A0A087YDU2_POEFO Loading...

Mitochondrial import inner membrane translocase subunit

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

AlphaFold DB (A0A3B3VJU5), UniProt , Accession A0A087YDU2, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 89 aa.

						>A0A087YDU2_POEFO|A0A087YDU2
MDSFDNLSASEKAEASELQKMIAIEQQKAQFQAQVHSFTDVCWDKCVDSPGSKLDYRTETCLQNCVERFIDTTLTITNRFTQMVQKGTH
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53	Low	71.7	Confident	223 Å²	223	115.2 Å²	115.2	100%	1.099	65%	0.649	S	S	*	*				0	61.7	0	-173.7	154.8	94.4	0	0	106.3
2	D	54.1	Low	72.9	Confident	135 Å²	135	113.3 Å²	113.3	72%	0.722	63%	0.628	S	S	*	*			trans	-139.5	22.7	-157.6	-49.7	-69.3	0	0	0	113.1
3	S	60.5	Low	74	Confident	109 Å²	109	109.5 Å²	109.5	76%	0.762	62%	0.621	S	S	*	*	S	Bend	trans	-89.1	-2.6	-177.3	-153.3	0	0	0	0	114.2
4	F	60.6	Low	75.2	Confident	142 Å²	142	111.1 Å²	111.1	62%	0.623	62%	0.621	S	S	*	*	S	Bend	trans	-98.4	-11.3	-175.1	-75.7	-83.8	0	0	0	114.4	N6 L7 K12 A15	F4-N6 PolarHBondContact O-N 2.85Å; F4-L7 HydrophobicContact CB-CD1 4.22Å; F4-L7 HydrophobicContact CD1-CD1 3.48Å; F4-L7 VanDerWaalsContact CD1-CD1 3.48Å; F4-L7 HydrophobicContact CE1-CD1 4.24Å; F4-L7 HydrophobicContact CG-CD1 4.22Å; F4-K12 WeakPolarHBondContact O-CE 3.29Å; F4-A15 HydrophobicContact CE1-CB 4.4Å
5	D	68.2	Low	76.2	Confident	129 Å²	129	105.7 Å²	105.7	69%	0.69	60%	0.596	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.2	-25.6	-173.8	-87.6	-39.5	0	0	0	113.9	L7 K12	D5-L7 PolarHBondContact O-N 3.06Å; D5-K12 PolarHBondContact O-NZ 3.33Å
6	N	74.6	Confident	77.1	Confident	166 Å²	166	102.6 Å²	102.6	89%	0.888	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.3	12.2	-177.1	-153.4	15.6	0	0	0	114.6	F4	F4-N6 PolarHBondContact O-N 2.85Å
7	L	75.3	Confident	78.1	Confident	51 Å²	51	101.9 Å²	101.9	27%	0.267	57%	0.574	S	S	.	*	S	Bend	trans	-84.6	142.3	177.7	-70.6	157.5	0	0	0	110.9	F4 D5 E11 K12	F4-L7 HydrophobicContact CB-CD1 4.22Å; F4-L7 HydrophobicContact CD1-CD1 3.48Å; F4-L7 VanDerWaalsContact CD1-CD1 3.48Å; F4-L7 HydrophobicContact CE1-CD1 4.24Å; F4-L7 HydrophobicContact CG-CD1 4.22Å; D5-L7 PolarHBondContact O-N 3.06Å; L7-E11 HydrophobicContact CB-CB 4.01Å; L7-E11 HydrophobicContact CD2-CB 3.7Å; L7-E11 HydrophobicContact CD2-CG 4.23Å; L7-E11 HydrophobicContact CG-CB 4.39Å; L7-K12 HydrophobicContact CB-CG 3.84Å; L7-K12 VanDerWaalsContact O-CE 3.25Å; L7-K12 WeakPolarHBondContact O-CE 3.35Å
8	S	85.6	Confident	79	Confident	58 Å²	58	101.4 Å²	101.4	41%	0.406	57%	0.569	S	S	.	*			trans	-61	158.6	169.5	69.8	0	0	0	0	111.1	S10 E11 K12	S8-S10 PolarHBondContact O-N 3.27Å; S8-S10 VanDerWaalsContact O-N 3.16Å; S8-E11 VanDerWaalsContact CB-OE2 3.23Å; S8-E11 WeakPolarHBondContact CB-OE2 3.47Å; S8-E11 PolarHBondContact N-OE2 3.45Å; S8-E11 PolarHBondContact O-N 3.38Å; S8-E11 VanDerWaalsContact O-N 3.12Å; S8-E11 WeakPolarHBondContact OG-CG 3.37Å; S8-E11 PolarHBondContact OG-N 3.02Å; S8-E11 PolarHBondContact OG-OE2 3.37Å; S8-K12 PolarHBondContact O-N 3.49Å
9	A	84.1	Confident	79.8	Confident	88 Å²	88	103.6 Å²	103.6	73%	0.727	57%	0.574	S	S	*	*	H	α-helix	trans	-57.2	-31.8	178.7	0	0	0	0	0	112.8	A13	A9-A13 PolarHBondContact O-N 3.35Å
10	S	85.6	Confident	80.6	Confident	79 Å²	79	103.9 Å²	103.9	55%	0.552	57%	0.569	S	S	*	*	H	α-helix	trans	-67	-48.6	175.7	-166.6	0	0	0	0	111.5	S8 K12 A13 E14	S8-S10 PolarHBondContact O-N 3.27Å; S8-S10 VanDerWaalsContact O-N 3.16Å; S10-K12 VanDerWaalsContact C-N 3.31Å; S10-K12 PolarHBondContact O-N 2.97Å; S10-A13 WeakPolarHBondContact O-CB 3.5Å; S10-A13 PolarHBondContact O-N 3.08Å; S10-A13 VanDerWaalsContact O-N 3.1Å; S10-E14 PolarHBondContact O-N 3.37Å
11	E	86.9	Confident	81.4	Confident	87 Å²	87	103.5 Å²	103.5	41%	0.407	57%	0.565	S	S	.	*	H	α-helix	trans	-65.9	-33.7	-179.8	-67.8	162.1	124.3	0	0	112	L7 S8 A13 E14 A15	L7-E11 HydrophobicContact CB-CB 4.01Å; L7-E11 HydrophobicContact CD2-CB 3.7Å; L7-E11 HydrophobicContact CD2-CG 4.23Å; L7-E11 HydrophobicContact CG-CB 4.39Å; S8-E11 VanDerWaalsContact CB-OE2 3.23Å; S8-E11 WeakPolarHBondContact CB-OE2 3.47Å; S8-E11 PolarHBondContact N-OE2 3.45Å; S8-E11 PolarHBondContact O-N 3.38Å; S8-E11 VanDerWaalsContact O-N 3.12Å; S8-E11 WeakPolarHBondContact OG-CG 3.37Å; S8-E11 PolarHBondContact OG-N 3.02Å; S8-E11 PolarHBondContact OG-OE2 3.37Å; E11-A13 VanDerWaalsContact C-N 3.34Å; E11-E14 PolarHBondContact O-N 3.4Å; E11-A15 VanDerWaalsContact O-CB 3.27Å; E11-A15 WeakPolarHBondContact O-CB 3.19Å; E11-A15 PolarHBondContact O-N 3.17Å
12	K	86.1	Confident	83.5	Confident	92 Å²	92	96.6 Å²	96.6	40%	0.4	53%	0.531	S	S	.	.	H	α-helix	trans	-65	-38	172.6	-69.7	-177.8	-179.5	179.1	0	111.9	F4 D5 L7 S8 S10 S16	F4-K12 WeakPolarHBondContact O-CE 3.29Å; D5-K12 PolarHBondContact O-NZ 3.33Å; L7-K12 HydrophobicContact CB-CG 3.84Å; L7-K12 VanDerWaalsContact O-CE 3.25Å; L7-K12 WeakPolarHBondContact O-CE 3.35Å; S8-K12 PolarHBondContact O-N 3.49Å; S10-K12 VanDerWaalsContact C-N 3.31Å; S10-K12 PolarHBondContact O-N 2.97Å; K12-S16 WeakPolarHBondContact O-CB 3.45Å; K12-S16 PolarHBondContact O-N 3.42Å
13	A	87.1	Confident	85.5	Confident	64 Å²	64	92.3 Å²	92.3	53%	0.529	52%	0.515	S	S	.	.	H	α-helix	trans	-68.1	-43.2	176.4	0	0	0	0	0	111.7	A9 S10 E11 S16 E17	A9-A13 PolarHBondContact O-N 3.35Å; S10-A13 WeakPolarHBondContact O-CB 3.5Å; S10-A13 PolarHBondContact O-N 3.08Å; S10-A13 VanDerWaalsContact O-N 3.1Å; E11-A13 VanDerWaalsContact C-N 3.34Å; A13-S16 PolarHBondContact O-N 3.49Å; A13-E17 PolarHBondContact O-N 2.9Å
14	E	90.8	Very high	87.3	Confident	132 Å²	132	92 Å²	92	62%	0.617	50%	0.504	S	S	*	.	H	α-helix	trans	-64.8	-42.3	175.6	-69.3	-178.2	135.2	0	0	112.3	S10 E11 S16 E17 L18	S10-E14 PolarHBondContact O-N 3.37Å; E11-E14 PolarHBondContact O-N 3.4Å; E14-S16 VanDerWaalsContact C-N 3.34Å; E14-S16 PolarHBondContact O-N 3.36Å; E14-E17 PolarHBondContact O-N 3.29Å; E14-L18 WeakPolarHBondContact O-CB 3.41Å; E14-L18 PolarHBondContact O-N 3.01Å
