicContact CG2-CB 3.96Å; R61-F64 HydrophobicContact CB-CD2 4.11Å; F64-V66 HydrophobicContact CD1-CG2 3.64Å; F64-V66 HydrophobicContact CE1-CG2 3.96Å
65	I	95.4	Very high	93.7	Very high	127 Å²	127	61.2 Å²	61.2	65%	0.651	32%	0.323	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104.9	119.5	176.4	-56.7	177.5	0	0	0	107.3	L41 V42	L41-I65 WeakPolarHBondContact O-CA 3.28Å; V42-I65 HydrophobicContact CG2-CG1 4.38Å
66	V	94.9	Very high	93.7	Very high	5 Å²	5	64.2 Å²	64.2	3%	0.03	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105	131.3	177.9	-175.7	0	0	0	0	108.6	L22 L28 N40 L41 F43 F64 V71	L22-V66 HydrophobicContact CD2-CG1 3.52Å; L22-V66 HydrophobicContact CD2-CG2 4.49Å; L28-V66 HydrophobicContact CD1-CG2 3.78Å; N40-V66 CarbonylContact C-O 3.59Å; N40-V66 WeakPolarHBondContact CA-O 3.34Å; L41-V66 HydrophobicContact CB-CB 4.33Å; L41-V66 PolarHBondContact N-O 3.5Å; L41-V66 PolarHBondContact O-N 3.23Å; F43-V66 HydrophobicContact CD2-CG2 4.13Å; F43-V66 HydrophobicContact CE2-CG2 4.36Å; F64-V66 HydrophobicContact CD1-CG2 3.64Å; F64-V66 HydrophobicContact CE1-CG2 3.96Å; V66-V71 HydrophobicContact CG1-CG2 3.63Å
67	R	95.2	Very high	93.5	Very high	163 Å²	163	65.9 Å²	65.9	62%	0.615	35%	0.346	S	S	*	.			trans	-83.2	135	174.1	-151.3	177.8	144.2	148.2	0.1	110.7	N40 E69 N70	N40-R67 VanDerWaalsContact OD1-CA 3.28Å; N40-R67 WeakPolarHBondContact OD1-CA 3.41Å; N40-R67 VanDerWaalsContact OD1-CG 3.28Å; N40-R67 WeakPolarHBondContact OD1-CG 3.29Å; R67-E69 VanDerWaalsContact C-N 3.31Å; R67-E69 WeakPolarHBondContact CB-OE1 3.49Å; R67-E69 WeakPolarHBondContact CD-OE1 3.2Å; R67-E69 WeakPolarHBondContact CD-OE2 3.49Å; R67-E69 VanDerWaalsContact CG-OE1 3.27Å; R67-E69 WeakPolarHBondContact CG-OE1 3.07Å; R67-E69 WeakPolarHBondContact CG-OE2 3.41Å; R67-E69 IonicContact CZ-OE1 2.74Å; R67-E69 IonicContact CZ-OE2 3.54Å; R67-E69 IonicContact NE-OE1 3.95Å; R67-E69 PolarHBondContact NE-OE1 3.21Å; R67-E69 IonicContact NE-OE2 3.84Å; R67-E69 PolarHBondContact NE-OE2 3.26Å; R67-E69 PolarHBondContact O-N 2.78Å; R67-N70 WeakPolarHBondContact O-CB 3.46Å; R67-N70 PolarHBondContact O-N 3.04Å
68	G	92	Very high	93.1	Very high	12 Å²	12	69.1 Å²	69.1	12%	0.124	36%	0.364	C	S	.	.	G	3₁₀ helix	trans	-59.9	-34.4	-166.1	0	0	0	0	0	114.6	F38 A39 N40 N70 V71	F38-G68 WeakPolarHBondContact O-CA 3.37Å; A39-G68 WeakPolarHBondContact O-CA 3.38Å; N40-G68 PolarHBondContact OD1-N 3.18Å; G68-N70 PolarHBondContact O-N 3.28Å; G68-V71 WeakPolarHBondContact O-CB 3.44Å; G68-V71 PolarHBondContact O-N 3.1Å; G68-V71 VanDerWaalsContact O-N 3.08Å
69	E	93.3	Very high	92.2	Very high	90 Å²	90	71.8 Å²	71.8	42%	0.421	38%	0.381	S	S	.	.	G	3₁₀ helix	trans	-68.2	-16.2	177.9	74.6	-75.7	162.8	0	0	114.4	R23 R67	R23-E69 PolarHBondContact NE-O 2.94Å; R23-E69 PolarHBondContact NH2-O 3.33Å; R67-E69 VanDerWaalsContact C-N 3.31Å; R67-E69 WeakPolarHBondContact CB-OE1 3.49Å; R67-E69 WeakPolarHBondContact CD-OE1 3.2Å; R67-E69 WeakPolarHBondContact CD-OE2 3.49Å; R67-E69 VanDerWaalsContact CG-OE1 3.27Å; R67-E69 WeakPolarHBondContact CG-OE1 3.07Å; R67-E69 WeakPolarHBondContact CG-OE2 3.41Å; R67-E69 IonicContact CZ-OE1 2.74Å; R67-E69 IonicContact CZ-OE2 3.54Å; R67-E69 IonicContact NE-OE1 3.95Å; R67-E69 PolarHBondContact NE-OE1 3.21Å; R67-E69 IonicContact NE-OE2 3.84Å; R67-E69 PolarHBondContact NE-OE2 3.26Å; R67-E69 PolarHBondContact O-N 2.78Å
70	N	93.2	Very high	91.3	Very high	63 Å²	63	77.7 Å²	77.7	34%	0.337	41%	0.413	S	S	.	.	G	3₁₀ helix	trans	-89.6	-9.5	176.3	-63.6	-60.7	0	0	0	112.6	L22 R23 R67 G68	L22-N70 CarbonylContact C-O 3.53Å; L22-N70 VanDerWaalsContact CA-O 3.25Å; L22-N70 WeakPolarHBondContact CA-O 3.34Å; R23-N70 PolarHBondContact N-O 2.85Å; R67-N70 WeakPolarHBondContact O-CB 3.46Å; R67-N70 PolarHBondContact O-N 3.04Å; G68-N70 PolarHBondContact O-N 3.28Å
