A0A087YDZ6_POEFO Loading...

Small nuclear ribonucleoprotein G

Plays a role in pre-mRNA splicing.

AlphaFold DB (A0A3P9I2H6), UniProt , Accession A0A087YDZ6, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 76 aa.

						>A0A087YDZ6_POEFO|A0A087YDZ6
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVMDDCLEMGPGGQQNTIGMVVIRGNSIIMLEALERV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.2	Very low	72.8	Confident	236 Å²	236	127 Å²	127	100%	1.163	66%	0.662	S	S	*	*				0	102.3	0	-65.9	-80.1	-103.5	0	0	106.7	K3	M1-K3 PolarHBondContact O-N 3.44Å
2	S	56.9	Low	74.7	Confident	119 Å²	119	119.3 Å²	119.3	83%	0.832	62%	0.619	S	S	*	*	P	Polyproline II helix	trans	-60.3	126.5	174.3	54.4	0	0	0	0	107.4	A4	S2-A4 PolarHBondContact O-N 2.86Å
3	K	59.4	Low	76.4	Confident	190 Å²	190	114.4 Å²	114.4	83%	0.826	59%	0.593	S	S	*	*	P	Polyproline II helix	trans	-60	116.9	169.4	-76.9	178.6	175.2	178.8	0	105.8	M1 H5	M1-K3 PolarHBondContact O-N 3.44Å; K3-H5 PolarHBondContact O-N 3.42Å; K3-H5 VanDerWaalsContact O-N 3.07Å; K3-H5 PolarHBondContact O-ND1 2.83Å
4	A	61.5	Low	77.8	Confident	93 Å²	93	113.1 Å²	113.1	77%	0.769	59%	0.587	S	S	*	*	P	Polyproline II helix	trans	-53.6	119.9	171.8	0	0	0	0	0	106.8	S2	S2-A4 PolarHBondContact O-N 2.86Å
5	H	66.7	Low	79.1	Confident	176 Å²	176	110 Å²	110	82%	0.815	57%	0.567	S	S	*	*	P	Polyproline II helix	trans	-67.2	130.2	177.8	-80.9	63.5	0	0	0	107.4	K3	K3-H5 PolarHBondContact O-N 3.42Å; K3-H5 VanDerWaalsContact O-N 3.07Å; K3-H5 PolarHBondContact O-ND1 2.83Å
6	P	70.4	Confident	80.3	Confident	103 Å²	103	107.7 Å²	107.7	67%	0.669	55%	0.552	S	S	*	*	P	Polyproline II helix	trans	-54.7	137.6	175.8	-23	32.2	0	0	0	109.6	E8	P6-E8 PolarHBondContact O-N 3.49Å
7	P	75.7	Confident	81.3	Confident	26 Å²	26	101.4 Å²	101.4	17%	0.169	52%	0.519	C	S	.	.	P	Polyproline II helix	trans	-58.3	127	176.9	21.4	-30.8	0	0	0	110.2	L9 F34 M38	P7-L9 HydrophobicContact CB-CD1 4.05Å; P7-L9 HydrophobicContact CB-CG 4.05Å; P7-L9 PolarHBondContact O-N 2.96Å; P7-F34 HydrophobicContact CG-CD2 4.27Å; P7-F34 HydrophobicContact CG-CE2 4.43Å; P7-M38 HydrophobicContact CB-CG 3.74Å; P7-M38 HydrophobicContact CB-SD 4.25Å; P7-M38 HydrophobicContact CG-CG 3.74Å
8	E	85.8	Confident	82.2	Confident	151 Å²	151	96.1 Å²	96.1	71%	0.706	49%	0.493	S	S	*	.			trans	-77.6	55.9	177.2	-68.8	-170.6	178.2	0	0	111.6	P6	P6-E8 PolarHBondContact O-N 3.49Å