15	A	90.8	Very high	89	Confident	30 Å²	30	90.4 Å²	90.4	25%	0.248	50%	0.498	C	S	.	.	H	α-helix	trans	-62.4	-40.6	176	0	0	0	0	0	112.1	F4 E11 L18 Q19	F4-A15 HydrophobicContact CE1-CB 4.4Å; E11-A15 VanDerWaalsContact O-CB 3.27Å; E11-A15 WeakPolarHBondContact O-CB 3.19Å; E11-A15 PolarHBondContact O-N 3.17Å; A15-L18 PolarHBondContact O-N 3.06Å; A15-Q19 WeakPolarHBondContact O-CB 3.31Å; A15-Q19 PolarHBondContact O-N 3.35Å
16	S	91.1	Very high	90.4	Very high	56 Å²	56	89.7 Å²	89.7	39%	0.392	49%	0.491	S	S	.	.	H	α-helix	trans	-62	-43	174.8	-179.3	0	0	0	0	111.7	K12 A13 E14 Q19 K20	K12-S16 WeakPolarHBondContact O-CB 3.45Å; K12-S16 PolarHBondContact O-N 3.42Å; A13-S16 PolarHBondContact O-N 3.49Å; E14-S16 VanDerWaalsContact C-N 3.34Å; E14-S16 PolarHBondContact O-N 3.36Å; S16-Q19 PolarHBondContact O-N 3.46Å; S16-K20 WeakPolarHBondContact O-CG 3.34Å; S16-K20 PolarHBondContact O-N 2.84Å; S16-K20 VanDerWaalsContact O-N 3.11Å
17	E	93.3	Very high	91.6	Very high	92 Å²	92	88.2 Å²	88.2	43%	0.43	48%	0.478	S	S	.	.	H	α-helix	trans	-67.2	-42.9	177.8	-168.9	56.2	-153.4	0	0	112.2	A13 E14 Q19 K20 M21	A13-E17 PolarHBondContact O-N 2.9Å; E14-E17 PolarHBondContact O-N 3.29Å; E17-Q19 VanDerWaalsContact C-N 3.3Å; E17-Q19 PolarHBondContact O-N 2.9Å; E17-K20 WeakPolarHBondContact O-CB 3.25Å; E17-K20 PolarHBondContact O-N 3.08Å; E17-K20 IonicContact OE2-NZ 2.84Å; E17-K20 PolarHBondContact OE2-NZ 2.91Å; E17-M21 WeakPolarHBondContact O-CG 3.45Å; E17-M21 PolarHBondContact O-N 2.75Å
18	L	94.4	Very high	92.7	Very high	92 Å²	92	91.3 Å²	91.3	48%	0.482	49%	0.489	S	S	.	.	H	α-helix	trans	-59	-41.9	173.2	179.1	60.2	0	0	0	111.8	E14 A15 K20 M21 I22	E14-L18 WeakPolarHBondContact O-CB 3.41Å; E14-L18 PolarHBondContact O-N 3.01Å; A15-L18 PolarHBondContact O-N 3.06Å; L18-K20 VanDerWaalsContact C-N 3.3Å; L18-K20 PolarHBondContact O-N 3.37Å; L18-M21 HydrophobicContact CB-CE 4.39Å; L18-M21 HydrophobicContact CD1-CE 3.96Å; L18-M21 PolarHBondContact O-N 2.66Å; L18-I22 HydrophobicContact CD1-CD1 4.15Å; L18-I22 HydrophobicContact CD1-CG1 4.26Å; L18-I22 HydrophobicContact CG-CD1 3.91Å; L18-I22 HydrophobicContact CG-CG1 4.45Å; L18-I22 VanDerWaalsContact O-CG1 3.31Å; L18-I22 WeakPolarHBondContact O-CG1 3.37Å; L18-I22 PolarHBondContact O-N 2.91Å
19	Q	94.4	Very high	93.3	Very high	144 Å²	144	91.4 Å²	91.4	67%	0.673	49%	0.494	S	S	*	.	H	α-helix	trans	-62.2	-38.3	177.6	-171.7	174.5	-1.9	0	0	111.9	A15 S16 E17 I22 A23	A15-Q19 WeakPolarHBondContact O-CB 3.31Å; A15-Q19 PolarHBondContact O-N 3.35Å; S16-Q19 PolarHBondContact O-N 3.46Å; E17-Q19 VanDerWaalsContact C-N 3.3Å; E17-Q19 PolarHBondContact O-N 2.9Å; Q19-I22 PolarHBondContact O-N 3.45Å; Q19-A23 WeakPolarHBondContact O-CB 3.43Å; Q19-A23 PolarHBondContact O-N 3.1Å
20	K	95.8	Very high	93.9	Very high	108 Å²	108	93.7 Å²	93.7	47%	0.47	49%	0.49	S	S	.	.	H	α-helix	trans	-65	-44.9	173.4	-66.1	177.5	-149.3	151.5	0	111.8	S16 E17 L18 I22 A23 I24	S16-K20 WeakPolarHBondContact O-CG 3.34Å; S16-K20 PolarHBondContact O-N 2.84Å; S16-K20 VanDerWaalsContact O-N 3.11Å; E17-K20 WeakPolarHBondContact O-CB 3.25Å; E17-K20 PolarHBondContact O-N 3.08Å; E17-K20 IonicContact OE2-NZ 2.84Å; E17-K20 PolarHBondContact OE2-NZ 2.91Å; L18-K20 VanDerWaalsContact C-N 3.3Å; L18-K20 PolarHBondContact O-N 3.37Å; K20-I22 VanDerWaalsContact C-N 3.32Å; K20-I22 PolarHBondContact O-N 3.06Å; K20-A23 PolarHBondContact O-N 3.19Å; K20-I24 WeakPolarHBondContact O-CG1 3.23Å; K20-I24 PolarHBondContact O-N 3.47Å
21	M	96.6	Very high	94.5	Very high	97 Å²	97	96.1 Å²	96.1	48%	0.478	49%	0.491	S	S	.	.	H	α-helix	trans	-59.6	-44.7	177.1	-69.3	-168.7	-69.8	0	0	111.3	E17 L18 A23 I24 E25	E17-M21 WeakPolarHBondContact O-CG 3.45Å; E17-M21 PolarHBondContact O-N 2.75Å; L18-M21 HydrophobicContact CB-CE 4.39Å; L18-M21 HydrophobicContact CD1-CE 3.96Å; L18-M21 PolarHBondContact O-N 2.66Å; M21-A23 VanDerWaalsContact C-N 3.33Å; M21-A23 PolarHBondContact O-N 2.89Å; M21-I24 PolarHBondContact O-N 3.37Å; M21-E25 WeakPolarHBondContact O-CG 3.27Å; M21-E25 PolarHBondContact O-N 3.03Å
22	I	97.4	Very high	95	Very high	78 Å²	78	96 Å²	96	40%	0.4	49%	0.49	S	S	.	.	H	α-helix	trans	-59.6	-44.4	175.9	-69.6	168.1	0	0	0	110.8	L18 Q19 K20 I24 E25 Q26	L18-I22 HydrophobicContact CD1-CD1 4.15Å; L18-I22 HydrophobicContact CD1-CG1 4.26Å; L18-I22 HydrophobicContact CG-CD1 3.91Å; L18-I22 HydrophobicContact CG-CG1 4.45Å; L18-I22 VanDerWaalsContact O-CG1 3.31Å; L18-I22 WeakPolarHBondContact O-CG1 3.37Å; L18-I22 PolarHBondContact O-N 2.91Å; Q19-I22 PolarHBondContact O-N 3.45Å; K20-I22 VanDerWaalsContact C-N 3.32Å; K20-I22 PolarHBondContact O-N 3.06Å; I22-I24 VanDerWaalsContact C-N 3.34Å; I22-I24 PolarHBondContact O-N 3.46Å; I22-E25 PolarHBondContact O-N 3.39Å; I22-Q26 HydrophobicContact CG2-CG 4.24Å; I22-Q26 WeakPolarHBondContact O-CB 3.4Å; I22-Q26 VanDerWaalsContact O-CG 3.25Å; I22-Q26 WeakPolarHBondContact O-CG 3.3Å; I22-Q26 PolarHBondContact O-N 3.38Å
23	A	96.6	Very high	95.6	Very high	45 Å²	45	94.4 Å²	94.4	37%	0.372	49%	0.494	S	S	.	.	H	α-helix	trans	-61.8	-41	179	0	0	0	0	0	112.3	Q19 K20 M21 Q26 Q27	Q19-A23 WeakPolarHBondContact O-CB 3.43Å; Q19-A23 PolarHBondContact O-N 3.1Å; K20-A23 PolarHBondContact O-N 3.19Å; M21-A23 VanDerWaalsContact C-N 3.33Å; M21-A23 PolarHBondContact O-N 2.89Å; A23-Q26 PolarHBondContact O-N 3.12Å; A23-Q27 WeakPolarHBondContact O-CG 3.3Å; A23-Q27 PolarHBondContact O-N 3.44Å
24	I	97.6	Very high	96.1	Very high	103 Å²	103	95.3 Å²	95.3	53%	0.528	49%	0.487	S	S	.	.	H	α-helix	trans	-64.4	-47.7	176.6	-67.9	165.4	0	0	0	110.8	K20 M21 I22 Q26 Q27 K28	K20-I24 WeakPolarHBondContact O-CG1 3.23Å; K20-I24 PolarHBondContact O-N 3.47Å; M21-I24 PolarHBondContact O-N 3.37Å; I22-I24 VanDerWaalsContact C-N 3.34Å; I22-I24 PolarHBondContact O-N 3.46Å; I24-Q26 VanDerWaalsContact C-N 3.31Å; I24-Q26 PolarHBondContact O-N 3.16Å; I24-Q27 PolarHBondContact O-N 3.48Å; I24-K28 PolarHBondContact O-N 2.93Å
