A0A087YDY1_POEFO Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB (A0A3B3RP45), UniProt , Accession A0A087YDY1, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 71 aa.

						>A0A087YDY1_POEFO|A0A087YDY1
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMSYCEAHAKEDPLLSPVPASENPFREKKFFCAIL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.3	Very low	76.5	Confident	255 Å²	255	108.6 Å²	108.6	100%	1.256	65%	0.646	S	S	*	*				0	73.5	0	-59.5	-175.7	-155.9	0	0	110
2	A	55.2	Low	78.1	Confident	86 Å²	86	104 Å²	104	71%	0.711	63%	0.628	S	S	*	*			trans	-126.6	-7	-173.1	0	0	0	0	0	115.1	N4	A2-N4 PolarHBondContact O-N 3.44Å
3	S	58.9	Low	79.6	Confident	102 Å²	102	109.7 Å²	109.7	71%	0.713	63%	0.632	S	S	*	*	H	α-helix	trans	-76.9	-19	-174.2	-80.5	0	0	0	0	115.8
4	N	64.3	Low	80.9	Confident	140 Å²	140	114 Å²	114	75%	0.749	64%	0.639	S	S	*	*	H	α-helix	trans	-86.8	-16.4	-174.7	-72	6.3	0	0	0	113.7	A2 S8	A2-N4 PolarHBondContact O-N 3.44Å; N4-S8 WeakPolarHBondContact O-CB 3.31Å; N4-S8 PolarHBondContact O-N 3.22Å
5	N	73.6	Confident	82	Confident	112 Å²	112	113.5 Å²	113.5	60%	0.599	63%	0.634	S	S	*	*	H	α-helix	trans	-77.5	-36.4	-172.2	-149.9	33.1	0	0	0	112.1	I9	N5-I9 VanDerWaalsContact O-CD1 3.3Å; N5-I9 WeakPolarHBondContact O-CD1 3.46Å; N5-I9 WeakPolarHBondContact O-CG1 3.44Å; N5-I9 PolarHBondContact O-N 3.34Å; N5-I9 VanDerWaalsContact O-N 3.08Å
6	T	81.1	Confident	83	Confident	99 Å²	99	110.8 Å²	110.8	61%	0.607	62%	0.621	S	S	*	*	H	α-helix	trans	-71.5	-39.4	-180	54.2	0	0	0	0	112.5	I9 A10	T6-I9 PolarHBondContact O-N 3.26Å; T6-A10 WeakPolarHBondContact O-CB 3.3Å; T6-A10 PolarHBondContact O-N 3.1Å
7	A	84.7	Confident	83.9	Confident	53 Å²	53	109.6 Å²	109.6	44%	0.438	61%	0.609	S	S	.	*	H	α-helix	trans	-65.1	-43.3	175.8	0	0	0	0	0	111.9	A10 Q11	A7-A10 PolarHBondContact O-N 3.2Å; A7-Q11 WeakPolarHBondContact O-CG 3.24Å; A7-Q11 PolarHBondContact O-N 2.72Å
8	S	92.4	Very high	84.7	Confident	66 Å²	66	108.6 Å²	108.6	46%	0.462	60%	0.599	S	S	.	*	H	α-helix	trans	-60.5	-44.7	174.5	178.3	0	0	0	0	111.8	N4 A10 Q11 A12	N4-S8 WeakPolarHBondContact O-CB 3.31Å; N4-S8 PolarHBondContact O-N 3.22Å; S8-A10 VanDerWaalsContact C-N 3.35Å; S8-A10 PolarHBondContact O-N 3.33Å; S8-Q11 PolarHBondContact O-N 3.36Å; S8-A12 WeakPolarHBondContact O-CB 3.45Å; S8-A12 PolarHBondContact O-N 3.31Å
9	I	93.6	Very high	85.4	Confident	79 Å²	79	107.6 Å²	107.6	41%	0.405	59%	0.592	S	S	.	*	H	α-helix	trans	-62.8	-40.8	176.5	-68.8	163.7	0	0	0	111.5	N5 T6 A12 R13	N5-I9 VanDerWaalsContact O-CD1 3.3Å; N5-I9 WeakPolarHBondContact O-CD1 3.46Å; N5-I9 WeakPolarHBondContact O-CG1 3.44Å; N5-I9 PolarHBondContact O-N 3.34Å; N5-I9 VanDerWaalsContact O-N 3.08Å; T6-I9 PolarHBondContact O-N 3.26Å; I9-A12 PolarHBondContact O-N 3.29Å; I9-R13 VanDerWaalsContact O-CG 3.3Å; I9-R13 WeakPolarHBondContact O-CG 3.33Å; I9-R13 PolarHBondContact O-N 3.42Å
10	A	94	Very high	86.1	Confident	60 Å²	60	107.5 Å²	107.5	50%	0.496	59%	0.586	S	S	.	*	H	α-helix	trans	-64.6	-41.5	177.7	0	0	0	0	0	111.9	T6 A7 S8 R13 K14	T6-A10 WeakPolarHBondContact O-CB 3.3Å; T6-A10 PolarHBondContact O-N 3.1Å; A7-A10 PolarHBondContact O-N 3.2Å; S8-A10 VanDerWaalsContact C-N 3.35Å; S8-A10 PolarHBondContact O-N 3.33Å; A10-R13 PolarHBondContact O-N 3.36Å; A10-K14 PolarHBondContact O-N 2.84Å
11	Q	95.3	Very high	86.6	Confident	143 Å²	143	108.4 Å²	108.4	67%	0.668	59%	0.587	S	S	*	*	H	α-helix	trans	-63.4	-45.8	174.6	-73.2	175.6	-30	0	0	111.8	A7 S8 R13 K14 L15	A7-Q11 WeakPolarHBondContact O-CG 3.24Å; A7-Q11 PolarHBondContact O-N 2.72Å; S8-Q11 PolarHBondContact O-N 3.36Å; Q11-R13 VanDerWaalsContact C-N 3.32Å; Q11-R13 PolarHBondContact O-N 3.46Å; Q11-K14 PolarHBondContact O-N 3.38Å; Q11-L15 PolarHBondContact O-N 3Å