71	V	93.1	Very high	90.2	Very high	34 Å²	34	79.8 Å²	79.8	21%	0.206	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79	122.7	177.5	-179.7	0	0	0	0	109.2	V20 L41 V66 G68	V20-V71 HydrophobicContact CG1-CG1 4.08Å; V20-V71 HydrophobicContact CG1-CG2 4.35Å; L41-V71 HydrophobicContact CD1-CG2 3.88Å; L41-V71 HydrophobicContact CG-CG2 4.47Å; V66-V71 HydrophobicContact CG1-CG2 3.63Å; G68-V71 WeakPolarHBondContact O-CB 3.44Å; G68-V71 PolarHBondContact O-N 3.1Å; G68-V71 VanDerWaalsContact O-N 3.08Å
72	V	93.5	Very high	88.4	Confident	87 Å²	87	79.6 Å²	79.6	53%	0.527	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	-49.8	174.3	176.5	0	0	0	0	110.2	L21 R23	L21-V72 HydrophobicContact CB-CB 4.44Å; L21-V72 HydrophobicContact CD2-CB 4.47Å; L21-V72 HydrophobicContact CD2-CG1 4.27Å; L21-V72 HydrophobicContact CG-CB 4.46Å; L21-V72 WeakPolarHBondContact O-CB 3.29Å; L21-V72 PolarHBondContact O-N 3.36Å; R23-V72 HydrophobicContact CB-CG2 4.27Å
73	L	92.6	Very high	86.8	Confident	86 Å²	86	82.6 Å²	82.6	45%	0.45	44%	0.44	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.6	154.2	175.2	70.7	90.6	0	0	0	110.3	L19 V20 L21	L19-L73 HydrophobicContact CD2-CD1 4.3Å; V20-L73 WeakPolarHBondContact CA-O 3.25Å; L21-L73 HydrophobicContact CB-CD1 4.26Å; L21-L73 HydrophobicContact CB-CD2 4.09Å; L21-L73 HydrophobicContact CB-CG 3.72Å; L21-L73 HydrophobicContact CD2-CD2 3.8Å; L21-L73 HydrophobicContact CD2-CG 4.35Å; L21-L73 PolarHBondContact N-O 2.76Å
74	L	92	Very high	85	Confident	42 Å²	42	84.2 Å²	84.2	22%	0.22	45%	0.45	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	136.6	173.3	173.7	146.4	0	0	0	108.2	L10 H18 L19 V20 L32 L41 F43	L10-L74 HydrophobicContact CD2-CD2 3.71Å; H18-L74 HydrophobicContact CB-CG 4.44Å; H18-L74 WeakPolarHBondContact CD2-CD2 3.32Å; L19-L74 WeakPolarHBondContact O-CA 3.25Å; V20-L74 HydrophobicContact CG2-CB 4.3Å; V20-L74 HydrophobicContact CG2-CD1 3.81Å; V20-L74 HydrophobicContact CG2-CG 4.12Å; L32-L74 HydrophobicContact CD2-CD1 4.32Å; L41-L74 HydrophobicContact CD1-CD1 3.54Å; L41-L74 HydrophobicContact CD2-CD1 4.45Å; F43-L74 HydrophobicContact CZ-CD1 4.1Å
75	G	91.5	Very high	83.4	Confident	31 Å²	31	85.4 Å²	85.4	32%	0.32	46%	0.461	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143	133.8	178.5	0	0	0	0	0	111.9	H18 L19 M77	H18-G75 WeakPolarHBondContact CA-O 3.42Å; H18-G75 VanDerWaalsContact CD2-C 3.43Å; H18-G75 PolarHBondContact CD2-O 3.03Å; L19-G75 PolarHBondContact N-O 3.49Å; L19-G75 PolarHBondContact O-N 3.01Å; G75-M77 PolarHBondContact O-N 2.73Å
76	E	91.6	Very high	82.5	Confident	109 Å²	109	86.2 Å²	86.2	51%	0.509	47%	0.465	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-61.7	131.2	173.8	-169.6	-173.9	146.7	0	0	109.7	K16 H18	K16-E76 HydrophobicContact CB-CG 4.33Å; K16-E76 HydrophobicContact CD-CG 3.92Å; K16-E76 WeakPolarHBondContact CD-OE1 3.43Å; K16-E76 VanDerWaalsContact CD-OE2 3.3Å; K16-E76 WeakPolarHBondContact CD-OE2 3.45Å; K16-E76 IonicContact NZ-OE2 2.78Å; K16-E76 PolarHBondContact NZ-OE2 3.39Å; H18-E76 VanDerWaalsContact CD2-CA 3.44Å; H18-E76 WeakPolarHBondContact CD2-CA 3.43Å; H18-E76 PolarHBondContact CD2-N 3.45Å; H18-E76 VanDerWaalsContact CD2-N 3.33Å
77	M	88.6	Confident	82	Confident	55 Å²	55	88.8 Å²	88.8	27%	0.271	48%	0.479	S	S	.	.			trans	-100.2	114.7	173.4	-80.3	-171.7	65.5	0	0	109.7	K17 L19 I29 G75 V79	K17-M77 HydrophobicContact CB-CB 4.44Å; K17-M77 HydrophobicContact CG-CB 4.32Å; K17-M77 PolarHBondContact O-N 3.35Å; L19-M77 HydrophobicContact CB-CG 3.94Å; L19-M77 HydrophobicContact CB-SD 3.88Å; L19-M77 HydrophobicContact CD1-SD 4.38Å; I29-M77 HydrophobicContact CB-SD 4.47Å; I29-M77 HydrophobicContact CD1-SD 4.07Å; I29-M77 HydrophobicContact CG1-SD 4.08Å; I29-M77 HydrophobicContact CG2-CE 4.48Å; I29-M77 HydrophobicContact CG2-SD 3.61Å; G75-M77 PolarHBondContact O-N 2.73Å; M77-V79 PolarHBondContact O-N 3.26Å
78	D	84.2	Confident	81.6	Confident	69 Å²	69	86.9 Å²	86.9	37%	0.369	48%	0.477	S	S	.	.			trans	-70.5	118.8	169.8	-168.4	-18.8	0	0	0	109.6	D80 K81	D78-D80 PolarHBondContact OD1-N 2.8Å; D78-K81 HydrophobicContact CB-CB 4.29Å; D78-K81 HydrophobicContact CB-CD 4.3Å; D78-K81 HydrophobicContact CB-CG 4.32Å; D78-K81 PolarHBondContact OD1-N 2.79Å; D78-K81 WeakPolarHBondContact OD2-CD 3.28Å; D78-K81 WeakPolarHBondContact OD2-CE 3.44Å; D78-K81 WeakPolarHBondContact OD2-CG 3.44Å; D78-K81 IonicContact OD2-NZ 2.74Å; D78-K81 PolarHBondContact OD2-NZ 3.13Å