25	E	97.8	Very high	96.5	Very high	108 Å²	108	91.3 Å²	91.3	51%	0.505	47%	0.472	S	S	.	.	H	α-helix	trans	-65.6	-35.3	179.4	-69.7	-58	152.3	0	0	112	M21 I22 K28 A29	M21-E25 WeakPolarHBondContact O-CG 3.27Å; M21-E25 PolarHBondContact O-N 3.03Å; I22-E25 PolarHBondContact O-N 3.39Å; E25-K28 PolarHBondContact O-N 3.28Å; E25-K28 IonicContact OE2-NZ 3.95Å; E25-A29 WeakPolarHBondContact O-CB 3.32Å; E25-A29 PolarHBondContact O-N 3.4Å
26	Q	97.8	Very high	96.8	Very high	114 Å²	114	95.3 Å²	95.3	53%	0.533	49%	0.485	S	S	.	.	H	α-helix	trans	-62.9	-45.7	172.5	-77.2	176.6	-4.7	0	0	112.1	I22 A23 I24 K28 A29 Q30	I22-Q26 HydrophobicContact CG2-CG 4.24Å; I22-Q26 WeakPolarHBondContact O-CB 3.4Å; I22-Q26 VanDerWaalsContact O-CG 3.25Å; I22-Q26 WeakPolarHBondContact O-CG 3.3Å; I22-Q26 PolarHBondContact O-N 3.38Å; A23-Q26 PolarHBondContact O-N 3.12Å; I24-Q26 VanDerWaalsContact C-N 3.31Å; I24-Q26 PolarHBondContact O-N 3.16Å; Q26-K28 VanDerWaalsContact C-N 3.31Å; Q26-K28 PolarHBondContact O-N 2.75Å; Q26-A29 PolarHBondContact O-N 2.92Å; Q26-Q30 VanDerWaalsContact O-CG 3.32Å; Q26-Q30 WeakPolarHBondContact O-CG 3.26Å; Q26-Q30 PolarHBondContact O-N 3.48Å
27	Q	97.9	Very high	97.2	Very high	134 Å²	134	95 Å²	95	63%	0.626	48%	0.483	S	S	*	.	H	α-helix	trans	-60.6	-42.5	175.9	-75.6	-179.5	-17.7	0	0	111.6	A23 I24 Q30 F31	A23-Q27 WeakPolarHBondContact O-CG 3.3Å; A23-Q27 PolarHBondContact O-N 3.44Å; I24-Q27 PolarHBondContact O-N 3.48Å; Q27-Q30 PolarHBondContact O-N 2.97Å; Q27-F31 PolarHBondContact O-N 3.47Å
28	K	98.3	Very high	97.4	Very high	116 Å²	116	92 Å²	92	50%	0.504	47%	0.469	S	S	.	.	H	α-helix	trans	-62.4	-45.5	175.9	-176.7	-179.6	172.3	-169.1	0	111.5	I24 E25 Q26 Q30 F31 Q32	I24-K28 PolarHBondContact O-N 2.93Å; E25-K28 PolarHBondContact O-N 3.28Å; E25-K28 IonicContact OE2-NZ 3.95Å; Q26-K28 VanDerWaalsContact C-N 3.31Å; Q26-K28 PolarHBondContact O-N 2.75Å; K28-Q30 VanDerWaalsContact C-N 3.35Å; K28-Q30 PolarHBondContact O-N 3.29Å; K28-F31 PolarHBondContact O-N 3.4Å; K28-Q32 VanDerWaalsContact O-CG 3.31Å; K28-Q32 WeakPolarHBondContact O-CG 3.36Å; K28-Q32 PolarHBondContact O-N 2.94Å
29	A	98.3	Very high	97.6	Very high	61 Å²	61	91 Å²	91	50%	0.504	47%	0.467	S	S	.	.	H	α-helix	trans	-61.6	-42.2	177.8	0	0	0	0	0	112	E25 Q26 Q32 A33	E25-A29 WeakPolarHBondContact O-CB 3.32Å; E25-A29 PolarHBondContact O-N 3.4Å; Q26-A29 PolarHBondContact O-N 2.92Å; A29-Q32 PolarHBondContact O-N 3.24Å; A29-A33 WeakPolarHBondContact O-CB 3.48Å; A29-A33 PolarHBondContact O-N 3.02Å
30	Q	97.9	Very high	97.7	Very high	136 Å²	136	89.1 Å²	89.1	64%	0.636	46%	0.461	S	S	*	.	H	α-helix	trans	-62	-44.4	174.9	-72.6	173	1.9	0	0	111.8	Q26 Q27 K28 A33 Q34	Q26-Q30 VanDerWaalsContact O-CG 3.32Å; Q26-Q30 WeakPolarHBondContact O-CG 3.26Å; Q26-Q30 PolarHBondContact O-N 3.48Å; Q27-Q30 PolarHBondContact O-N 2.97Å; K28-Q30 VanDerWaalsContact C-N 3.35Å; K28-Q30 PolarHBondContact O-N 3.29Å; Q30-A33 PolarHBondContact O-N 3.34Å; Q30-Q34 PolarHBondContact O-N 3.02Å
31	F	97.6	Very high	97.8	Very high	130 Å²	130	86.2 Å²	86.2	57%	0.57	45%	0.452	S	S	*	.	H	α-helix	trans	-60.8	-45.7	175.8	175.1	-99.3	0	0	0	111.8	Q27 K28 A33 Q34 V35	Q27-F31 PolarHBondContact O-N 3.47Å; K28-F31 PolarHBondContact O-N 3.4Å; F31-A33 VanDerWaalsContact C-N 3.35Å; F31-A33 PolarHBondContact O-N 3.28Å; F31-Q34 WeakPolarHBondContact O-CB 3.38Å; F31-Q34 PolarHBondContact O-N 3.45Å; F31-Q34 VanDerWaalsContact O-N 3.13Å; F31-V35 HydrophobicContact CD1-CG2 4.18Å; F31-V35 HydrophobicContact CE1-CG2 3.69Å; F31-V35 HydrophobicContact CE2-CG2 4.21Å; F31-V35 HydrophobicContact CZ-CG2 3.71Å; F31-V35 WeakPolarHBondContact O-CG2 3.31Å; F31-V35 PolarHBondContact O-N 3.42Å
32	Q	98.4	Very high	97.9	Very high	83 Å²	83	81.7 Å²	81.7	39%	0.388	43%	0.43	S	S	.	.	H	α-helix	trans	-62.1	-42	177.6	-67.9	-60.3	-30.5	0	0	111.9	K28 A29 Q34 V35 H36	K28-Q32 VanDerWaalsContact O-CG 3.31Å; K28-Q32 WeakPolarHBondContact O-CG 3.36Å; K28-Q32 PolarHBondContact O-N 2.94Å; A29-Q32 PolarHBondContact O-N 3.24Å; Q32-Q34 VanDerWaalsContact C-N 3.26Å; Q32-Q34 PolarHBondContact O-N 2.87Å; Q32-V35 PolarHBondContact O-N 3.46Å; Q32-H36 PolarHBondContact O-CD2 3.36Å; Q32-H36 PolarHBondContact O-N 3.19Å
33	A	98.3	Very high	97.9	Very high	60 Å²	60	83.7 Å²	83.7	50%	0.496	43%	0.433	S	S	.	.	H	α-helix	trans	-59.2	-38.8	174.3	0	0	0	0	0	111.9	A29 Q30 F31 H36 S37	A29-A33 WeakPolarHBondContact O-CB 3.48Å; A29-A33 PolarHBondContact O-N 3.02Å; Q30-A33 PolarHBondContact O-N 3.34Å; F31-A33 VanDerWaalsContact C-N 3.35Å; F31-A33 PolarHBondContact O-N 3.28Å; A33-H36 PolarHBondContact O-N 3Å; A33-S37 PolarHBondContact O-N 3.44Å
34	Q	97.4	Very high	98	Very high	82 Å²	82	88.1 Å²	88.1	38%	0.383	45%	0.45	S	S	.	.	H	α-helix	trans	-67.6	-40.8	176.2	-167.7	61.6	67.3	0	0	112.3	Q30 F31 Q32 H36 S37 F38	Q30-Q34 PolarHBondContact O-N 3.02Å; F31-Q34 WeakPolarHBondContact O-CB 3.38Å; F31-Q34 PolarHBondContact O-N 3.45Å; F31-Q34 VanDerWaalsContact O-N 3.13Å; Q32-Q34 VanDerWaalsContact C-N 3.26Å; Q32-Q34 PolarHBondContact O-N 2.87Å; Q34-H36 VanDerWaalsContact C-N 3.34Å; Q34-S37 PolarHBondContact O-N 3.49Å; Q34-F38 HydrophobicContact CG-CD2 4.23Å; Q34-F38 HydrophobicContact CG-CE1 3.98Å; Q34-F38 HydrophobicContact CG-CE2 3.57Å; Q34-F38 HydrophobicContact CG-CZ 3.42Å; Q34-F38 VanDerWaalsContact CG-CZ 3.42Å; Q34-F38 VanDerWaalsContact NE2-CZ 3.28Å; Q34-F38 WeakPolarHBondContact O-CD2 3.36Å; Q34-F38 VanDerWaalsContact O-CG 3.25Å; Q34-F38 WeakPolarHBondContact O-CG 3.32Å; Q34-F38 PolarHBondContact O-N 2.88Å
35	V	98.3	Very high	98	Very high	49 Å²	49	90.1 Å²	90.1	30%	0.297	46%	0.455	S	S	.	.	H	α-helix	trans	-60.1	-43.8	173.8	171.2	0	0	0	0	111	F31 Q32 F38 T39	F31-V35 HydrophobicContact CD1-CG2 4.18Å; F31-V35 HydrophobicContact CE1-CG2 3.69Å; F31-V35 HydrophobicContact CE2-CG2 4.21Å; F31-V35 HydrophobicContact CZ-CG2 3.71Å; F31-V35 WeakPolarHBondContact O-CG2 3.31Å; F31-V35 PolarHBondContact O-N 3.42Å; Q32-V35 PolarHBondContact O-N 3.46Å; V35-F38 PolarHBondContact O-N 3.45Å; V35-T39 WeakPolarHBondContact O-CB 3.25Å; V35-T39 PolarHBondContact O-N 3.41Å; V35-T39 PolarHBondContact O-OG1 3.43Å