12	A	96.3	Very high	89	Confident	53 Å²	53	100.4 Å²	100.4	44%	0.438	55%	0.547	S	S	.	.	H	α-helix	trans	-60.6	-41.7	177.5	0	0	0	0	0	111.9	S8 I9 L15 V16	S8-A12 WeakPolarHBondContact O-CB 3.45Å; S8-A12 PolarHBondContact O-N 3.31Å; I9-A12 PolarHBondContact O-N 3.29Å; A12-L15 PolarHBondContact O-N 3.36Å; A12-V16 WeakPolarHBondContact O-CG2 3.36Å; A12-V16 PolarHBondContact O-N 2.91Å
13	R	97	Very high	91	Very high	178 Å²	178	99.1 Å²	99.1	67%	0.672	54%	0.537	S	S	*	.	H	α-helix	trans	-61	-46.9	174.4	-74.4	172.1	-178.2	-114.2	1.3	111.6	I9 A10 Q11 L15 V16 E17	I9-R13 VanDerWaalsContact O-CG 3.3Å; I9-R13 WeakPolarHBondContact O-CG 3.33Å; I9-R13 PolarHBondContact O-N 3.42Å; A10-R13 PolarHBondContact O-N 3.36Å; Q11-R13 VanDerWaalsContact C-N 3.32Å; Q11-R13 PolarHBondContact O-N 3.46Å; R13-L15 VanDerWaalsContact C-N 3.29Å; R13-L15 PolarHBondContact O-N 3.45Å; R13-V16 PolarHBondContact O-N 3.47Å; R13-E17 WeakPolarHBondContact O-CG 3.46Å; R13-E17 PolarHBondContact O-N 2.95Å
14	K	97.4	Very high	92.9	Very high	170 Å²	170	100.7 Å²	100.7	74%	0.739	54%	0.537	S	S	*	.	H	α-helix	trans	-58.6	-42.5	176.9	-176.3	179.6	177.3	-177	0	111.6	A10 Q11 E17 Q18	A10-K14 PolarHBondContact O-N 2.84Å; Q11-K14 PolarHBondContact O-N 3.38Å; K14-E17 PolarHBondContact O-N 3.48Å; K14-Q18 PolarHBondContact O-N 3.25Å
15	L	97.7	Very high	94.4	Very high	106 Å²	106	98.9 Å²	98.9	56%	0.555	53%	0.526	S	S	*	.	H	α-helix	trans	-63.8	-42.4	177	-179.1	62.6	0	0	0	111.8	Q11 A12 R13 E17 Q18 L19	Q11-L15 PolarHBondContact O-N 3Å; A12-L15 PolarHBondContact O-N 3.36Å; R13-L15 VanDerWaalsContact C-N 3.29Å; R13-L15 PolarHBondContact O-N 3.45Å; L15-E17 VanDerWaalsContact C-N 3.35Å; L15-E17 PolarHBondContact O-N 2.95Å; L15-Q18 WeakPolarHBondContact O-CB 3.45Å; L15-Q18 PolarHBondContact O-N 3.33Å; L15-L19 HydrophobicContact CD1-CD1 4.39Å; L15-L19 HydrophobicContact CD1-CG 4.34Å; L15-L19 HydrophobicContact CG-CD1 4.08Å; L15-L19 HydrophobicContact CG-CG 4.45Å; L15-L19 WeakPolarHBondContact O-CG 3.3Å; L15-L19 PolarHBondContact O-N 3.04Å
16	V	98.3	Very high	95.6	Very high	70 Å²	70	101.2 Å²	101.2	42%	0.424	54%	0.539	S	S	.	.	H	α-helix	trans	-61.8	-43.1	176.6	167.9	0	0	0	0	111.3	A12 R13 Q18 L19 K20	A12-V16 WeakPolarHBondContact O-CG2 3.36Å; A12-V16 PolarHBondContact O-N 2.91Å; R13-V16 PolarHBondContact O-N 3.47Å; V16-Q18 VanDerWaalsContact C-N 3.32Å; V16-Q18 PolarHBondContact O-N 3.2Å; V16-L19 PolarHBondContact O-N 3.39Å; V16-K20 HydrophobicContact CG1-CD 4.26Å; V16-K20 VanDerWaalsContact O-CG 3.31Å; V16-K20 WeakPolarHBondContact O-CG 3.48Å; V16-K20 PolarHBondContact O-N 2.99Å
17	E	98.3	Very high	96.4	Very high	91 Å²	91	105.3 Å²	105.3	43%	0.425	54%	0.543	S	S	.	.	H	α-helix	trans	-64	-38.3	176.7	-64.4	-48	125.2	0	0	111.9	R13 K14 L15 K20 M21	R13-E17 WeakPolarHBondContact O-CG 3.46Å; R13-E17 PolarHBondContact O-N 2.95Å; K14-E17 PolarHBondContact O-N 3.48Å; L15-E17 VanDerWaalsContact C-N 3.35Å; L15-E17 PolarHBondContact O-N 2.95Å; E17-K20 PolarHBondContact O-N 3.39Å; E17-K20 IonicContact OE1-NZ 2.72Å; E17-K20 PolarHBondContact OE1-NZ 2.94Å; E17-K20 IonicContact OE2-NZ 3.68Å; E17-M21 WeakPolarHBondContact O-CG 3.44Å; E17-M21 PolarHBondContact O-N 3.21Å