79	V	76.4	Confident	81.4	Confident	94 Å²	94	92.6 Å²	92.6	57%	0.57	50%	0.5	S	S	*	.	S	Bend	trans	-79.3	-24.6	-178.6	-173.1	0	0	0	0	111.2	K17 M77	K17-V79 HydrophobicContact CB-CG2 4.26Å; K17-V79 HydrophobicContact CD-CG2 4.02Å; M77-V79 PolarHBondContact O-N 3.26Å
80	D	73.7	Confident	81.4	Confident	146 Å²	146	89.1 Å²	89.1	78%	0.781	49%	0.485	S	S	*	.	S	Bend	trans	-90.4	-16.5	-172.4	-63	-35.1	0	0	0	112.4	D78 P82	D78-D80 PolarHBondContact OD1-N 2.8Å; D80-P82 WeakPolarHBondContact O-CD 2.91Å
81	K	72.3	Confident	81.4	Confident	143 Å²	143	89 Å²	89	62%	0.622	49%	0.489	S	S	*	.	S	Bend	trans	-75.1	118.9	171.6	-82.3	-175.9	-173.7	102.6	0	109.9	D78 C83	D78-K81 HydrophobicContact CB-CB 4.29Å; D78-K81 HydrophobicContact CB-CD 4.3Å; D78-K81 HydrophobicContact CB-CG 4.32Å; D78-K81 PolarHBondContact OD1-N 2.79Å; D78-K81 WeakPolarHBondContact OD2-CD 3.28Å; D78-K81 WeakPolarHBondContact OD2-CE 3.44Å; D78-K81 WeakPolarHBondContact OD2-CG 3.44Å; D78-K81 IonicContact OD2-NZ 2.74Å; D78-K81 PolarHBondContact OD2-NZ 3.13Å; K81-C83 PolarHBondContact O-N 2.78Å
82	P	57.8	Low	81.3	Confident	108 Å²	108	91 Å²	91	70%	0.701	50%	0.498	S	S	*	.			trans	-60	117.7	169.6	25.3	-31	0	0	0	107.5	D80 D84	D80-P82 WeakPolarHBondContact O-CD 2.91Å; P82-D84 PolarHBondContact O-N 3.2Å
83	C	61	Low	81.2	Confident	98 Å²	98	94.6 Å²	94.6	66%	0.662	51%	0.509	S	S	*	.			trans	-67.1	106.5	167.1	-124.4	0	0	0	0	105.5	K81 T85	K81-C83 PolarHBondContact O-N 2.78Å; C83-T85 HydrophobicContact CB-CG2 3.82Å; C83-T85 PolarHBondContact O-N 2.93Å; C83-T85 PolarHBondContact O-OG1 2.85Å; C83-T85 VanDerWaalsContact O-OG1 3.1Å
84	D	56.9	Low	81.2	Confident	157 Å²	157	94 Å²	94	84%	0.84	50%	0.504	S	S	*	.			trans	-66.4	61.1	163.3	-78.4	-26.3	0	0	0	108.2	P82 I86	P82-D84 PolarHBondContact O-N 3.2Å; D84-I86 PolarHBondContact O-N 2.84Å
85	T	62.2	Low	81.2	Confident	75 Å²	75	92 Å²	92	46%	0.46	49%	0.494	S	S	.	.			trans	-80.9	109.2	-170.5	19.3	0	0	0	0	108.8	C83 L87	C83-T85 HydrophobicContact CB-CG2 3.82Å; C83-T85 PolarHBondContact O-N 2.93Å; C83-T85 PolarHBondContact O-OG1 2.85Å; C83-T85 VanDerWaalsContact O-OG1 3.1Å; T85-L87 HydrophobicContact CG2-CB 4.33Å; T85-L87 HydrophobicContact CG2-CD1 4.29Å; T85-L87 HydrophobicContact CG2-CG 4.44Å; T85-L87 PolarHBondContact O-N 2.9Å; T85-L87 VanDerWaalsContact O-N 3.1Å
86	I	76.7	Confident	81.2	Confident	144 Å²	144	94.2 Å²	94.2	74%	0.738	50%	0.497	S	S	*	.			trans	-59.3	-9.7	161.7	-58.3	166.4	0	0	0	111.2	D84	D84-I86 PolarHBondContact O-N 2.84Å
87	L	83.8	Confident	81.2	Confident	59 Å²	59	95.4 Å²	95.4	31%	0.309	50%	0.503	S	S	.	.	P	Polyproline II helix	trans	-85.1	130.1	-174.8	-59.3	175.4	0	0	0	111.9	K54 F56 T85	K54-L87 CarbonylContact O-C 3.6Å; K54-L87 VanDerWaalsContact O-CA 3.28Å; K54-L87 WeakPolarHBondContact O-CA 3.21Å; F56-L87 HydrophobicContact CD1-CB 3.73Å; F56-L87 HydrophobicContact CE1-CB 4.21Å; T85-L87 HydrophobicContact CG2-CB 4.33Å; T85-L87 HydrophobicContact CG2-CD1 4.29Å; T85-L87 HydrophobicContact CG2-CG 4.44Å; T85-L87 PolarHBondContact O-N 2.9Å; T85-L87 VanDerWaalsContact O-N 3.1Å
88	Q	86.6	Confident	81.3	Confident	123 Å²	123	95.3 Å²	95.3	58%	0.575	50%	0.502	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-90.5	127.4	177.2	-178.3	179.5	-14.8	0	0	110.8	K54 K55 F56 V90	K54-Q88 PolarHBondContact O-N 2.88Å; K55-Q88 CarbonylContact C-O 3.35Å; K55-Q88 VanDerWaalsContact CA-O 3.24Å; K55-Q88 WeakPolarHBondContact CA-O 3.27Å; K55-Q88 HydrophobicContact CG-CB 4.42Å; F56-Q88 WeakPolarHBondContact CD1-O 3.45Å; F56-Q88 PolarHBondContact N-O 3.28Å; Q88-V90 HydrophobicContact CG-CG1 4.42Å
89	Q	88.6	Confident	81.7	Confident	131 Å²	131	95.3 Å²	95.3	61%	0.612	50%	0.5	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.8	131.2	172.1	-167.5	174.5	0.2	0	0	110.3	F56	F56-Q89 HydrophobicContact CD1-CB 4.42Å; F56-Q89 HydrophobicContact CE1-CB 3.72Å; F56-Q89 HydrophobicContact CE1-CG 4.37Å; F56-Q89 HydrophobicContact CE2-CB 4.12Å; F56-Q89 HydrophobicContact CE2-CG 3.85Å; F56-Q89 HydrophobicContact CZ-CB 3.55Å; F56-Q89 HydrophobicContact CZ-CG 3.79Å; F56-Q89 WeakPolarHBondContact O-CA 3.28Å