36	H	98.4	Very high	98	Very high	114 Å²	114	85.5 Å²	85.5	53%	0.528	43%	0.434	S	S	.	.	H	α-helix	trans	-61.7	-47.2	175	-72.7	-55	0	0	0	111.7	Q32 A33 Q34 F38 T39 D40	Q32-H36 PolarHBondContact O-CD2 3.36Å; Q32-H36 PolarHBondContact O-N 3.19Å; A33-H36 PolarHBondContact O-N 3Å; Q34-H36 VanDerWaalsContact C-N 3.34Å; H36-F38 VanDerWaalsContact C-N 3.32Å; H36-F38 PolarHBondContact O-N 3.22Å; H36-T39 WeakPolarHBondContact O-CB 3.36Å; H36-T39 PolarHBondContact O-N 3.39Å; H36-D40 PolarHBondContact O-N 3.35Å
37	S	98.1	Very high	97.9	Very high	48 Å²	48	81 Å²	81	34%	0.336	41%	0.414	S	S	.	.	H	α-helix	trans	-58.9	-41.8	177.1	177.9	0	0	0	0	112.7	A33 Q34 V41	A33-S37 PolarHBondContact O-N 3.44Å; Q34-S37 PolarHBondContact O-N 3.49Å; S37-V41 WeakPolarHBondContact O-CG2 3.5Å; S37-V41 PolarHBondContact O-N 3.17Å; S37-V41 VanDerWaalsContact O-N 3.13Å
38	F	98.4	Very high	97.6	Very high	31 Å²	31	82 Å²	82	14%	0.136	42%	0.424	C	S	.	.	H	α-helix	trans	-65.9	-40	174.7	-66.1	-22.3	0	0	0	112.2	Q34 V35 H36 C42 V66 F69 I70	Q34-F38 HydrophobicContact CG-CD2 4.23Å; Q34-F38 HydrophobicContact CG-CE1 3.98Å; Q34-F38 HydrophobicContact CG-CE2 3.57Å; Q34-F38 HydrophobicContact CG-CZ 3.42Å; Q34-F38 VanDerWaalsContact CG-CZ 3.42Å; Q34-F38 VanDerWaalsContact NE2-CZ 3.28Å; Q34-F38 WeakPolarHBondContact O-CD2 3.36Å; Q34-F38 VanDerWaalsContact O-CG 3.25Å; Q34-F38 WeakPolarHBondContact O-CG 3.32Å; Q34-F38 PolarHBondContact O-N 2.88Å; V35-F38 PolarHBondContact O-N 3.45Å; H36-F38 VanDerWaalsContact C-N 3.32Å; H36-F38 PolarHBondContact O-N 3.22Å; F38-C42 WeakPolarHBondContact O-CB 3.49Å; F38-C42 PolarHBondContact O-N 3.05Å; F38-C42 PolarHBondContact O-SG 3Å; F38-V66 HydrophobicContact CB-CG2 4.2Å; F38-V66 HydrophobicContact CD2-CG1 3.82Å; F38-V66 HydrophobicContact CE2-CG1 4.04Å; F38-V66 HydrophobicContact CG-CG1 4.32Å; F38-F69 AromaticContact CD1-CD1 3.98Å; F38-F69 HydrophobicContact CD1-CD1 3.98Å; F38-F69 HydrophobicContact CD1-CE1 4.29Å; F38-F69 HydrophobicContact CD1-CG 4.33Å; F38-F69 AromaticContact CE1-CD1 3.35Å; F38-F69 HydrophobicContact CE1-CD1 3.35Å; F38-F69 AromaticContact CE1-CE1 3.69Å; F38-F69 HydrophobicContact CE1-CE1 3.69Å; F38-F69 HydrophobicContact CE1-CG 4.08Å; F38-F69 HydrophobicContact CZ-CD1 4.31Å; F38-I70 HydrophobicContact CE1-CG1 4.42Å; F38-I70 HydrophobicContact CE2-CD1 4.05Å; F38-I70 HydrophobicContact CE2-CG1 4.15Å; F38-I70 HydrophobicContact CZ-CD1 4.08Å; F38-I70 HydrophobicContact CZ-CG1 3.65Å
39	T	98	Very high	97.1	Very high	71 Å²	71	81.3 Å²	81.3	44%	0.436	43%	0.434	S	S	.	.	H	α-helix	trans	-59.6	-50.9	177.2	-57.9	0	0	0	0	109.8	V35 H36 V41 W43	V35-T39 WeakPolarHBondContact O-CB 3.25Å; V35-T39 PolarHBondContact O-N 3.41Å; V35-T39 PolarHBondContact O-OG1 3.43Å; H36-T39 WeakPolarHBondContact O-CB 3.36Å; H36-T39 PolarHBondContact O-N 3.39Å; T39-V41 PolarHBondContact O-N 3.25Å; T39-W43 WeakPolarHBondContact O-CA 3.49Å; T39-W43 WeakPolarHBondContact O-CB 3.39Å; T39-W43 PolarHBondContact O-N 2.98Å
40	D	97.9	Very high	96.5	Very high	103 Å²	103	83.6 Å²	83.6	55%	0.551	44%	0.444	S	S	*	.	H	α-helix	trans	-58.9	-52	-179.5	-63.3	-20.9	0	0	0	111.4	H36 D44	H36-D40 PolarHBondContact O-N 3.35Å; D40-D44 PolarHBondContact O-N 2.88Å
41	V	98.2	Very high	95.9	Very high	47 Å²	47	80 Å²	80	29%	0.285	44%	0.444	S	S	.	.	H	α-helix	trans	-66.4	-43.7	-176.5	172.8	0	0	0	0	112.3	S37 T39 K45 F69	S37-V41 WeakPolarHBondContact O-CG2 3.5Å; S37-V41 PolarHBondContact O-N 3.17Å; S37-V41 VanDerWaalsContact O-N 3.13Å; T39-V41 PolarHBondContact O-N 3.25Å; V41-K45 HydrophobicContact CG1-CD 4.18Å; V41-K45 VanDerWaalsContact O-CG 3.29Å; V41-K45 WeakPolarHBondContact O-CG 3.45Å; V41-K45 PolarHBondContact O-N 3.01Å; V41-F69 HydrophobicContact CG1-CD2 4.31Å; V41-F69 HydrophobicContact CG1-CE2 4.4Å
42	C	98.4	Very high	95.7	Very high	2 Å²	2	80.2 Å²	80.2	1%	0.014	46%	0.461	C	S	.	.	H	α-helix	trans	-80.9	-27.1	-175.8	-66.3	0	0	0	0	112.3	F38 K45 C46 L62 C65	F38-C42 WeakPolarHBondContact O-CB 3.49Å; F38-C42 PolarHBondContact O-N 3.05Å; F38-C42 PolarHBondContact O-SG 3Å; C42-K45 PolarHBondContact O-N 3.11Å; C42-C46 VanDerWaalsContact O-CB 3.24Å; C42-C46 WeakPolarHBondContact O-CB 3.43Å; C42-C46 PolarHBondContact O-N 2.7Å; C42-L62 HydrophobicContact CB-CD2 3.92Å; C42-C65 WeakPolarHBondContact CA-SG 3.48Å; C42-C65 HydrophobicContact CB-CB 3.77Å; C42-C65 WeakPolarHBondContact CB-SG 3.42Å; C42-C65 WeakPolarHBondContact SG-CB 3.36Å; C42-C65 CovalentContact SG-SG 2.05Å; C42-C65 PolarHBondContact SG-SG 3.46Å
43	W	97.4	Very high	95.5	Very high	121 Å²	121	84.4 Å²	84.4	46%	0.458	48%	0.478	S	S	.	.	H	α-helix	trans	-59.6	-53.7	171.2	-176.1	-91.8	0	0	0	110.6	T39 K45 C46 V47 P50	T39-W43 WeakPolarHBondContact O-CA 3.49Å; T39-W43 WeakPolarHBondContact O-CB 3.39Å; T39-W43 PolarHBondContact O-N 2.98Å; W43-K45 PolarHBondContact O-N 2.84Å; W43-K45 VanDerWaalsContact O-N 3.13Å; W43-C46 PolarHBondContact O-N 2.97Å; W43-V47 HydrophobicContact CD2-CB 3.96Å; W43-V47 HydrophobicContact CD2-CG1 4.26Å; W43-V47 HydrophobicContact CD2-CG2 4Å; W43-V47 HydrophobicContact CE3-CB 4.1Å; W43-V47 HydrophobicContact CE3-CG1 4.27Å; W43-V47 HydrophobicContact CE3-CG2 3.67Å; W43-V47 HydrophobicContact CG-CB 4.43Å; W43-V47 HydrophobicContact CH2-CB 4.46Å; W43-V47 HydrophobicContact CH2-CG1 3.76Å; W43-V47 HydrophobicContact CZ2-CB 4.33Å; W43-V47 HydrophobicContact CZ2-CG1 3.72Å; W43-V47 HydrophobicContact CZ3-CB 4.34Å; W43-V47 HydrophobicContact CZ3-CG1 4.03Å; W43-V47 HydrophobicContact CZ3-CG2 3.97Å; W43-V47 WeakPolarHBondContact O-CB 3.39Å; W43-V47 PolarHBondContact O-N 3.25Å; W43-P50 HydrophobicContact CZ2-CB 4.49Å
44	D	97.2	Very high	95.2	Very high	137 Å²	137	85.3 Å²	85.3	73%	0.733	47%	0.474	S	S	*	.	H	α-helix	trans	-61	-25.5	179.5	-73.1	-9.2	0	0	0	113.5	D40	D40-D44 PolarHBondContact O-N 2.88Å