18	Q	98.2	Very high	97	Very high	91 Å²	91	107.8 Å²	107.8	43%	0.425	55%	0.548	S	S	.	.	H	α-helix	trans	-61.5	-49	173.2	-178.3	62.8	28.7	0	0	111.8	K14 L15 V16 K20 M21 E22	K14-Q18 PolarHBondContact O-N 3.25Å; L15-Q18 WeakPolarHBondContact O-CB 3.45Å; L15-Q18 PolarHBondContact O-N 3.33Å; V16-Q18 VanDerWaalsContact C-N 3.32Å; V16-Q18 PolarHBondContact O-N 3.2Å; Q18-K20 VanDerWaalsContact C-N 3.29Å; Q18-K20 PolarHBondContact O-N 3.31Å; Q18-M21 WeakPolarHBondContact O-CB 3.15Å; Q18-M21 PolarHBondContact O-N 3.03Å; Q18-M21 VanDerWaalsContact O-N 3.1Å; Q18-E22 WeakPolarHBondContact CG-OE1 3.44Å; Q18-E22 PolarHBondContact NE2-OE1 2.97Å; Q18-E22 PolarHBondContact O-N 3.42Å
19	L	98.4	Very high	97.3	Very high	90 Å²	90	112.4 Å²	112.4	47%	0.471	56%	0.56	S	S	.	*	H	α-helix	trans	-64	-34.8	-179.3	-70.2	172.1	0	0	0	112.1	L15 V16 M21 E22 A23	L15-L19 HydrophobicContact CD1-CD1 4.39Å; L15-L19 HydrophobicContact CD1-CG 4.34Å; L15-L19 HydrophobicContact CG-CD1 4.08Å; L15-L19 HydrophobicContact CG-CG 4.45Å; L15-L19 WeakPolarHBondContact O-CG 3.3Å; L15-L19 PolarHBondContact O-N 3.04Å; V16-L19 PolarHBondContact O-N 3.39Å; L19-M21 VanDerWaalsContact C-N 3.34Å; L19-E22 PolarHBondContact O-N 3.44Å; L19-A23 VanDerWaalsContact O-CB 3.24Å; L19-A23 WeakPolarHBondContact O-CB 3.44Å; L19-A23 PolarHBondContact O-N 3.42Å
20	K	98.3	Very high	97.6	Very high	106 Å²	106	114.5 Å²	114.5	46%	0.461	58%	0.576	S	S	.	*	H	α-helix	trans	-61.8	-41.9	173	-75.4	171.9	-178.8	171	0	111.6	V16 E17 Q18 N24	V16-K20 HydrophobicContact CG1-CD 4.26Å; V16-K20 VanDerWaalsContact O-CG 3.31Å; V16-K20 WeakPolarHBondContact O-CG 3.48Å; V16-K20 PolarHBondContact O-N 2.99Å; E17-K20 PolarHBondContact O-N 3.39Å; E17-K20 IonicContact OE1-NZ 2.72Å; E17-K20 PolarHBondContact OE1-NZ 2.94Å; E17-K20 IonicContact OE2-NZ 3.68Å; Q18-K20 VanDerWaalsContact C-N 3.29Å; Q18-K20 PolarHBondContact O-N 3.31Å; K20-N24 VanDerWaalsContact O-CG 3.27Å; K20-N24 PolarHBondContact O-N 3.43Å; K20-N24 PolarHBondContact O-ND2 2.97Å
21	M	98.1	Very high	97.8	Very high	126 Å²	126	115.8 Å²	115.8	62%	0.621	58%	0.581	S	S	*	*	H	α-helix	trans	-64	-46.4	175.5	-65.7	-178	-163.2	0	0	111.2	E17 Q18 L19 A23 N24	E17-M21 WeakPolarHBondContact O-CG 3.44Å; E17-M21 PolarHBondContact O-N 3.21Å; Q18-M21 WeakPolarHBondContact O-CB 3.15Å; Q18-M21 PolarHBondContact O-N 3.03Å; Q18-M21 VanDerWaalsContact O-N 3.1Å; L19-M21 VanDerWaalsContact C-N 3.34Å; M21-A23 PolarHBondContact O-N 2.91Å; M21-N24 PolarHBondContact O-N 3.3Å
22	E	97.8	Very high	97.9	Very high	87 Å²	87	114.8 Å²	114.8	41%	0.407	58%	0.575	S	S	.	*	H	α-helix	trans	-67.2	-33.4	-179.9	-70.3	175	-166.9	0	0	113.5	Q18 L19 N24 I25 R27	Q18-E22 WeakPolarHBondContact CG-OE1 3.44Å; Q18-E22 PolarHBondContact NE2-OE1 2.97Å; Q18-E22 PolarHBondContact O-N 3.42Å; L19-E22 PolarHBondContact O-N 3.44Å; E22-N24 VanDerWaalsContact C-N 3.26Å; E22-N24 PolarHBondContact O-N 2.98Å; E22-I25 HydrophobicContact CB-CD1 4.43Å; E22-I25 PolarHBondContact O-N 3.27Å; E22-R27 PolarHBondContact O-NH2 3Å
23	A	97.8	Very high	98	Very high	60 Å²	60	113.9 Å²	113.9	50%	0.496	57%	0.567	S	S	.	*	H	α-helix	trans	-63.1	-36.9	174.9	0	0	0	0	0	111.5	L19 M21 I25 R27	L19-A23 VanDerWaalsContact O-CB 3.24Å; L19-A23 WeakPolarHBondContact O-CB 3.44Å; L19-A23 PolarHBondContact O-N 3.42Å; M21-A23 PolarHBondContact O-N 2.91Å; A23-I25 PolarHBondContact O-N 3.41Å; A23-R27 PolarHBondContact O-NH1 3.08Å
24	N	97.6	Very high	98.1	Very high	134 Å²	134	107.9 Å²	107.9	72%	0.717	56%	0.555	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.4	8.9	-178.3	-68.3	-16.9	0	0	0	114.2	K20 M21 E22	K20-N24 VanDerWaalsContact O-CG 3.27Å; K20-N24 PolarHBondContact O-N 3.43Å; K20-N24 PolarHBondContact O-ND2 2.97Å; M21-N24 PolarHBondContact O-N 3.3Å; E22-N24 VanDerWaalsContact C-N 3.26Å; E22-N24 PolarHBondContact O-N 2.98Å