90	V	92.4	Very high	82.3	Confident	18 Å²	18	98.6 Å²	98.6	11%	0.109	50%	0.502	C	S	.	.			trans	-126	171.4	177.1	-63.9	0	0	0	0	111.3	K55 F56 Q88 E94 I95	K55-V90 HydrophobicContact CB-CG1 4.18Å; K55-V90 HydrophobicContact CB-CG2 4.16Å; K55-V90 HydrophobicContact CD-CG1 3.84Å; K55-V90 HydrophobicContact CG-CG1 3.94Å; F56-V90 WeakPolarHBondContact O-CG2 3.31Å; F56-V90 PolarHBondContact O-N 3.23Å; Q88-V90 HydrophobicContact CG-CG1 4.42Å; V90-E94 HydrophobicContact CB-CB 4.48Å; V90-I95 HydrophobicContact CG2-CB 3.89Å; V90-I95 HydrophobicContact CG2-CD1 3.86Å; V90-I95 HydrophobicContact CG2-CG1 4.35Å
91	S	93.4	Very high	83.2	Confident	61 Å²	61	96.4 Å²	96.4	43%	0.427	49%	0.489	S	S	.	.			trans	-69.5	159.2	178.1	73.9	0	0	0	0	111.7	E93 E94 I95	S91-E93 VanDerWaalsContact C-N 3.27Å; S91-E93 PolarHBondContact O-N 2.9Å; S91-E94 PolarHBondContact O-N 2.82Å; S91-E94 WeakPolarHBondContact OG-CB 3.35Å; S91-E94 PolarHBondContact OG-N 3.08Å; S91-I95 PolarHBondContact O-N 3Å; S91-I95 VanDerWaalsContact O-N 3.08Å
92	I	91.1	Very high	84.1	Confident	74 Å²	74	94.5 Å²	94.5	38%	0.379	48%	0.483	S	S	.	.	H	α-helix	trans	-61.6	-38.4	177.8	-62.7	170.8	0	0	0	110.8	I59 I95 L96	I59-I92 HydrophobicContact CD1-CG2 4.21Å; I59-I92 HydrophobicContact CG1-CG1 4.33Å; I59-I92 HydrophobicContact CG1-CG2 3.99Å; I92-I95 WeakPolarHBondContact O-CG2 3.32Å; I92-L96 HydrophobicContact CG2-CD1 3.7Å; I92-L96 HydrophobicContact CG2-CG 4.31Å; I92-L96 WeakPolarHBondContact O-CB 3.35Å; I92-L96 WeakPolarHBondContact O-CD1 3.42Å; I92-L96 WeakPolarHBondContact O-CG 3.39Å; I92-L96 PolarHBondContact O-N 2.91Å
93	E	91.5	Very high	85.5	Confident	164 Å²	164	94.7 Å²	94.7	77%	0.766	47%	0.474	S	S	*	.	H	α-helix	trans	-65.8	-46.6	-179.8	-64.7	176.1	179.4	0	0	111.2	S91 L96 E97	S91-E93 VanDerWaalsContact C-N 3.27Å; S91-E93 PolarHBondContact O-N 2.9Å; E93-L96 PolarHBondContact O-N 2.88Å; E93-E97 PolarHBondContact O-N 3.17Å; E93-E97 VanDerWaalsContact O-N 3.14Å
94	E	92.1	Very high	87	Confident	74 Å²	74	93.8 Å²	93.8	35%	0.346	46%	0.461	S	S	.	.	H	α-helix	trans	-63.9	-45.8	-179.9	-172.4	-178.8	165.2	0	0	111.6	K55 V90 S91 L96 E97 E98	K55-E94 IonicContact NZ-OE1 3.63Å; K55-E94 PolarHBondContact NZ-OE1 3.18Å; V90-E94 HydrophobicContact CB-CB 4.48Å; S91-E94 PolarHBondContact O-N 2.82Å; S91-E94 WeakPolarHBondContact OG-CB 3.35Å; S91-E94 PolarHBondContact OG-N 3.08Å; E94-L96 VanDerWaalsContact C-N 3.33Å; E94-L96 PolarHBondContact O-N 3.41Å; E94-E97 PolarHBondContact O-N 3.1Å; E94-E98 WeakPolarHBondContact O-CG 3.37Å; E94-E98 PolarHBondContact O-N 2.72Å
95	I	92.6	Very high	88.6	Confident	0 Å²	0	88.7 Å²	88.7	0%	0	44%	0.44	C	S	.	.	H	α-helix	trans	-66.9	-34.8	-178.3	-159.3	66.9	0	0	0	112.4	I50 V52 K55 V90 S91 I92 Q99	I50-I95 HydrophobicContact CB-CG1 3.84Å; I50-I95 HydrophobicContact CB-CG2 4.4Å; I50-I95 HydrophobicContact CD1-CG2 4.23Å; I50-I95 HydrophobicContact CG2-CG1 3.68Å; V52-I95 HydrophobicContact CB-CD1 3.87Å; V52-I95 HydrophobicContact CG2-CD1 3.72Å; V52-I95 HydrophobicContact CG2-CG1 4.23Å; K55-I95 HydrophobicContact CB-CD1 4.21Å; V90-I95 HydrophobicContact CG2-CB 3.89Å; V90-I95 HydrophobicContact CG2-CD1 3.86Å; V90-I95 HydrophobicContact CG2-CG1 4.35Å; S91-I95 PolarHBondContact O-N 3Å; S91-I95 VanDerWaalsContact O-N 3.08Å; I92-I95 WeakPolarHBondContact O-CG2 3.32Å; I95-Q99 VanDerWaalsContact O-CB 3.24Å; I95-Q99 WeakPolarHBondContact O-CB 3.44Å; I95-Q99 PolarHBondContact O-N 2.88Å
96	L	91.3	Very high	89.9	Confident	76 Å²	76	91.4 Å²	91.4	40%	0.398	45%	0.445	S	S	.	.	H	α-helix	trans	-69.6	-38.9	178.8	-74.5	172.6	0	0	0	111.3	I50 I59 I92 E93 E94 R100	I50-L96 HydrophobicContact CD1-CD2 3.72Å; I59-L96 HydrophobicContact CD1-CD2 4.26Å; I92-L96 HydrophobicContact CG2-CD1 3.7Å; I92-L96 HydrophobicContact CG2-CG 4.31Å; I92-L96 WeakPolarHBondContact O-CB 3.35Å; I92-L96 WeakPolarHBondContact O-CD1 3.42Å; I92-L96 WeakPolarHBondContact O-CG 3.39Å; I92-L96 PolarHBondContact O-N 2.91Å; E93-L96 PolarHBondContact O-N 2.88Å; E94-L96 VanDerWaalsContact C-N 3.33Å; E94-L96 PolarHBondContact O-N 3.41Å; L96-R100 WeakPolarHBondContact O-CB 3.38Å; L96-R100 PolarHBondContact O-N 2.83Å