45	K	97.5	Very high	95.1	Very high	145 Å²	145	85.3 Å²	85.3	63%	0.63	48%	0.477	S	S	*	.	H	α-helix	trans	-90.7	-32	-178.4	-74.2	179.9	-175	-58.7	0	114.3	V41 C42 W43	V41-K45 HydrophobicContact CG1-CD 4.18Å; V41-K45 VanDerWaalsContact O-CG 3.29Å; V41-K45 WeakPolarHBondContact O-CG 3.45Å; V41-K45 PolarHBondContact O-N 3.01Å; C42-K45 PolarHBondContact O-N 3.11Å; W43-K45 PolarHBondContact O-N 2.84Å; W43-K45 VanDerWaalsContact O-N 3.13Å
46	C	97.9	Very high	95	Very high	12 Å²	12	91.7 Å²	91.7	8%	0.081	50%	0.497	C	S	.	.	H	α-helix	trans	-116.8	-18.2	-166.8	-69.7	0	0	0	0	113.9	C42 W43 C61 L62	C42-C46 VanDerWaalsContact O-CB 3.24Å; C42-C46 WeakPolarHBondContact O-CB 3.43Å; C42-C46 PolarHBondContact O-N 2.7Å; W43-C46 PolarHBondContact O-N 2.97Å; C46-C61 VanDerWaalsContact CA-SG 3.52Å; C46-C61 HydrophobicContact CB-CB 3.62Å; C46-C61 WeakPolarHBondContact CB-SG 3.16Å; C46-C61 WeakPolarHBondContact SG-CB 3.45Å; C46-C61 PolarHBondContact SG-O 2.75Å; C46-C61 VanDerWaalsContact SG-O 3.36Å; C46-C61 CovalentContact SG-SG 2.04Å; C46-C61 PolarHBondContact SG-SG 3.3Å; C46-L62 HydrophobicContact CB-CD2 3.87Å; C46-L62 HydrophobicContact CB-CG 4.08Å
47	V	96.3	Very high	94.9	Very high	18 Å²	18	95.8 Å²	95.8	11%	0.109	51%	0.507	C	S	.	.			trans	-113.5	90.2	-173.4	-172.1	0	0	0	0	110.2	W43 T58 L62	W43-V47 HydrophobicContact CD2-CB 3.96Å; W43-V47 HydrophobicContact CD2-CG1 4.26Å; W43-V47 HydrophobicContact CD2-CG2 4Å; W43-V47 HydrophobicContact CE3-CB 4.1Å; W43-V47 HydrophobicContact CE3-CG1 4.27Å; W43-V47 HydrophobicContact CE3-CG2 3.67Å; W43-V47 HydrophobicContact CG-CB 4.43Å; W43-V47 HydrophobicContact CH2-CB 4.46Å; W43-V47 HydrophobicContact CH2-CG1 3.76Å; W43-V47 HydrophobicContact CZ2-CB 4.33Å; W43-V47 HydrophobicContact CZ2-CG1 3.72Å; W43-V47 HydrophobicContact CZ3-CB 4.34Å; W43-V47 HydrophobicContact CZ3-CG1 4.03Å; W43-V47 HydrophobicContact CZ3-CG2 3.97Å; W43-V47 WeakPolarHBondContact O-CB 3.39Å; W43-V47 PolarHBondContact O-N 3.25Å; V47-T58 HydrophobicContact CG2-CG2 3.87Å; V47-L62 HydrophobicContact CG2-CD2 4.37Å
48	D	90.7	Very high	94.8	Very high	155 Å²	155	94.7 Å²	94.7	83%	0.829	50%	0.499	S	S	*	.	S	Bend	trans	-74.1	-39.2	178.2	-69.2	-29.3	0	0	0	112.8
49	S	88.1	Confident	94.7	Very high	103 Å²	103	98 Å²	98	72%	0.72	52%	0.515	S	S	*	.	S	Bend	trans	-146.3	118.2	-177.4	-70.4	0	0	0	0	110.4	G51	S49-G51 PolarHBondContact O-N 2.93Å
50	P	85.3	Confident	94.7	Very high	109 Å²	109	96.9 Å²	96.9	71%	0.708	51%	0.508	S	S	*	.			trans	-69.5	123.6	-178.2	26.2	-31.9	0	0	0	110.7	W43	W43-P50 HydrophobicContact CZ2-CB 4.49Å
51	G	86.3	Confident	94.7	Very high	61 Å²	61	94.2 Å²	94.2	63%	0.629	50%	0.496	S	S	*	.			trans	-104.3	177.6	171.5	0	0	0	0	0	112.3	S49 K53	S49-G51 PolarHBondContact O-N 2.93Å; G51-K53 PolarHBondContact O-N 2.92Å
52	S	93.1	Very high	94.7	Very high	133 Å²	133	93.9 Å²	93.9	93%	0.93	49%	0.493	S	S	*	.	S	Bend	trans	-68.9	-13.8	173.4	55.9	0	0	0	0	113.8
53	K	93.6	Very high	94.7	Very high	171 Å²	171	99.6 Å²	99.6	74%	0.743	52%	0.519	S	S	*	.	S	Bend	trans	-149.7	154.5	174.1	60.5	-178.4	-179.7	178.7	0	109.3	G51	G51-K53 PolarHBondContact O-N 2.92Å
54	L	93.8	Very high	94.8	Very high	79 Å²	79	97.3 Å²	97.3	41%	0.414	52%	0.516	S	S	.	.			trans	-71.6	136	168.1	-57.2	178.5	0	0	0	108.4	T58 E59 L62	L54-T58 HydrophobicContact CD2-CG2 3.87Å; L54-E59 HydrophobicContact CB-CG 3.61Å; L54-E59 HydrophobicContact CD1-CG 4.24Å; L54-L62 HydrophobicContact CD1-CD1 3.9Å
55	D	94	Very high	94.9	Very high	83 Å²	83	91.7 Å²	91.7	44%	0.444	49%	0.487	S	S	.	.			trans	-83.5	163.5	168.7	72.7	10.7	0	0	0	110.2	R57 T58 E59	D55-R57 PolarHBondContact O-N 3.49Å; D55-R57 VanDerWaalsContact O-N 3.12Å; D55-R57 PolarHBondContact OD1-N 2.75Å; D55-T58 PolarHBondContact O-N 3.35Å; D55-T58 VanDerWaalsContact OD1-CB 3.26Å; D55-T58 WeakPolarHBondContact OD1-CB 3.29Å; D55-T58 PolarHBondContact OD1-N 3.43Å; D55-T58 PolarHBondContact OD1-OG1 3.3Å; D55-E59 WeakPolarHBondContact O-CG 3.23Å; D55-E59 PolarHBondContact O-N 3.35Å
56	Y	96	Very high	94.9	Very high	183 Å²	183	87 Å²	87	72%	0.718	47%	0.471	S	S	*	.	H	α-helix	trans	-55.6	-33.9	-177.5	174.5	-106.3	0	0	0	113.1	T60	Y56-T60 VanDerWaalsContact O-CB 3.28Å; Y56-T60 WeakPolarHBondContact O-CB 3.49Å; Y56-T60 PolarHBondContact O-N 2.89Å; Y56-T60 PolarHBondContact O-OG1 3.45Å
57	R	95.8	Very high	95	Very high	199 Å²	199	90 Å²	90	75%	0.751	48%	0.484	S	S	*	.	H	α-helix	trans	-67.9	-44.5	178.7	-179.3	-179.8	-71.1	137	-3.1	110.7	D55 T60 C61	D55-R57 PolarHBondContact O-N 3.49Å; D55-R57 VanDerWaalsContact O-N 3.12Å; D55-R57 PolarHBondContact OD1-N 2.75Å; R57-T60 PolarHBondContact O-N 3.1Å; R57-C61 WeakPolarHBondContact O-CB 3.29Å; R57-C61 PolarHBondContact O-N 3.13Å
58	T	96.6	Very high	95.1	Very high	25 Å²	25	95.4 Å²	95.4	15%	0.153	50%	0.502	C	S	.	.	H	α-helix	trans	-66	-45.6	179	-53.1	0	0	0	0	110.8	V47 L54 D55 T60 C61 L62	V47-T58 HydrophobicContact CG2-CG2 3.87Å; L54-T58 HydrophobicContact CD2-CG2 3.87Å; D55-T58 PolarHBondContact O-N 3.35Å; D55-T58 VanDerWaalsContact OD1-CB 3.26Å; D55-T58 WeakPolarHBondContact OD1-CB 3.29Å; D55-T58 PolarHBondContact OD1-N 3.43Å; D55-T58 PolarHBondContact OD1-OG1 3.3Å; T58-T60 PolarHBondContact O-N 2.87Å; T58-C61 PolarHBondContact O-N 3.47Å; T58-L62 HydrophobicContact CG2-CD1 4.15Å; T58-L62 WeakPolarHBondContact O-CG 3.45Å; T58-L62 PolarHBondContact O-N 3.13Å
59	E	96.8	Very high	95.4	Very high	102 Å²	102	91.3 Å²	91.3	48%	0.477	48%	0.477	S	S	.	.	H	α-helix	trans	-57.7	-48.9	175.4	-68.8	177.8	171.9	0	0	111.6	L54 D55 C61 L62 Q63	L54-E59 HydrophobicContact CB-CG 3.61Å; L54-E59 HydrophobicContact CD1-CG 4.24Å; D55-E59 WeakPolarHBondContact O-CG 3.23Å; D55-E59 PolarHBondContact O-N 3.35Å; E59-C61 VanDerWaalsContact C-N 3.32Å; E59-C61 PolarHBondContact O-N 2.92Å; E59-L62 PolarHBondContact O-N 2.96Å; E59-Q63 PolarHBondContact O-N 3.07Å