25	I	97.8	Very high	98.2	Very high	102 Å²	102	101.8 Å²	101.8	52%	0.523	54%	0.537	S	S	.	.	S	Bend	trans	-75	126.2	172.9	-62.6	172.5	0	0	0	109.4	E22 A23 R27	E22-I25 HydrophobicContact CB-CD1 4.43Å; E22-I25 PolarHBondContact O-N 3.27Å; A23-I25 PolarHBondContact O-N 3.41Å; I25-R27 PolarHBondContact O-N 3.35Å; I25-R27 PolarHBondContact O-NH1 3.49Å
26	D	98	Very high	98.2	Very high	161 Å²	161	100.8 Å²	100.8	86%	0.861	53%	0.532	S	S	*	.	P	Polyproline II helix	trans	-65.3	121.1	172.6	-71.6	-41.1	0	0	0	110.6
27	R	97.8	Very high	98.2	Very high	185 Å²	185	103.2 Å²	103.2	70%	0.698	54%	0.542	S	S	*	.	P	Polyproline II helix	trans	-100.5	144.8	179.6	-64.5	176.5	-175.9	75	2	110.2	E22 A23 I25	E22-R27 PolarHBondContact O-NH2 3Å; A23-R27 PolarHBondContact O-NH1 3.08Å; I25-R27 PolarHBondContact O-N 3.35Å; I25-R27 PolarHBondContact O-NH1 3.49Å
28	I	98.1	Very high	98.2	Very high	106 Å²	106	104 Å²	104	54%	0.544	55%	0.547	S	S	.	.	P	Polyproline II helix	trans	-93.4	158.7	167.5	62.7	171.7	0	0	0	110.6	A33	I28-A33 HydrophobicContact CD1-CB 3.76Å; I28-A33 HydrophobicContact CG1-CB 4.28Å
29	K	98.5	Very high	98.2	Very high	162 Å²	162	102.8 Å²	102.8	70%	0.704	55%	0.548	S	S	*	.	P	Polyproline II helix	trans	-63.4	138.3	173.4	-67.7	-175.2	179.7	179.5	0	109.9	S31 K32 A33	K29-S31 PolarHBondContact O-N 2.91Å; K29-K32 HydrophobicContact CB-CB 4.44Å; K29-K32 WeakPolarHBondContact O-CB 3.4Å; K29-K32 PolarHBondContact O-N 2.78Å; K29-A33 PolarHBondContact O-N 3.1Å; K29-A33 VanDerWaalsContact O-N 3.08Å
30	V	98.5	Very high	98.3	Very high	123 Å²	123	105.6 Å²	105.6	75%	0.745	55%	0.554	S	S	*	*	H	α-helix	trans	-57.3	-38.6	176.6	178.1	0	0	0	0	111.5	K32 A33 A34	V30-K32 VanDerWaalsContact C-N 3.29Å; V30-K32 PolarHBondContact O-N 3.31Å; V30-A33 PolarHBondContact O-N 3.27Å; V30-A34 WeakPolarHBondContact O-CB 3.39Å; V30-A34 PolarHBondContact O-N 3.08Å
31	S	98.4	Very high	98.2	Very high	87 Å²	87	104.5 Å²	104.5	61%	0.608	56%	0.558	S	S	*	*	H	α-helix	trans	-60.8	-36.4	176.2	55.9	0	0	0	0	113.2	K29 A35	K29-S31 PolarHBondContact O-N 2.91Å; S31-A35 WeakPolarHBondContact O-CB 3.46Å; S31-A35 PolarHBondContact O-N 3.29Å; S31-A35 VanDerWaalsContact O-N 3.1Å
32	K	98.5	Very high	98.2	Very high	123 Å²	123	104.4 Å²	104.4	54%	0.535	56%	0.556	S	S	.	*	H	α-helix	trans	-69	-50.4	175	177.3	172.9	178.5	170	0	110.6	K29 V30 A34 A35 D36	K29-K32 HydrophobicContact CB-CB 4.44Å; K29-K32 WeakPolarHBondContact O-CB 3.4Å; K29-K32 PolarHBondContact O-N 2.78Å; V30-K32 VanDerWaalsContact C-N 3.29Å; V30-K32 PolarHBondContact O-N 3.31Å; K32-A34 VanDerWaalsContact C-N 3.25Å; K32-A34 PolarHBondContact O-N 3.09Å; K32-A35 PolarHBondContact O-N 3.29Å; K32-A35 VanDerWaalsContact O-N 3.09Å; K32-D36 VanDerWaalsContact O-CG 3.27Å; K32-D36 PolarHBondContact O-N 2.93Å
33	A	98.6	Very high	98.2	Very high	33 Å²	33	103.4 Å²	103.4	27%	0.273	56%	0.563	S	S	.	*	H	α-helix	trans	-56.3	-42.1	178.3	0	0	0	0	0	111.9	I28 K29 V30 D36 L37	I28-A33 HydrophobicContact CD1-CB 3.76Å; I28-A33 HydrophobicContact CG1-CB 4.28Å; K29-A33 PolarHBondContact O-N 3.1Å; K29-A33 VanDerWaalsContact O-N 3.08Å; V30-A33 PolarHBondContact O-N 3.27Å; A33-D36 PolarHBondContact O-N 3.46Å; A33-L37 VanDerWaalsContact O-CG 3.29Å; A33-L37 WeakPolarHBondContact O-CG 3.49Å; A33-L37 PolarHBondContact O-N 3Å
34	A	98.6	Very high	98.2	Very high	52 Å²	52	104.1 Å²	104.1	43%	0.43	56%	0.556	S	S	.	*	H	α-helix	trans	-64.5	-41.7	176.6	0	0	0	0	0	112.5	V30 K32 L37 M38	V30-A34 WeakPolarHBondContact O-CB 3.39Å; V30-A34 PolarHBondContact O-N 3.08Å; K32-A34 VanDerWaalsContact C-N 3.25Å; K32-A34 PolarHBondContact O-N 3.09Å; A34-L37 PolarHBondContact O-N 3.44Å; A34-M38 WeakPolarHBondContact O-CB 3.35Å; A34-M38 PolarHBondContact O-N 2.88Å