97	E	92.2	Very high	90.4	Very high	134 Å²	134	88.7 Å²	88.7	63%	0.626	43%	0.43	S	S	*	.	H	α-helix	trans	-65.3	-47.3	174.7	-172.9	170.3	-166.4	0	0	111.2	E93 E94 Q99 R100 L101	E93-E97 PolarHBondContact O-N 3.17Å; E93-E97 VanDerWaalsContact O-N 3.14Å; E94-E97 PolarHBondContact O-N 3.1Å; E97-Q99 PolarHBondContact O-N 3.06Å; E97-R100 PolarHBondContact O-N 3.03Å; E97-L101 HydrophobicContact CG-CD1 4.48Å; E97-L101 WeakPolarHBondContact O-CG 3.41Å; E97-L101 PolarHBondContact O-N 2.91Å
98	E	90.9	Very high	90.8	Very high	53 Å²	53	92 Å²	92	25%	0.248	44%	0.444	C	S	.	.	H	α-helix	trans	-61.5	-42.1	176.9	-72.2	-167	168.6	0	0	112.4	V52 K55 E94 R100 L101 Q102	V52-E98 HydrophobicContact CB-CB 4.34Å; V52-E98 HydrophobicContact CG1-CB 3.98Å; V52-E98 HydrophobicContact CG2-CB 4.37Å; K55-E98 WeakPolarHBondContact CD-OE1 3.36Å; K55-E98 VanDerWaalsContact CD-OE2 3.31Å; K55-E98 WeakPolarHBondContact CD-OE2 3.13Å; K55-E98 IonicContact NZ-OE1 2.71Å; K55-E98 PolarHBondContact NZ-OE1 3.37Å; E94-E98 WeakPolarHBondContact O-CG 3.37Å; E94-E98 PolarHBondContact O-N 2.72Å; E98-R100 VanDerWaalsContact C-N 3.33Å; E98-R100 PolarHBondContact O-N 2.79Å; E98-L101 PolarHBondContact O-N 2.92Å; E98-Q102 WeakPolarHBondContact O-CB 3.43Å; E98-Q102 PolarHBondContact O-N 2.91Å
99	Q	91.5	Very high	91	Very high	69 Å²	69	90.7 Å²	90.7	32%	0.322	44%	0.444	S	S	.	.	H	α-helix	trans	-60.9	-43.4	176.6	-175.2	-176.5	23.5	0	0	111.1	I50 V52 I95 E97 Q102 Q103	I50-Q99 HydrophobicContact CG2-CB 4.2Å; I50-Q99 HydrophobicContact CG2-CG 4.2Å; V52-Q99 HydrophobicContact CG2-CB 4.03Å; I95-Q99 VanDerWaalsContact O-CB 3.24Å; I95-Q99 WeakPolarHBondContact O-CB 3.44Å; I95-Q99 PolarHBondContact O-N 2.88Å; E97-Q99 PolarHBondContact O-N 3.06Å; Q99-Q102 PolarHBondContact O-N 2.83Å; Q99-Q103 WeakPolarHBondContact O-CB 3.48Å; Q99-Q103 PolarHBondContact O-N 3.44Å
100	R	90.8	Very high	90.9	Very high	163 Å²	163	89.1 Å²	89.1	62%	0.615	44%	0.437	S	S	*	.	H	α-helix	trans	-62	-45.4	178.1	177.6	-178.4	150.3	178.3	-8.6	111.4	L96 E97 E98 Q103 Q104	L96-R100 WeakPolarHBondContact O-CB 3.38Å; L96-R100 PolarHBondContact O-N 2.83Å; E97-R100 PolarHBondContact O-N 3.03Å; E98-R100 VanDerWaalsContact C-N 3.33Å; E98-R100 PolarHBondContact O-N 2.79Å; R100-Q103 PolarHBondContact O-N 3.48Å; R100-Q104 WeakPolarHBondContact O-CG 3.42Å; R100-Q104 PolarHBondContact O-N 3.41Å
101	L	91.9	Very high	90.7	Very high	100 Å²	100	95 Å²	95	52%	0.524	46%	0.46	S	S	.	.	H	α-helix	trans	-62.3	-43.7	177.2	-69.9	171.8	0	0	0	111.5	E97 E98 Q103 Q104 A105	E97-L101 HydrophobicContact CG-CD1 4.48Å; E97-L101 WeakPolarHBondContact O-CG 3.41Å; E97-L101 PolarHBondContact O-N 2.91Å; E98-L101 PolarHBondContact O-N 2.92Å; L101-Q103 VanDerWaalsContact C-N 3.35Å; L101-Q103 PolarHBondContact O-N 3.29Å; L101-Q104 PolarHBondContact O-N 2.78Å; L101-A105 PolarHBondContact O-N 2.86Å
102	Q	90.2	Very high	90.6	Very high	103 Å²	103	96.5 Å²	96.5	48%	0.481	47%	0.467	S	S	.	.	H	α-helix	trans	-62.4	-41.6	177.4	-170.2	-177.5	28.7	0	0	112	E98 Q99 A105 K106	E98-Q102 WeakPolarHBondContact O-CB 3.43Å; E98-Q102 PolarHBondContact O-N 2.91Å; Q99-Q102 PolarHBondContact O-N 2.83Å; Q102-A105 PolarHBondContact O-N 2.98Å; Q102-K106 VanDerWaalsContact O-CB 3.32Å; Q102-K106 WeakPolarHBondContact O-CB 3.48Å; Q102-K106 PolarHBondContact O-N 2.88Å
103	Q	87.9	Confident	90.5	Very high	112 Å²	112	99.2 Å²	99.2	52%	0.523	48%	0.476	S	S	.	.	H	α-helix	trans	-66.7	-40.4	179	-168.2	176.2	10.4	0	0	111.7	Q99 R100 L101 K106 Q107	Q99-Q103 WeakPolarHBondContact O-CB 3.48Å; Q99-Q103 PolarHBondContact O-N 3.44Å; R100-Q103 PolarHBondContact O-N 3.48Å; L101-Q103 VanDerWaalsContact C-N 3.35Å; L101-Q103 PolarHBondContact O-N 3.29Å; Q103-K106 PolarHBondContact O-N 3.02Å; Q103-Q107 WeakPolarHBondContact O-CB 3.34Å; Q103-Q107 VanDerWaalsContact O-CG 3.26Å; Q103-Q107 WeakPolarHBondContact O-CG 3.13Å; Q103-Q107 PolarHBondContact O-N 2.83Å