60	T	98.3	Very high	95.9	Very high	47 Å²	47	90.2 Å²	90.2	29%	0.288	46%	0.462	S	S	.	.	H	α-helix	trans	-62.8	-39.2	177.6	-59	0	0	0	0	111.6	Y56 R57 T58 N64	Y56-T60 VanDerWaalsContact O-CB 3.28Å; Y56-T60 WeakPolarHBondContact O-CB 3.49Å; Y56-T60 PolarHBondContact O-N 2.89Å; Y56-T60 PolarHBondContact O-OG1 3.45Å; R57-T60 PolarHBondContact O-N 3.1Å; T58-T60 PolarHBondContact O-N 2.87Å; T60-N64 WeakPolarHBondContact CG2-ND2 3.31Å; T60-N64 WeakPolarHBondContact O-CB 3.25Å; T60-N64 PolarHBondContact O-N 3.2Å; T60-N64 VanDerWaalsContact O-N 3.09Å; T60-N64 PolarHBondContact O-ND2 3.35Å
61	C	98.4	Very high	96.5	Very high	46 Å²	46	88.2 Å²	88.2	31%	0.311	45%	0.446	S	S	.	.	H	α-helix	trans	-63.7	-47.8	176.6	-173.8	0	0	0	0	111.4	C46 R57 T58 E59 Q63 N64 C65	C46-C61 VanDerWaalsContact CA-SG 3.52Å; C46-C61 HydrophobicContact CB-CB 3.62Å; C46-C61 WeakPolarHBondContact CB-SG 3.16Å; C46-C61 WeakPolarHBondContact SG-CB 3.45Å; C46-C61 PolarHBondContact SG-O 2.75Å; C46-C61 VanDerWaalsContact SG-O 3.36Å; C46-C61 CovalentContact SG-SG 2.04Å; C46-C61 PolarHBondContact SG-SG 3.3Å; R57-C61 WeakPolarHBondContact O-CB 3.29Å; R57-C61 PolarHBondContact O-N 3.13Å; T58-C61 PolarHBondContact O-N 3.47Å; E59-C61 VanDerWaalsContact C-N 3.32Å; E59-C61 PolarHBondContact O-N 2.92Å; C61-Q63 PolarHBondContact O-N 3.34Å; C61-N64 PolarHBondContact O-N 3.39Å; C61-C65 VanDerWaalsContact O-CB 3.26Å; C61-C65 WeakPolarHBondContact O-CB 3.44Å; C61-C65 PolarHBondContact O-N 2.93Å
62	L	98.1	Very high	97	Very high	41 Å²	41	88.9 Å²	88.9	22%	0.215	44%	0.438	C	S	.	.	H	α-helix	trans	-60.7	-45.8	-179.7	-72	169.3	0	0	0	111.5	C42 C46 V47 L54 T58 E59 C65 V66	C42-L62 HydrophobicContact CB-CD2 3.92Å; C46-L62 HydrophobicContact CB-CD2 3.87Å; C46-L62 HydrophobicContact CB-CG 4.08Å; V47-L62 HydrophobicContact CG2-CD2 4.37Å; L54-L62 HydrophobicContact CD1-CD1 3.9Å; T58-L62 HydrophobicContact CG2-CD1 4.15Å; T58-L62 WeakPolarHBondContact O-CG 3.45Å; T58-L62 PolarHBondContact O-N 3.13Å; E59-L62 PolarHBondContact O-N 2.96Å; L62-C65 PolarHBondContact O-N 2.77Å; L62-V66 WeakPolarHBondContact O-CG2 3.38Å; L62-V66 PolarHBondContact O-N 3.41Å; L62-V66 VanDerWaalsContact O-N 3.12Å
63	Q	98.4	Very high	97.2	Very high	121 Å²	121	85.5 Å²	85.5	57%	0.565	41%	0.412	S	S	*	.	H	α-helix	trans	-57.7	-52.4	176	-177.3	-176.5	-30.9	0	0	111	E59 C61 C65 V66 E67	E59-Q63 PolarHBondContact O-N 3.07Å; C61-Q63 PolarHBondContact O-N 3.34Å; Q63-C65 VanDerWaalsContact C-N 3.31Å; Q63-C65 PolarHBondContact O-N 3.13Å; Q63-V66 PolarHBondContact O-N 2.94Å; Q63-E67 WeakPolarHBondContact CG-OE1 3.44Å; Q63-E67 PolarHBondContact NE2-OE1 2.96Å; Q63-E67 WeakPolarHBondContact O-CG 3.44Å; Q63-E67 PolarHBondContact O-N 2.93Å; Q63-E67 VanDerWaalsContact O-N 3.08Å
64	N	98.7	Very high	97.4	Very high	73 Å²	73	82 Å²	82	39%	0.39	40%	0.4	S	S	.	.	H	α-helix	trans	-61.9	-39.6	179.2	-75.8	-51.3	0	0	0	112	T60 C61 V66 E67 R68	T60-N64 WeakPolarHBondContact CG2-ND2 3.31Å; T60-N64 WeakPolarHBondContact O-CB 3.25Å; T60-N64 PolarHBondContact O-N 3.2Å; T60-N64 VanDerWaalsContact O-N 3.09Å; T60-N64 PolarHBondContact O-ND2 3.35Å; C61-N64 PolarHBondContact O-N 3.39Å; N64-V66 PolarHBondContact O-N 3.36Å; N64-E67 PolarHBondContact O-N 2.94Å; N64-R68 VanDerWaalsContact O-CB 3.27Å; N64-R68 WeakPolarHBondContact O-CB 3.02Å; N64-R68 WeakPolarHBondContact O-CG 3.04Å; N64-R68 PolarHBondContact O-N 3.27Å
65	C	98.8	Very high	97.6	Very high	19 Å²	19	82.8 Å²	82.8	13%	0.128	41%	0.408	C	S	.	.	H	α-helix	trans	-59.6	-49	-179.5	176.2	0	0	0	0	111.4	C42 C61 L62 Q63 F69	C42-C65 WeakPolarHBondContact CA-SG 3.48Å; C42-C65 HydrophobicContact CB-CB 3.77Å; C42-C65 WeakPolarHBondContact CB-SG 3.42Å; C42-C65 WeakPolarHBondContact SG-CB 3.36Å; C42-C65 CovalentContact SG-SG 2.05Å; C42-C65 PolarHBondContact SG-SG 3.46Å; C61-C65 VanDerWaalsContact O-CB 3.26Å; C61-C65 WeakPolarHBondContact O-CB 3.44Å; C61-C65 PolarHBondContact O-N 2.93Å; L62-C65 PolarHBondContact O-N 2.77Å; Q63-C65 VanDerWaalsContact C-N 3.31Å; Q63-C65 PolarHBondContact O-N 3.13Å; C65-F69 WeakPolarHBondContact O-CB 3.34Å; C65-F69 PolarHBondContact O-N 2.96Å
66	V	98.6	Very high	97.8	Very high	47 Å²	47	84 Å²	84	29%	0.285	41%	0.414	S	S	.	.	H	α-helix	trans	-64.3	-48.3	178.6	177.6	0	0	0	0	111	F38 L62 Q63 N64 R68 F69 I70	F38-V66 HydrophobicContact CB-CG2 4.2Å; F38-V66 HydrophobicContact CD2-CG1 3.82Å; F38-V66 HydrophobicContact CE2-CG1 4.04Å; F38-V66 HydrophobicContact CG-CG1 4.32Å; L62-V66 WeakPolarHBondContact O-CG2 3.38Å; L62-V66 PolarHBondContact O-N 3.41Å; L62-V66 VanDerWaalsContact O-N 3.12Å; Q63-V66 PolarHBondContact O-N 2.94Å; N64-V66 PolarHBondContact O-N 3.36Å; V66-R68 PolarHBondContact O-N 2.86Å; V66-F69 PolarHBondContact O-N 2.97Å; V66-I70 HydrophobicContact CG1-CD1 3.91Å; V66-I70 WeakPolarHBondContact O-CG1 3.46Å; V66-I70 PolarHBondContact O-N 2.94Å
67	E	98.6	Very high	97.9	Very high	76 Å²	76	78.8 Å²	78.8	36%	0.355	40%	0.401	S	S	.	.	H	α-helix	trans	-58.2	-47.5	178	-72.5	177	-166.6	0	0	112	Q63 N64 F69 I70 D71	Q63-E67 WeakPolarHBondContact CG-OE1 3.44Å; Q63-E67 PolarHBondContact NE2-OE1 2.96Å; Q63-E67 WeakPolarHBondContact O-CG 3.44Å; Q63-E67 PolarHBondContact O-N 2.93Å; Q63-E67 VanDerWaalsContact O-N 3.08Å; N64-E67 PolarHBondContact O-N 2.94Å; E67-F69 VanDerWaalsContact C-N 3.33Å; E67-F69 PolarHBondContact O-N 3.26Å; E67-I70 PolarHBondContact O-N 3.45Å; E67-D71 WeakPolarHBondContact O-CB 3.5Å; E67-D71 PolarHBondContact O-N 2.93Å
68	R	98.4	Very high	97.9	Very high	131 Å²	131	73 Å²	73	49%	0.494	39%	0.385	S	S	.	.	H	α-helix	trans	-65.5	-36.3	179	-69	-52	96.5	-147.8	-5.7	111.9	N64 V66 D71 T72	N64-R68 VanDerWaalsContact O-CB 3.27Å; N64-R68 WeakPolarHBondContact O-CB 3.02Å; N64-R68 WeakPolarHBondContact O-CG 3.04Å; N64-R68 PolarHBondContact O-N 3.27Å; V66-R68 PolarHBondContact O-N 2.86Å; R68-D71 IonicContact CZ-OD2 3.01Å; R68-D71 IonicContact NH1-OD2 2.74Å; R68-D71 PolarHBondContact NH1-OD2 3.44Å; R68-D71 IonicContact NH2-OD2 2.71Å; R68-D71 PolarHBondContact NH2-OD2 3.37Å; R68-T72 VanDerWaalsContact O-CB 3.23Å; R68-T72 WeakPolarHBondContact O-CB 3.46Å; R68-T72 PolarHBondContact O-N 3.38Å; R68-T72 PolarHBondContact O-OG1 2.74Å