35	A	98.6	Very high	98.1	Very high	43 Å²	43	98.9 Å²	98.9	36%	0.355	53%	0.532	S	S	.	.	H	α-helix	trans	-65.5	-40.3	176.7	0	0	0	0	0	112	S31 K32 M38 S39	S31-A35 WeakPolarHBondContact O-CB 3.46Å; S31-A35 PolarHBondContact O-N 3.29Å; S31-A35 VanDerWaalsContact O-N 3.1Å; K32-A35 PolarHBondContact O-N 3.29Å; K32-A35 VanDerWaalsContact O-N 3.09Å; A35-M38 PolarHBondContact O-N 2.74Å; A35-S39 WeakPolarHBondContact O-CB 3.29Å; A35-S39 PolarHBondContact O-N 2.99Å; A35-S39 PolarHBondContact O-OG 3.01Å
36	D	98.5	Very high	98	Very high	84 Å²	84	102.8 Å²	102.8	45%	0.449	55%	0.545	S	S	.	.	H	α-helix	trans	-64	-43.8	177.2	-64.9	-19.1	0	0	0	110.5	K32 A33 S39 Y40	K32-D36 VanDerWaalsContact O-CG 3.27Å; K32-D36 PolarHBondContact O-N 2.93Å; A33-D36 PolarHBondContact O-N 3.46Å; D36-S39 PolarHBondContact O-N 2.9Å; D36-Y40 WeakPolarHBondContact O-CB 3.36Å; D36-Y40 PolarHBondContact O-N 3.39Å
37	L	98.6	Very high	97.8	Very high	121 Å²	121	102.1 Å²	102.1	63%	0.634	54%	0.536	S	S	*	.	H	α-helix	trans	-62.7	-45.3	174.9	-72.4	173.2	0	0	0	112.2	A33 A34 Y40 C41	A33-L37 VanDerWaalsContact O-CG 3.29Å; A33-L37 WeakPolarHBondContact O-CG 3.49Å; A33-L37 PolarHBondContact O-N 3Å; A34-L37 PolarHBondContact O-N 3.44Å; L37-Y40 PolarHBondContact O-N 3.47Å; L37-C41 PolarHBondContact O-N 3.49Å; L37-C41 PolarHBondContact O-SG 3.42Å; L37-C41 VanDerWaalsContact O-SG 3.34Å
38	M	98.3	Very high	97.8	Very high	109 Å²	109	96.6 Å²	96.6	54%	0.537	52%	0.521	S	S	.	.	H	α-helix	trans	-61	-46.9	177.8	-173.1	177.5	76.9	0	0	111.1	A34 A35 Y40 C41 E42	A34-M38 WeakPolarHBondContact O-CB 3.35Å; A34-M38 PolarHBondContact O-N 2.88Å; A35-M38 PolarHBondContact O-N 2.74Å; M38-Y40 VanDerWaalsContact C-N 3.29Å; M38-Y40 PolarHBondContact O-N 3.38Å; M38-C41 PolarHBondContact O-N 3.2Å; M38-E42 HydrophobicContact CG-CG 4.46Å; M38-E42 WeakPolarHBondContact O-CG 3.32Å; M38-E42 PolarHBondContact O-N 3.36Å
39	S	98.4	Very high	97.6	Very high	64 Å²	64	95 Å²	95	45%	0.448	52%	0.517	S	S	.	.	H	α-helix	trans	-60.3	-40.4	178.5	-56	0	0	0	0	111.7	A35 D36 A43	A35-S39 WeakPolarHBondContact O-CB 3.29Å; A35-S39 PolarHBondContact O-N 2.99Å; A35-S39 PolarHBondContact O-OG 3.01Å; D36-S39 PolarHBondContact O-N 2.9Å; S39-A43 WeakPolarHBondContact O-CB 3.36Å; S39-A43 PolarHBondContact O-N 2.82Å
40	Y	98.5	Very high	97.4	Very high	150 Å²	150	95.1 Å²	95.1	59%	0.588	53%	0.525	S	S	*	.	H	α-helix	trans	-62.9	-48.5	175.8	-178.9	-90.5	0	0	0	111.6	D36 L37 M38 E42 A43 H44	D36-Y40 WeakPolarHBondContact O-CB 3.36Å; D36-Y40 PolarHBondContact O-N 3.39Å; L37-Y40 PolarHBondContact O-N 3.47Å; M38-Y40 VanDerWaalsContact C-N 3.29Å; M38-Y40 PolarHBondContact O-N 3.38Å; Y40-E42 PolarHBondContact O-N 3.32Å; Y40-A43 PolarHBondContact O-N 3.21Å; Y40-H44 AromaticContact CD2-CE1 3.61Å; Y40-H44 AromaticContact CD2-ND1 3.77Å; Y40-H44 AromaticContact CE2-CE1 3.35Å; Y40-H44 WeakPolarHBondContact CE2-CE1 3.35Å; Y40-H44 AromaticContact CE2-ND1 3.68Å; Y40-H44 AromaticContact CZ-CE1 3.83Å; Y40-H44 AromaticContact CZ-ND1 3.81Å; Y40-H44 PolarHBondContact O-N 2.88Å; Y40-H44 PolarHBondContact O-ND1 3.32Å
41	C	98.1	Very high	97.3	Very high	82 Å²	82	94.6 Å²	94.6	55%	0.554	52%	0.517	S	S	*	.	H	α-helix	trans	-61.3	-44.9	178.5	-68.9	0	0	0	0	111.5	L37 M38 A43 H44 A45	L37-C41 PolarHBondContact O-N 3.49Å; L37-C41 PolarHBondContact O-SG 3.42Å; L37-C41 VanDerWaalsContact O-SG 3.34Å; M38-C41 PolarHBondContact O-N 3.2Å; C41-A43 PolarHBondContact O-N 3.09Å; C41-H44 PolarHBondContact O-N 3.01Å; C41-A45 WeakPolarHBondContact O-CA 3.26Å; C41-A45 VanDerWaalsContact O-CB 3.26Å; C41-A45 WeakPolarHBondContact O-CB 3.44Å; C41-A45 PolarHBondContact O-N 3.25Å