104	Q	91.8	Very high	90.3	Very high	80 Å²	80	96.2 Å²	96.2	37%	0.374	46%	0.463	S	S	.	.	H	α-helix	trans	-62.2	-49.2	175	-72.5	178.7	-12.5	0	0	111.4	R100 L101 K106 Q107 E108	R100-Q104 WeakPolarHBondContact O-CG 3.42Å; R100-Q104 PolarHBondContact O-N 3.41Å; L101-Q104 PolarHBondContact O-N 2.78Å; Q104-K106 VanDerWaalsContact C-N 3.31Å; Q104-K106 PolarHBondContact O-N 3.05Å; Q104-Q107 PolarHBondContact O-N 2.64Å; Q104-E108 WeakPolarHBondContact O-CG 3.39Å; Q104-E108 PolarHBondContact O-N 3.1Å
105	A	91.6	Very high	90.1	Very high	49 Å²	49	98.9 Å²	98.9	41%	0.405	48%	0.476	S	S	.	.	H	α-helix	trans	-61.1	-39.3	177.7	0	0	0	0	0	112.4	L101 Q102 T109	L101-A105 PolarHBondContact O-N 2.86Å; Q102-A105 PolarHBondContact O-N 2.98Å; A105-T109 WeakPolarHBondContact O-CB 3.49Å; A105-T109 PolarHBondContact O-N 2.69Å; A105-T109 PolarHBondContact O-OG1 3.41Å
106	K	88.7	Confident	90	Very high	132 Å²	132	102 Å²	102	57%	0.574	50%	0.495	S	S	*	.	H	α-helix	trans	-64.8	-44.6	175.9	-172.5	176.7	174.7	-175	0	111.2	Q102 Q103 Q104 E108 T109 E110	Q102-K106 VanDerWaalsContact O-CB 3.32Å; Q102-K106 WeakPolarHBondContact O-CB 3.48Å; Q102-K106 PolarHBondContact O-N 2.88Å; Q103-K106 PolarHBondContact O-N 3.02Å; Q104-K106 VanDerWaalsContact C-N 3.31Å; Q104-K106 PolarHBondContact O-N 3.05Å; K106-E108 PolarHBondContact O-N 3.23Å; K106-T109 PolarHBondContact O-N 2.8Å; K106-E110 WeakPolarHBondContact CE-OE1 3.44Å; K106-E110 HydrophobicContact CG-CG 4.39Å; K106-E110 WeakPolarHBondContact O-CB 3.39Å; K106-E110 VanDerWaalsContact O-CG 3.29Å; K106-E110 WeakPolarHBondContact O-CG 3.32Å; K106-E110 PolarHBondContact O-N 3.47Å
107	Q	88.6	Confident	89.9	Confident	88 Å²	88	100 Å²	100	41%	0.411	49%	0.485	S	S	.	.	H	α-helix	trans	-62.4	-41.5	177.4	-75.2	176.2	11.5	0	0	112.5	Q103 Q104 E110 K111	Q103-Q107 WeakPolarHBondContact O-CB 3.34Å; Q103-Q107 VanDerWaalsContact O-CG 3.26Å; Q103-Q107 WeakPolarHBondContact O-CG 3.13Å; Q103-Q107 PolarHBondContact O-N 2.83Å; Q104-Q107 PolarHBondContact O-N 2.64Å; Q107-E110 PolarHBondContact O-N 2.83Å; Q107-K111 VanDerWaalsContact O-CG 3.25Å; Q107-K111 WeakPolarHBondContact O-CG 3.19Å; Q107-K111 PolarHBondContact O-N 2.77Å
108	E	91.4	Very high	89.7	Confident	129 Å²	129	101.5 Å²	101.5	60%	0.603	49%	0.489	S	S	*	.	H	α-helix	trans	-63.5	-46.3	176.2	-72	175.8	179.3	0	0	111.3	Q104 K106 E110 K111 V112	Q104-E108 WeakPolarHBondContact O-CG 3.39Å; Q104-E108 PolarHBondContact O-N 3.1Å; K106-E108 PolarHBondContact O-N 3.23Å; E108-E110 VanDerWaalsContact C-N 3.34Å; E108-E110 PolarHBondContact O-N 3.07Å; E108-K111 PolarHBondContact O-N 3.33Å; E108-V112 WeakPolarHBondContact O-CG2 3.5Å; E108-V112 PolarHBondContact O-N 3.48Å; E108-V112 VanDerWaalsContact O-N 3.09Å
109	T	89.9	Confident	89.8	Confident	94 Å²	94	104.9 Å²	104.9	58%	0.577	51%	0.509	S	S	*	.	H	α-helix	trans	-63.3	-41	177.9	-52.8	0	0	0	0	111.6	A105 K106 V112 K113	A105-T109 WeakPolarHBondContact O-CB 3.49Å; A105-T109 PolarHBondContact O-N 2.69Å; A105-T109 PolarHBondContact O-OG1 3.41Å; K106-T109 PolarHBondContact O-N 2.8Å; T109-V112 PolarHBondContact O-N 2.93Å; T109-K113 WeakPolarHBondContact O-CB 3.35Å; T109-K113 PolarHBondContact O-N 3.09Å
110	E	87.9	Confident	89.8	Confident	99 Å²	99	110.6 Å²	110.6	46%	0.463	53%	0.527	S	S	.	.	H	α-helix	trans	-65.7	-39.8	177.3	-78.3	178.1	174.1	0	0	112.2	K106 Q107 E108 K113 M114	K106-E110 WeakPolarHBondContact CE-OE1 3.44Å; K106-E110 HydrophobicContact CG-CG 4.39Å; K106-E110 WeakPolarHBondContact O-CB 3.39Å; K106-E110 VanDerWaalsContact O-CG 3.29Å; K106-E110 WeakPolarHBondContact O-CG 3.32Å; K106-E110 PolarHBondContact O-N 3.47Å; Q107-E110 PolarHBondContact O-N 2.83Å; E108-E110 VanDerWaalsContact C-N 3.34Å; E108-E110 PolarHBondContact O-N 3.07Å; E110-K113 PolarHBondContact O-N 3.44Å; E110-M114 WeakPolarHBondContact O-CB 3.46Å; E110-M114 PolarHBondContact O-N 2.74Å