69	F	98.2	Very high	97.9	Very high	69 Å²	69	80.1 Å²	80.1	30%	0.303	41%	0.409	S	S	.	.	H	α-helix	trans	-63.8	-46.6	177.3	-170.3	-76	0	0	0	111	F38 V41 C65 V66 E67 T72 T73	F38-F69 AromaticContact CD1-CD1 3.98Å; F38-F69 HydrophobicContact CD1-CD1 3.98Å; F38-F69 HydrophobicContact CD1-CE1 4.29Å; F38-F69 HydrophobicContact CD1-CG 4.33Å; F38-F69 AromaticContact CE1-CD1 3.35Å; F38-F69 HydrophobicContact CE1-CD1 3.35Å; F38-F69 AromaticContact CE1-CE1 3.69Å; F38-F69 HydrophobicContact CE1-CE1 3.69Å; F38-F69 HydrophobicContact CE1-CG 4.08Å; F38-F69 HydrophobicContact CZ-CD1 4.31Å; V41-F69 HydrophobicContact CG1-CD2 4.31Å; V41-F69 HydrophobicContact CG1-CE2 4.4Å; C65-F69 WeakPolarHBondContact O-CB 3.34Å; C65-F69 PolarHBondContact O-N 2.96Å; V66-F69 PolarHBondContact O-N 2.97Å; E67-F69 VanDerWaalsContact C-N 3.33Å; E67-F69 PolarHBondContact O-N 3.26Å; F69-T72 PolarHBondContact O-N 2.05Å; F69-T73 WeakPolarHBondContact CD1-OG1 3.18Å; F69-T73 WeakPolarHBondContact CE1-OG1 3.27Å; F69-T73 VanDerWaalsContact O-CB 3.29Å; F69-T73 WeakPolarHBondContact O-CB 2.96Å; F69-T73 PolarHBondContact O-N 2.94Å; F69-T73 PolarHBondContact O-OG1 2.04Å
70	I	98	Very high	97.9	Very high	80 Å²	80	81.8 Å²	81.8	41%	0.41	42%	0.415	S	S	.	.	H	α-helix	trans	-62.1	-51.1	178.2	-66.4	168	0	0	0	110.3	F38 V66 E67 T72 T73 L74	F38-I70 HydrophobicContact CE1-CG1 4.42Å; F38-I70 HydrophobicContact CE2-CD1 4.05Å; F38-I70 HydrophobicContact CE2-CG1 4.15Å; F38-I70 HydrophobicContact CZ-CD1 4.08Å; F38-I70 HydrophobicContact CZ-CG1 3.65Å; V66-I70 HydrophobicContact CG1-CD1 3.91Å; V66-I70 WeakPolarHBondContact O-CG1 3.46Å; V66-I70 PolarHBondContact O-N 2.94Å; E67-I70 PolarHBondContact O-N 3.45Å; I70-T72 VanDerWaalsContact C-N 3.31Å; I70-T72 PolarHBondContact O-N 3.24Å; I70-T73 PolarHBondContact O-N 3.32Å; I70-L74 WeakPolarHBondContact O-CB 3.39Å; I70-L74 PolarHBondContact O-N 2.83Å
71	D	98.2	Very high	97.8	Very high	66 Å²	66	82.4 Å²	82.4	35%	0.353	42%	0.419	S	S	.	.	H	α-helix	trans	-57.5	-44.5	-179.9	-79.5	-3	0	0	0	112	E67 R68 T75	E67-D71 WeakPolarHBondContact O-CB 3.5Å; E67-D71 PolarHBondContact O-N 2.93Å; R68-D71 IonicContact CZ-OD2 3.01Å; R68-D71 IonicContact NH1-OD2 2.74Å; R68-D71 PolarHBondContact NH1-OD2 3.44Å; R68-D71 IonicContact NH2-OD2 2.71Å; R68-D71 PolarHBondContact NH2-OD2 3.37Å; D71-T75 VanDerWaalsContact O-CB 3.32Å; D71-T75 WeakPolarHBondContact O-CB 3.01Å; D71-T75 PolarHBondContact O-N 3.12Å; D71-T75 PolarHBondContact O-OG1 3.29Å
72	T	97.8	Very high	97.7	Very high	76 Å²	76	85.3 Å²	85.3	47%	0.466	43%	0.428	S	S	.	.	H	α-helix	trans	-67.7	-44.3	-179.5	-56.8	0	0	0	0	110.9	R68 F69 I70 L74 T75 I76	R68-T72 VanDerWaalsContact O-CB 3.23Å; R68-T72 WeakPolarHBondContact O-CB 3.46Å; R68-T72 PolarHBondContact O-N 3.38Å; R68-T72 PolarHBondContact O-OG1 2.74Å; F69-T72 PolarHBondContact O-N 2.05Å; I70-T72 VanDerWaalsContact C-N 3.31Å; I70-T72 PolarHBondContact O-N 3.24Å; T72-L74 PolarHBondContact O-N 3.05Å; T72-T75 PolarHBondContact O-N 2.98Å; T72-I76 HydrophobicContact CG2-CD1 3.77Å; T72-I76 HydrophobicContact CG2-CG1 4.41Å; T72-I76 VanDerWaalsContact O-CG1 3.3Å; T72-I76 WeakPolarHBondContact O-CG1 3.1Å; T72-I76 PolarHBondContact O-N 2.71Å
73	T	97.1	Very high	97.5	Very high	62 Å²	62	89.1 Å²	89.1	38%	0.38	45%	0.446	S	S	.	.	H	α-helix	trans	-61.2	-45.6	178.6	-59.7	0	0	0	0	111.1	F69 I70 I76 T77	F69-T73 WeakPolarHBondContact CD1-OG1 3.18Å; F69-T73 WeakPolarHBondContact CE1-OG1 3.27Å; F69-T73 VanDerWaalsContact O-CB 3.29Å; F69-T73 WeakPolarHBondContact O-CB 2.96Å; F69-T73 PolarHBondContact O-N 2.94Å; F69-T73 PolarHBondContact O-OG1 2.04Å; I70-T73 PolarHBondContact O-N 3.32Å; T73-I76 PolarHBondContact O-N 2.93Å; T73-T77 VanDerWaalsContact O-CB 3.3Å; T73-T77 WeakPolarHBondContact O-CB 3.48Å; T73-T77 PolarHBondContact O-N 2.83Å; T73-T77 PolarHBondContact O-OG1 3.41Å
74	L	97.5	Very high	97.3	Very high	97 Å²	97	87 Å²	87	51%	0.508	44%	0.441	S	S	.	.	H	α-helix	trans	-62.8	-44.3	176.9	-179.8	60.7	0	0	0	111.3	I70 T72 I76 T77 N78	I70-L74 WeakPolarHBondContact O-CB 3.39Å; I70-L74 PolarHBondContact O-N 2.83Å; T72-L74 PolarHBondContact O-N 3.05Å; L74-I76 PolarHBondContact O-N 3.47Å; L74-T77 PolarHBondContact O-N 2.77Å; L74-N78 WeakPolarHBondContact CD1-ND2 3.37Å; L74-N78 WeakPolarHBondContact CG-ND2 3.24Å; L74-N78 VanDerWaalsContact O-CB 3.26Å; L74-N78 WeakPolarHBondContact O-CB 3.47Å; L74-N78 PolarHBondContact O-N 3.38Å; L74-N78 PolarHBondContact O-ND2 3.36Å
75	T	97.9	Very high	97	Very high	95 Å²	95	89.5 Å²	89.5	58%	0.583	45%	0.451	S	S	*	.	H	α-helix	trans	-59.4	-47.8	178.2	-62	0	0	0	0	111.6	D71 T72 R79	D71-T75 VanDerWaalsContact O-CB 3.32Å; D71-T75 WeakPolarHBondContact O-CB 3.01Å; D71-T75 PolarHBondContact O-N 3.12Å; D71-T75 PolarHBondContact O-OG1 3.29Å; T72-T75 PolarHBondContact O-N 2.98Å; T75-R79 WeakPolarHBondContact O-CB 3.4Å; T75-R79 PolarHBondContact O-N 2.9Å; T75-R79 VanDerWaalsContact O-N 3.08Å
76	I	97.6	Very high	96.4	Very high	110 Å²	110	96.1 Å²	96.1	56%	0.564	48%	0.477	S	S	*	.	H	α-helix	trans	-64.5	-47.5	179.1	-68.3	169.9	0	0	0	110.6	T72 T73 L74 N78 R79 F80	T72-I76 HydrophobicContact CG2-CD1 3.77Å; T72-I76 HydrophobicContact CG2-CG1 4.41Å; T72-I76 VanDerWaalsContact O-CG1 3.3Å; T72-I76 WeakPolarHBondContact O-CG1 3.1Å; T72-I76 PolarHBondContact O-N 2.71Å; T73-I76 PolarHBondContact O-N 2.93Å; L74-I76 PolarHBondContact O-N 3.47Å; I76-N78 PolarHBondContact O-N 3.44Å; I76-R79 PolarHBondContact O-N 2.65Å; I76-F80 WeakPolarHBondContact O-CB 3.35Å; I76-F80 PolarHBondContact O-N 2.91Å
77	T	97.4	Very high	95.2	Very high	73 Å²	73	96.8 Å²	96.8	45%	0.448	49%	0.493	S	S	.	.	H	α-helix	trans	-63.1	-43.2	-177.7	-57	0	0	0	0	111.7	T73 L74 F80 T81	T73-T77 VanDerWaalsContact O-CB 3.3Å; T73-T77 WeakPolarHBondContact O-CB 3.48Å; T73-T77 PolarHBondContact O-N 2.83Å; T73-T77 PolarHBondContact O-OG1 3.41Å; L74-T77 PolarHBondContact O-N 2.77Å; T77-F80 PolarHBondContact O-N 2.89Å; T77-T81 WeakPolarHBondContact O-CB 3.26Å; T77-T81 PolarHBondContact O-N 3.31Å; T77-T81 PolarHBondContact O-OG1 3.49Å