42	E	97.1	Very high	97	Very high	124 Å²	124	92.5 Å²	92.5	58%	0.579	50%	0.503	S	S	*	.	H	α-helix	trans	-62.6	-41.1	178.7	-73.2	175.2	174.8	0	0	112.5	M38 Y40 H44	M38-E42 HydrophobicContact CG-CG 4.46Å; M38-E42 WeakPolarHBondContact O-CG 3.32Å; M38-E42 PolarHBondContact O-N 3.36Å; Y40-E42 PolarHBondContact O-N 3.32Å; E42-H44 VanDerWaalsContact C-N 3.31Å; E42-H44 PolarHBondContact O-N 3.34Å
43	A	97.8	Very high	96.6	Very high	67 Å²	67	92.4 Å²	92.4	55%	0.554	51%	0.514	S	S	*	.	H	α-helix	trans	-63	-37.2	178.4	0	0	0	0	0	112.4	S39 Y40 C41	S39-A43 WeakPolarHBondContact O-CB 3.36Å; S39-A43 PolarHBondContact O-N 2.82Å; Y40-A43 PolarHBondContact O-N 3.21Å; C41-A43 PolarHBondContact O-N 3.09Å
44	H	97.4	Very high	96.4	Very high	75 Å²	75	93.5 Å²	93.5	35%	0.347	52%	0.518	S	S	.	.	H	α-helix	trans	-101.6	-3.4	-175.4	-58.7	85.5	0	0	0	113.7	Y40 C41 E42 K46 E47 D48	Y40-H44 AromaticContact CD2-CE1 3.61Å; Y40-H44 AromaticContact CD2-ND1 3.77Å; Y40-H44 AromaticContact CE2-CE1 3.35Å; Y40-H44 WeakPolarHBondContact CE2-CE1 3.35Å; Y40-H44 AromaticContact CE2-ND1 3.68Å; Y40-H44 AromaticContact CZ-CE1 3.83Å; Y40-H44 AromaticContact CZ-ND1 3.81Å; Y40-H44 PolarHBondContact O-N 2.88Å; Y40-H44 PolarHBondContact O-ND1 3.32Å; C41-H44 PolarHBondContact O-N 3.01Å; E42-H44 VanDerWaalsContact C-N 3.31Å; E42-H44 PolarHBondContact O-N 3.34Å; H44-K46 PolarHBondContact O-N 2.94Å; H44-K46 VanDerWaalsContact O-N 3.09Å; H44-E47 IonicContact CD2-OE2 3.89Å; H44-E47 PolarHBondContact O-N 2.84Å; H44-D48 PolarHBondContact O-N 3.43Å
45	A	96.5	Very high	96.1	Very high	24 Å²	24	94.2 Å²	94.2	20%	0.198	52%	0.518	C	S	.	.	T	Hydrogen-bonded Turn	trans	-57.7	-29.4	-175.9	0	0	0	0	0	114	C41 L51 S52	C41-A45 WeakPolarHBondContact O-CA 3.26Å; C41-A45 VanDerWaalsContact O-CB 3.26Å; C41-A45 WeakPolarHBondContact O-CB 3.44Å; C41-A45 PolarHBondContact O-N 3.25Å; A45-L51 HydrophobicContact CB-CD2 3.67Å; A45-S52 PolarHBondContact O-OG 2.85Å
46	K	94.2	Very high	95.6	Very high	184 Å²	184	94.5 Å²	94.5	80%	0.8	52%	0.52	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.7	-22.2	178.5	-65.2	-178.2	-177.6	175	0	113.2	H44	H44-K46 PolarHBondContact O-N 2.94Å; H44-K46 VanDerWaalsContact O-N 3.09Å
47	E	94.9	Very high	95.2	Very high	146 Å²	146	95.1 Å²	95.1	68%	0.682	53%	0.531	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.1	-15.5	-179.1	-62.2	178.7	-169.5	0	0	111.9	H44 P49	H44-E47 IonicContact CD2-OE2 3.89Å; H44-E47 PolarHBondContact O-N 2.84Å; E47-P49 WeakPolarHBondContact O-CD 3.15Å
48	D	96.8	Very high	94.8	Very high	70 Å²	70	95.6 Å²	95.6	37%	0.374	53%	0.53	S	S	.	.			trans	-79.5	108.3	174.4	-174.2	-22.5	0	0	0	110.5	H44 L50 L51 S52	H44-D48 PolarHBondContact O-N 3.43Å; D48-L50 PolarHBondContact O-N 2.87Å; D48-L50 WeakPolarHBondContact OD1-CA 3.31Å; D48-L50 VanDerWaalsContact OD1-CB 3.31Å; D48-L50 WeakPolarHBondContact OD1-CB 3.46Å; D48-L50 PolarHBondContact OD1-N 3.21Å; D48-L51 HydrophobicContact CB-CB 4Å; D48-L51 PolarHBondContact O-N 3.22Å; D48-L51 PolarHBondContact OD1-N 3.3Å; D48-S52 PolarHBondContact O-N 2.86Å
49	P	94.8	Very high	94.5	Very high	72 Å²	72	93.4 Å²	93.4	47%	0.468	52%	0.521	S	S	.	.	T	Hydrogen-bonded Turn	trans	-69	-15.8	-177.9	-19.9	36.1	0	0	0	113.9	E47 S52 V54	E47-P49 WeakPolarHBondContact O-CD 3.15Å; P49-S52 WeakPolarHBondContact CA-O 3.43Å; P49-V54 HydrophobicContact CB-CG1 3.88Å; P49-V54 HydrophobicContact CB-CG2 4.28Å; P49-V54 HydrophobicContact CG-CG1 4.36Å