111	K	88.4	Confident	89.7	Confident	140 Å²	140	106.2 Å²	106.2	61%	0.609	53%	0.532	S	S	*	.	H	α-helix	trans	-61.1	-47.3	174.5	-75.2	169.8	-176.2	175.6	0	111.5	Q107 E108 M114 Q115	Q107-K111 VanDerWaalsContact O-CG 3.25Å; Q107-K111 WeakPolarHBondContact O-CG 3.19Å; Q107-K111 PolarHBondContact O-N 2.77Å; E108-K111 PolarHBondContact O-N 3.33Å; K111-M114 PolarHBondContact O-N 3.08Å; K111-Q115 PolarHBondContact O-N 3.13Å
112	V	90.9	Very high	89.6	Confident	94 Å²	94	106.5 Å²	106.5	57%	0.57	53%	0.534	S	S	*	.	H	α-helix	trans	-62.4	-46.9	177.8	175	0	0	0	0	110.5	E108 T109 M114 Q115 V116	E108-V112 WeakPolarHBondContact O-CG2 3.5Å; E108-V112 PolarHBondContact O-N 3.48Å; E108-V112 VanDerWaalsContact O-N 3.09Å; T109-V112 PolarHBondContact O-N 2.93Å; V112-M114 VanDerWaalsContact C-N 3.33Å; V112-M114 PolarHBondContact O-N 3.35Å; V112-Q115 PolarHBondContact O-N 3.02Å; V112-V116 WeakPolarHBondContact O-CG2 3.36Å; V112-V116 PolarHBondContact O-N 3.09Å
113	K	88.1	Confident	89.2	Confident	130 Å²	130	107 Å²	107	57%	0.565	55%	0.549	S	S	*	.	H	α-helix	trans	-61	-42.1	178	-172.8	178.5	179.2	-178.1	0	111.7	T109 E110 V116 L117	T109-K113 WeakPolarHBondContact O-CB 3.35Å; T109-K113 PolarHBondContact O-N 3.09Å; E110-K113 PolarHBondContact O-N 3.44Å; K113-V116 PolarHBondContact O-N 2.98Å; K113-L117 HydrophobicContact CG-CD1 4.02Å; K113-L117 WeakPolarHBondContact O-CB 3.35Å; K113-L117 VanDerWaalsContact O-CG 3.23Å; K113-L117 WeakPolarHBondContact O-CG 3.4Å; K113-L117 PolarHBondContact O-N 3.37Å
114	M	86.6	Confident	88.7	Confident	101 Å²	101	107 Å²	107	50%	0.498	55%	0.551	S	S	.	*	H	α-helix	trans	-64.4	-41.1	178.4	-173.8	178.8	-67.4	0	0	111.6	E110 K111 V112 L117 K118	E110-M114 WeakPolarHBondContact O-CB 3.46Å; E110-M114 PolarHBondContact O-N 2.74Å; K111-M114 PolarHBondContact O-N 3.08Å; V112-M114 VanDerWaalsContact C-N 3.33Å; V112-M114 PolarHBondContact O-N 3.35Å; M114-L117 PolarHBondContact O-N 3.43Å; M114-K118 WeakPolarHBondContact O-CB 2.98Å; M114-K118 PolarHBondContact O-N 2.9Å
115	Q	88.4	Confident	87.8	Confident	131 Å²	131	108.8 Å²	108.8	61%	0.612	57%	0.57	S	S	*	*	H	α-helix	trans	-62.7	-48.7	176.2	-173.2	170	-6.9	0	0	111.3	K111 V112 L117 K118 D119	K111-Q115 PolarHBondContact O-N 3.13Å; V112-Q115 PolarHBondContact O-N 3.02Å; Q115-L117 VanDerWaalsContact C-N 3.3Å; Q115-L117 PolarHBondContact O-N 3.08Å; Q115-K118 PolarHBondContact O-N 3.42Å; Q115-D119 VanDerWaalsContact O-CG 3.25Å; Q115-D119 PolarHBondContact O-N 2.78Å
116	V	90.9	Very high	86.5	Confident	64 Å²	64	112.5 Å²	112.5	39%	0.388	58%	0.577	S	S	.	*	H	α-helix	trans	-61.2	-37.9	178.3	173.5	0	0	0	0	112.3	V112 K113 R120	V112-V116 WeakPolarHBondContact O-CG2 3.36Å; V112-V116 PolarHBondContact O-N 3.09Å; K113-V116 PolarHBondContact O-N 2.98Å; V116-R120 WeakPolarHBondContact O-CG 3.3Å; V116-R120 PolarHBondContact O-N 3.23Å
117	L	89.3	Confident	85.1	Confident	36 Å²	36	110.1 Å²	110.1	19%	0.188	58%	0.582	C	S	.	*	H	α-helix	trans	-69.8	-40.4	177.1	-72.5	169.9	0	0	0	111.9	K113 M114 Q115 D119 R120 G121 L122 I124	K113-L117 HydrophobicContact CG-CD1 4.02Å; K113-L117 WeakPolarHBondContact O-CB 3.35Å; K113-L117 VanDerWaalsContact O-CG 3.23Å; K113-L117 WeakPolarHBondContact O-CG 3.4Å; K113-L117 PolarHBondContact O-N 3.37Å; M114-L117 PolarHBondContact O-N 3.43Å; Q115-L117 VanDerWaalsContact C-N 3.3Å; Q115-L117 PolarHBondContact O-N 3.08Å; L117-D119 VanDerWaalsContact C-N 3.33Å; L117-D119 PolarHBondContact O-N 3.32Å; L117-R120 CarbonylContact O-C 3.44Å; L117-R120 WeakPolarHBondContact O-CA 3.36Å; L117-R120 WeakPolarHBondContact O-CB 3.42Å; L117-R120 PolarHBondContact O-N 3.45Å; L117-G121 PolarHBondContact O-N 3.43Å; L117-L122 CarbonylContact C-O 3.55Å; L117-L122 HydrophobicContact CB-CB 4.32Å; L117-L122 HydrophobicContact CD2-CB 4.29Å; L117-L122 HydrophobicContact CD2-CD1 3.93Å; L117-L122 PolarHBondContact O-N 3.09Å; L117-I124 HydrophobicContact CD1-CD1 3.31Å; L117-I124 HydrophobicContact CD1-CG1 3.95Å
118	K	88.7	Confident	83.4	Confident	164 Å²	164	112.3 Å²	112.3	71%	0.713	60%	0.596	S	S	*	*	H	α-helix	trans	-62.4	-41.9	176.4	-171.9	-179.6	179.6	-176.7	0	111.5	M114 Q115 R120 G121	M114-K118 WeakPolarHBondContact O-CB 2.98Å; M114-K118 PolarHBondContact O-N 2.9Å; Q115-K118 PolarHBondContact O-N 3.42Å; K118-R120 PolarHBondContact O-N 3.08Å; K118-G121 PolarHBondContact O-N 3.32Å