78	N	96.9	Very high	93.4	Very high	76 Å²	76	98.4 Å²	98.4	41%	0.406	51%	0.508	S	S	.	.	H	α-helix	trans	-63.6	-44.5	177	-74.3	-19.5	0	0	0	111.5	L74 I76 F80 T81 Q82	L74-N78 WeakPolarHBondContact CD1-ND2 3.37Å; L74-N78 WeakPolarHBondContact CG-ND2 3.24Å; L74-N78 VanDerWaalsContact O-CB 3.26Å; L74-N78 WeakPolarHBondContact O-CB 3.47Å; L74-N78 PolarHBondContact O-N 3.38Å; L74-N78 PolarHBondContact O-ND2 3.36Å; I76-N78 PolarHBondContact O-N 3.44Å; N78-F80 VanDerWaalsContact C-N 3.35Å; N78-F80 PolarHBondContact O-N 3.49Å; N78-T81 PolarHBondContact O-N 3.09Å; N78-Q82 VanDerWaalsContact O-CG 3.31Å; N78-Q82 WeakPolarHBondContact O-CG 3.41Å; N78-Q82 PolarHBondContact O-N 3.08Å
79	R	96.6	Very high	91.1	Very high	176 Å²	176	103.1 Å²	103.1	66%	0.664	54%	0.536	S	S	*	.	H	α-helix	trans	-62	-43.9	176.8	-177.2	171.3	-179.3	148	-0.1	111.5	T75 I76 Q82 M83	T75-R79 WeakPolarHBondContact O-CB 3.4Å; T75-R79 PolarHBondContact O-N 2.9Å; T75-R79 VanDerWaalsContact O-N 3.08Å; I76-R79 PolarHBondContact O-N 2.65Å; R79-Q82 PolarHBondContact O-N 3.21Å; R79-M83 HydrophobicContact CG-SD 4.4Å; R79-M83 WeakPolarHBondContact O-CG 3.28Å; R79-M83 PolarHBondContact O-N 3.46Å
80	F	97.1	Very high	90.7	Very high	137 Å²	137	104.9 Å²	104.9	60%	0.601	55%	0.547	S	S	*	.	H	α-helix	trans	-62.5	-45.2	177.7	-173.1	-100.3	0	0	0	111.5	I76 T77 N78 Q82 M83 V84	I76-F80 WeakPolarHBondContact O-CB 3.35Å; I76-F80 PolarHBondContact O-N 2.91Å; T77-F80 PolarHBondContact O-N 2.89Å; N78-F80 VanDerWaalsContact C-N 3.35Å; N78-F80 PolarHBondContact O-N 3.49Å; F80-Q82 VanDerWaalsContact C-N 3.32Å; F80-Q82 PolarHBondContact O-N 3.32Å; F80-M83 WeakPolarHBondContact O-CB 3.4Å; F80-M83 PolarHBondContact O-N 3.04Å; F80-M83 VanDerWaalsContact O-N 3.08Å; F80-V84 HydrophobicContact CD1-CG2 4.04Å; F80-V84 HydrophobicContact CE1-CG2 3.65Å; F80-V84 HydrophobicContact CZ-CG2 3.92Å; F80-V84 WeakPolarHBondContact O-CG2 3.34Å; F80-V84 PolarHBondContact O-N 3.32Å
81	T	96.3	Very high	90.4	Very high	60 Å²	60	106.2 Å²	106.2	37%	0.368	56%	0.555	S	S	.	*	H	α-helix	trans	-57.2	-45	176.1	-58.8	0	0	0	0	111.7	T77 N78 M83 V84 Q85	T77-T81 WeakPolarHBondContact O-CB 3.26Å; T77-T81 PolarHBondContact O-N 3.31Å; T77-T81 PolarHBondContact O-OG1 3.49Å; N78-T81 PolarHBondContact O-N 3.09Å; T81-M83 VanDerWaalsContact C-N 3.32Å; T81-M83 PolarHBondContact O-N 3.42Å; T81-V84 PolarHBondContact O-N 3.27Å; T81-Q85 WeakPolarHBondContact O-CG 3.26Å; T81-Q85 PolarHBondContact O-N 3.12Å
82	Q	94.7	Very high	89.9	Confident	106 Å²	106	108.4 Å²	108.4	50%	0.495	57%	0.566	S	S	.	*	H	α-helix	trans	-62.5	-37.1	176.3	-71.1	172.7	19.6	0	0	112.7	N78 R79 F80 K86	N78-Q82 VanDerWaalsContact O-CG 3.31Å; N78-Q82 WeakPolarHBondContact O-CG 3.41Å; N78-Q82 PolarHBondContact O-N 3.08Å; R79-Q82 PolarHBondContact O-N 3.21Å; F80-Q82 VanDerWaalsContact C-N 3.32Å; F80-Q82 PolarHBondContact O-N 3.32Å; Q82-K86 WeakPolarHBondContact O-CB 3.35Å; Q82-K86 VanDerWaalsContact O-CG 3.29Å; Q82-K86 WeakPolarHBondContact O-CG 3.47Å; Q82-K86 PolarHBondContact O-N 2.95Å
83	M	94.8	Very high	89.5	Confident	122 Å²	122	110.3 Å²	110.3	60%	0.601	57%	0.572	S	S	*	*	H	α-helix	trans	-67.8	-44	177.1	-71.2	176.3	62.6	0	0	111.7	R79 F80 T81 K86 G87	R79-M83 HydrophobicContact CG-SD 4.4Å; R79-M83 WeakPolarHBondContact O-CG 3.28Å; R79-M83 PolarHBondContact O-N 3.46Å; F80-M83 WeakPolarHBondContact O-CB 3.4Å; F80-M83 PolarHBondContact O-N 3.04Å; F80-M83 VanDerWaalsContact O-N 3.08Å; T81-M83 VanDerWaalsContact C-N 3.32Å; T81-M83 PolarHBondContact O-N 3.42Å; M83-K86 PolarHBondContact O-N 2.83Å; M83-G87 PolarHBondContact O-N 3.01Å
84	V	95.1	Very high	89	Confident	75 Å²	75	113.3 Å²	113.3	46%	0.455	58%	0.584	S	S	.	*	H	α-helix	trans	-61.3	-46.2	177.3	172.6	0	0	0	0	111	F80 T81 K86 G87 T88	F80-V84 HydrophobicContact CD1-CG2 4.04Å; F80-V84 HydrophobicContact CE1-CG2 3.65Å; F80-V84 HydrophobicContact CZ-CG2 3.92Å; F80-V84 WeakPolarHBondContact O-CG2 3.34Å; F80-V84 PolarHBondContact O-N 3.32Å; T81-V84 PolarHBondContact O-N 3.27Å; V84-K86 VanDerWaalsContact C-N 3.32Å; V84-K86 PolarHBondContact O-N 2.78Å; V84-G87 PolarHBondContact O-N 3.05Å; V84-T88 PolarHBondContact O-N 3.29Å; V84-T88 PolarHBondContact O-OG1 2.78Å
85	Q	91.6	Very high	88.4	Confident	127 Å²	127	114.4 Å²	114.4	59%	0.593	59%	0.589	S	S	*	*	H	α-helix	trans	-60.8	-39.7	178.1	-72.8	174.1	-7.4	0	0	112.6	T81	T81-Q85 WeakPolarHBondContact O-CG 3.26Å; T81-Q85 PolarHBondContact O-N 3.12Å
86	K	85.3	Confident	87.8	Confident	158 Å²	158	115.8 Å²	115.8	69%	0.687	59%	0.589	S	S	*	*	H	α-helix	trans	-72.8	-28.3	178.8	-73.4	175.3	-179	179.7	0	114	Q82 M83 V84 T88	Q82-K86 WeakPolarHBondContact O-CB 3.35Å; Q82-K86 VanDerWaalsContact O-CG 3.29Å; Q82-K86 WeakPolarHBondContact O-CG 3.47Å; Q82-K86 PolarHBondContact O-N 2.95Å; M83-K86 PolarHBondContact O-N 2.83Å; V84-K86 VanDerWaalsContact C-N 3.32Å; V84-K86 PolarHBondContact O-N 2.78Å; K86-T88 VanDerWaalsContact C-N 3.32Å
87	G	74.3	Confident	87	Confident	60 Å²	60	116.2 Å²	116.2	62%	0.619	59%	0.591	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.4	-1.8	178.4	0	0	0	0	0	114.8	M83 V84 H89	M83-G87 PolarHBondContact O-N 3.01Å; V84-G87 PolarHBondContact O-N 3.05Å; G87-H89 VanDerWaalsContact C-N 3.28Å
88	T	61.7	Low	86.1	Confident	110 Å²	110	119.8 Å²	119.8	68%	0.675	60%	0.603	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.5	12.1	176.7	-40.4	0	0	0	0	112.1	V84 K86	V84-T88 PolarHBondContact O-N 3.29Å; V84-T88 PolarHBondContact O-OG1 2.78Å; K86-T88 VanDerWaalsContact C-N 3.32Å
89	H	49.4	Very low	85.1	Confident	231 Å²	231	123.8 Å²	123.8	100%	1.069	62%	0.621	S	S	*	*			trans	-123.4	0	169.9	-71.5	-61.1	0	0	0	109.3	G87	G87-H89 VanDerWaalsContact C-N 3.28Å

Retrieved 89 of 89 residues in 84.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).