50	L	94.6	Very high	94.2	Very high	164 Å²	164	95.9 Å²	95.9	86%	0.859	54%	0.535	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.5	-29	177.8	-57.6	179.6	0	0	0	111.5	D48	D48-L50 PolarHBondContact O-N 2.87Å; D48-L50 WeakPolarHBondContact OD1-CA 3.31Å; D48-L50 VanDerWaalsContact OD1-CB 3.31Å; D48-L50 WeakPolarHBondContact OD1-CB 3.46Å; D48-L50 PolarHBondContact OD1-N 3.21Å
51	L	95.4	Very high	93.8	Very high	112 Å²	112	97.5 Å²	97.5	59%	0.586	55%	0.546	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.2	-44.5	174.5	-174.6	61.2	0	0	0	111.9	A45 D48	A45-L51 HydrophobicContact CB-CD2 3.67Å; D48-L51 HydrophobicContact CB-CB 4Å; D48-L51 PolarHBondContact O-N 3.22Å; D48-L51 PolarHBondContact OD1-N 3.3Å
52	S	92.8	Very high	93.3	Very high	44 Å²	44	99.7 Å²	99.7	31%	0.308	54%	0.542	S	S	.	.	T	Hydrogen-bonded Turn	trans	-112.3	98.5	177.6	-64.2	0	0	0	0	109.1	A45 D48 P49 V54	A45-S52 PolarHBondContact O-OG 2.85Å; D48-S52 PolarHBondContact O-N 2.86Å; P49-S52 WeakPolarHBondContact CA-O 3.43Å; S52-V54 PolarHBondContact O-N 3.24Å
53	P	90.9	Very high	92.6	Very high	120 Å²	120	102 Å²	102	78%	0.779	55%	0.553	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.3	126.8	-174.5	-25.4	34.1	0	0	0	112.3
54	V	92.7	Very high	91.7	Very high	56 Å²	56	107.1 Å²	107.1	34%	0.339	56%	0.563	S	S	.	*	P	Polyproline II helix	trans	-81.6	155.7	176	-63.6	0	0	0	0	111.4	P49 S52 E58 N59	P49-V54 HydrophobicContact CB-CG1 3.88Å; P49-V54 HydrophobicContact CB-CG2 4.28Å; P49-V54 HydrophobicContact CG-CG1 4.36Å; S52-V54 PolarHBondContact O-N 3.24Å; V54-E58 HydrophobicContact CB-CB 4.35Å; V54-E58 HydrophobicContact CG2-CB 4.42Å; V54-N59 HydrophobicContact CG2-CB 4.27Å
55	P	92.3	Very high	90.4	Very high	68 Å²	68	111.1 Å²	111.1	44%	0.442	58%	0.579	S	S	.	*	P	Polyproline II helix	trans	-54.5	147.7	172.9	-25.9	35.5	0	0	0	112.2	S57 E58 N59	P55-S57 PolarHBondContact O-N 3.09Å; P55-S57 VanDerWaalsContact O-N 3.08Å; P55-E58 PolarHBondContact O-N 3.16Å; P55-N59 PolarHBondContact O-N 3.41Å
56	A	88.8	Confident	89	Confident	49 Å²	49	118.7 Å²	118.7	41%	0.405	61%	0.608	S	S	.	*	T	Hydrogen-bonded Turn	trans	-56.7	-30.8	-178.8	0	0	0	0	0	113.4	E58 N59 R62	A56-E58 VanDerWaalsContact C-N 3.3Å; A56-E58 PolarHBondContact O-N 3.18Å; A56-N59 PolarHBondContact O-N 2.93Å; A56-R62 HydrophobicContact CB-CG 4.01Å; A56-R62 VanDerWaalsContact O-CB 3.32Å; A56-R62 WeakPolarHBondContact O-CB 3.21Å; A56-R62 WeakPolarHBondContact O-CD 3.32Å; A56-R62 WeakPolarHBondContact O-CG 3.49Å
57	S	89.5	Confident	87.3	Confident	97 Å²	97	119.3 Å²	119.3	68%	0.678	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.4	-29.7	175.6	45.6	0	0	0	0	114.1	P55	P55-S57 PolarHBondContact O-N 3.09Å; P55-S57 VanDerWaalsContact O-N 3.08Å
58	E	90.1	Very high	85.5	Confident	130 Å²	130	117.4 Å²	117.4	61%	0.607	61%	0.613	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.3	-18.1	179.6	-68	170.9	-136.1	0	0	111.7	V54 P55 A56 P60	V54-E58 HydrophobicContact CB-CB 4.35Å; V54-E58 HydrophobicContact CG2-CB 4.42Å; P55-E58 PolarHBondContact O-N 3.16Å; A56-E58 VanDerWaalsContact C-N 3.3Å; A56-E58 PolarHBondContact O-N 3.18Å; E58-P60 WeakPolarHBondContact O-CD 3.32Å
59	N	93.2	Very high	84	Confident	64 Å²	64	117.9 Å²	117.9	34%	0.342	63%	0.626	S	S	.	*			trans	-76.3	111.8	175.8	-175.2	-7.2	0	0	0	111.1	V54 P55 A56 F61 R62	V54-N59 HydrophobicContact CG2-CB 4.27Å; P55-N59 PolarHBondContact O-N 3.41Å; A56-N59 PolarHBondContact O-N 2.93Å; N59-F61 PolarHBondContact O-N 3.47Å; N59-F61 VanDerWaalsContact O-N 3.16Å; N59-F61 WeakPolarHBondContact OD1-CA 3.4Å; N59-F61 WeakPolarHBondContact OD1-CB 3.48Å; N59-F61 PolarHBondContact OD1-N 2.88Å; N59-R62 VanDerWaalsContact O-CB 3.32Å; N59-R62 WeakPolarHBondContact O-CB 3.22Å; N59-R62 PolarHBondContact O-N 3.08Å; N59-R62 VanDerWaalsContact O-N 3.09Å