119	D	91.4	Very high	81	Confident	125 Å²	125	111.6 Å²	111.6	67%	0.668	60%	0.597	S	S	*	*	H	α-helix	trans	-62.4	-24.5	175.7	-65.4	-17.3	0	0	0	112.1	Q115 L117	Q115-D119 VanDerWaalsContact O-CG 3.25Å; Q115-D119 PolarHBondContact O-N 2.78Å; L117-D119 VanDerWaalsContact C-N 3.33Å; L117-D119 PolarHBondContact O-N 3.32Å
120	R	92.8	Very high	78.8	Confident	189 Å²	189	113.9 Å²	113.9	71%	0.713	61%	0.605	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.4	6.4	174.5	-65.7	178.1	-178.2	-162.1	0.5	113.8	V116 L117 K118 L122	V116-R120 WeakPolarHBondContact O-CG 3.3Å; V116-R120 PolarHBondContact O-N 3.23Å; L117-R120 CarbonylContact O-C 3.44Å; L117-R120 WeakPolarHBondContact O-CA 3.36Å; L117-R120 WeakPolarHBondContact O-CB 3.42Å; L117-R120 PolarHBondContact O-N 3.45Å; K118-R120 PolarHBondContact O-N 3.08Å; R120-L122 VanDerWaalsContact C-N 3.29Å; R120-L122 PolarHBondContact O-N 2.95Å
121	G	88.8	Confident	76.7	Confident	70 Å²	70	116.2 Å²	116.2	72%	0.722	62%	0.62	S	S	*	*	T	Hydrogen-bonded Turn	trans	73.1	15.8	-179.5	0	0	0	0	0	114.7	L117 K118	L117-G121 PolarHBondContact O-N 3.43Å; K118-G121 PolarHBondContact O-N 3.32Å
122	L	88.8	Confident	74.1	Confident	106 Å²	106	117.5 Å²	117.5	56%	0.555	63%	0.629	S	S	*	*			trans	-100.6	129.2	177.9	-64.3	173	0	0	0	110.5	L117 R120	L117-L122 CarbonylContact C-O 3.55Å; L117-L122 HydrophobicContact CB-CB 4.32Å; L117-L122 HydrophobicContact CD2-CB 4.29Å; L117-L122 HydrophobicContact CD2-CD1 3.93Å; L117-L122 PolarHBondContact O-N 3.09Å; R120-L122 VanDerWaalsContact C-N 3.29Å; R120-L122 PolarHBondContact O-N 2.95Å
123	S	82.5	Confident	71.4	Confident	113 Å²	113	127.4 Å²	127.4	79%	0.79	66%	0.658	S	S	*	*			trans	-111.4	125.3	172.7	57.7	0	0	0	0	110.7
124	I	77.2	Confident	70.6	Confident	112 Å²	112	127.3 Å²	127.3	57%	0.574	66%	0.662	S	S	*	*	P	Polyproline II helix	trans	-89.2	121.4	169.5	-59.9	175.5	0	0	0	107.6	L117 K126	L117-I124 HydrophobicContact CD1-CD1 3.31Å; L117-I124 HydrophobicContact CD1-CG1 3.95Å; I124-K126 PolarHBondContact O-N 3.07Å
125	P	72.6	Confident	69.8	Low	118 Å²	118	128.7 Å²	128.7	77%	0.766	67%	0.671	S	S	*	*	P	Polyproline II helix	trans	-62.4	129.8	172.7	25.1	-31	0	0	0	109.4
126	K	65.5	Low	68.7	Low	127 Å²	127	128.6 Å²	128.6	55%	0.552	67%	0.674	S	S	*	*	P	Polyproline II helix	trans	-72.9	138.5	172.6	-72	-174.1	175.9	-176.7	0	109.1	I124 D128 N129	I124-K126 PolarHBondContact O-N 3.07Å; K126-D128 PolarHBondContact O-N 3.45Å; K126-N129 PolarHBondContact O-N 3.47Å
127	A	58.3	Low	67.4	Low	82 Å²	82	132.4 Å²	132.4	68%	0.678	69%	0.691	S	S	*	*	G	3₁₀ helix	trans	-62.2	-22.5	179	0	0	0	0	0	113.3	N129	A127-N129 PolarHBondContact O-N 3.03Å
128	D	54	Low	66.1	Low	134 Å²	134	138.4 Å²	138.4	72%	0.717	72%	0.723	S	S	*	*	G	3₁₀ helix	trans	-71.8	-9.1	180	-57.7	-26.1	0	0	0	113.9	K126 L130	K126-D128 PolarHBondContact O-N 3.45Å; D128-L130 VanDerWaalsContact C-N 3.31Å; D128-L130 PolarHBondContact O-N 3.13Å
129	N	40.8	Very low	64.5	Low	115 Å²	115	136.7 Å²	136.7	62%	0.615	72%	0.723	S	S	*	*	G	3₁₀ helix	trans	-89.6	15.2	-179.3	-71.3	1.9	0	0	0	113.8	K126 A127	K126-N129 PolarHBondContact O-N 3.47Å; A127-N129 PolarHBondContact O-N 3.03Å
130	L	43.6	Very low	62.6	Low	142 Å²	142	137.5 Å²	137.5	74%	0.743	73%	0.727	S	S	*	*	G	3₁₀ helix	trans	-93.9	-5.6	179	-81.1	156.6	0	0	0	113.8	D128	D128-L130 VanDerWaalsContact C-N 3.31Å; D128-L130 PolarHBondContact O-N 3.13Å
131	D	42.9	Very low	60.3	Low	147 Å²	147	133.5 Å²	133.5	79%	0.786	73%	0.728	S	S	*	*	S	Bend	trans	-100.4	4.2	-179.1	-65.4	-23.7	0	0	0	113.7
132	E	33.4	Very low	57.9	Low	168 Å²	168	138.8 Å²	138.8	79%	0.785	73%	0.729	S	S	*	*			trans	-106.8	66.6	172	-75.9	-171.1	164.8	0	0	111.2
133	Y	35.6	Very low	55.1	Low	302 Å²	302	141.8 Å²	141.8	100%	1.184	75%	0.745	S	S	*	*			trans	-149.5	0	157.7	-94.5	-74.4	0	0	0	111.5

Retrieved 133 of 133 residues in 180 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).