60	P	91.3	Very high	82.4	Confident	115 Å²	115	121.9 Å²	121.9	75%	0.747	64%	0.642	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66	-18.1	178.9	28	-34.6	0	0	0	113.3	E58	E58-P60 WeakPolarHBondContact O-CD 3.32Å
61	F	90.8	Very high	80.5	Confident	184 Å²	184	124.9 Å²	124.9	81%	0.807	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93	9.9	177.4	-55.2	-76.3	0	0	0	113.3	N59	N59-F61 PolarHBondContact O-N 3.47Å; N59-F61 VanDerWaalsContact O-N 3.16Å; N59-F61 WeakPolarHBondContact OD1-CA 3.4Å; N59-F61 WeakPolarHBondContact OD1-CB 3.48Å; N59-F61 PolarHBondContact OD1-N 2.88Å
62	R	87.2	Confident	79.8	Confident	128 Å²	128	125.6 Å²	125.6	48%	0.483	66%	0.662	S	S	.	*	S	Bend	trans	-62	141.4	174.6	-169.2	-154.3	-171.4	172.3	-0.7	110.9	A56 N59 K64	A56-R62 HydrophobicContact CB-CG 4.01Å; A56-R62 VanDerWaalsContact O-CB 3.32Å; A56-R62 WeakPolarHBondContact O-CB 3.21Å; A56-R62 WeakPolarHBondContact O-CD 3.32Å; A56-R62 WeakPolarHBondContact O-CG 3.49Å; N59-R62 VanDerWaalsContact O-CB 3.32Å; N59-R62 WeakPolarHBondContact O-CB 3.22Å; N59-R62 PolarHBondContact O-N 3.08Å; N59-R62 VanDerWaalsContact O-N 3.09Å; R62-K64 PolarHBondContact O-N 3.3Å
63	E	83.7	Confident	79.1	Confident	174 Å²	174	129.8 Å²	129.8	81%	0.813	68%	0.68	S	S	*	*			trans	-54.2	128.1	167.1	-66.7	-175	176.7	0	0	111.6	K65	E63-K65 PolarHBondContact O-N 3.25Å
64	K	78	Confident	78.4	Confident	174 Å²	174	130.4 Å²	130.4	76%	0.757	68%	0.675	S	S	*	*			trans	-73.5	111.3	171.6	-66.1	-178.6	-177.7	177.7	0	108.1	R62 F66	R62-K64 PolarHBondContact O-N 3.3Å; K64-F66 HydrophobicContact CB-CE2 4.29Å; K64-F66 HydrophobicContact CB-CZ 4.46Å; K64-F66 PolarHBondContact O-N 3.23Å
65	K	69.6	Low	77.6	Confident	159 Å²	159	134.8 Å²	134.8	69%	0.691	69%	0.694	S	S	*	*			trans	-68.1	100.3	165.5	-69.7	-166.8	176.7	-170.8	0	107.9	E63 F67	E63-K65 PolarHBondContact O-N 3.25Å; K65-F67 PolarHBondContact O-N 3Å
66	F	67.4	Low	76.7	Confident	182 Å²	182	138.9 Å²	138.9	80%	0.798	71%	0.71	S	S	*	*			trans	-70.1	110.4	164.9	-66	-81	0	0	0	107.3	K64 C68	K64-F66 HydrophobicContact CB-CE2 4.29Å; K64-F66 HydrophobicContact CB-CZ 4.46Å; K64-F66 PolarHBondContact O-N 3.23Å; F66-C68 VanDerWaalsContact C-N 3.26Å; F66-C68 PolarHBondContact O-N 2.99Å
67	F	59.5	Low	75.9	Confident	197 Å²	197	144.9 Å²	144.9	86%	0.864	73%	0.731	S	S	*	*			trans	-73.4	89	166.3	-69.1	-83.5	0	0	0	107.4	K65 A69	K65-F67 PolarHBondContact O-N 3Å; F67-A69 PolarHBondContact O-N 3.24Å
68	C	56.8	Low	74.9	Confident	107 Å²	107	148.4 Å²	148.4	72%	0.723	73%	0.734	S	S	*	*			trans	-76.1	99.3	162.3	-173.1	0	0	0	0	107	F66	F66-C68 VanDerWaalsContact C-N 3.26Å; F66-C68 PolarHBondContact O-N 2.99Å
69	A	63.7	Low	73.7	Confident	79 Å²	79	149.8 Å²	149.8	65%	0.653	74%	0.744	S	S	*	*			trans	-80.6	109.1	158.4	0	0	0	0	0	106.5	F67 L71	F67-A69 PolarHBondContact O-N 3.24Å; A69-L71 PolarHBondContact O-N 3.22Å
70	I	62	Low	72.1	Confident	157 Å²	157	156.9 Å²	156.9	81%	0.805	78%	0.777	S	S	*	*			trans	-72.3	107.5	162.3	-56.4	178.2	0	0	0	104.8
71	L	55.1	Low	70.3	Confident	227 Å²	227	160.7 Å²	160.7	100%	1.188	78%	0.78	S	S	*	*			trans	-76.4	0	170	-72.3	170.7	0	0	0	110.2	A69	A69-L71 PolarHBondContact O-N 3.22Å

Retrieved 71 of 71 residues in 83.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).