9	L	90.9	Very high	83	Confident	17 Å²	17	91 Å²	91	9%	0.089	47%	0.467	C	S	.	.			trans	-87.5	-10.5	-178.4	-69.2	174.5	0	0	0	113.3	P7 K11 F12 L31 F34 L40 L70	P7-L9 HydrophobicContact CB-CD1 4.05Å; P7-L9 HydrophobicContact CB-CG 4.05Å; P7-L9 PolarHBondContact O-N 2.96Å; L9-K11 PolarHBondContact O-N 3.08Å; L9-K11 VanDerWaalsContact O-N 3.16Å; L9-F12 HydrophobicContact CD2-CD2 4Å; L9-F12 HydrophobicContact CD2-CE2 4.39Å; L9-F12 WeakPolarHBondContact O-CB 3.4Å; L9-F12 PolarHBondContact O-N 2.84Å; L9-L31 HydrophobicContact CB-CD2 4.37Å; L9-F34 HydrophobicContact CB-CD1 3.77Å; L9-F34 HydrophobicContact CB-CD2 4.01Å; L9-F34 HydrophobicContact CB-CE1 3.89Å; L9-F34 HydrophobicContact CB-CE2 4.11Å; L9-F34 HydrophobicContact CB-CG 3.84Å; L9-F34 HydrophobicContact CB-CZ 4.06Å; L9-F34 HydrophobicContact CD1-CB 4.02Å; L9-F34 HydrophobicContact CD1-CD2 4.2Å; L9-F34 HydrophobicContact CD1-CG 4.08Å; L9-L40 HydrophobicContact CD1-CD2 3.63Å; L9-L70 HydrophobicContact CD2-CD1 3.75Å
10	K	92.3	Very high	83.7	Confident	173 Å²	173	91.5 Å²	91.5	75%	0.752	47%	0.465	S	S	*	.	G	3₁₀ helix	trans	-56.8	-35	-177.4	-170.2	173.3	-178.4	-179.7	0	113.4	F12 M13 F34	K10-F12 PolarHBondContact O-N 3.48Å; K10-M13 WeakPolarHBondContact O-CB 3.45Å; K10-M13 VanDerWaalsContact O-CG 3.3Å; K10-M13 WeakPolarHBondContact O-CG 3.41Å; K10-M13 PolarHBondContact O-N 3.06Å; K10-F34 HydrophobicContact CB-CE1 4.49Å; K10-F34 HydrophobicContact CB-CZ 4.37Å
11	K	93.3	Very high	84.4	Confident	113 Å²	113	87.6 Å²	87.6	49%	0.491	45%	0.446	S	S	.	.	G	3₁₀ helix	trans	-69.5	-17.6	177.6	63.7	-175.2	-179.9	-167.6	0	113.9	L9 V76	L9-K11 PolarHBondContact O-N 3.08Å; L9-K11 VanDerWaalsContact O-N 3.16Å; K11-V76 HydrophobicContact CB-CG1 3.71Å; K11-V76 HydrophobicContact CD-CG1 3.75Å; K11-V76 HydrophobicContact CG-CG1 3.58Å
12	F	95.4	Very high	86.7	Confident	34 Å²	34	79.9 Å²	79.9	15%	0.149	41%	0.409	C	S	.	.	G	3₁₀ helix	trans	-98.1	0.8	179.7	-59.2	-82	0	0	0	113.1	L9 K10 K15 L17 L31 L70 A72 V76	L9-F12 HydrophobicContact CD2-CD2 4Å; L9-F12 HydrophobicContact CD2-CE2 4.39Å; L9-F12 WeakPolarHBondContact O-CB 3.4Å; L9-F12 PolarHBondContact O-N 2.84Å; K10-F12 PolarHBondContact O-N 3.48Å; F12-K15 VanDerWaalsContact O-CB 3.3Å; F12-K15 WeakPolarHBondContact O-CB 3.31Å; F12-K15 PolarHBondContact O-N 3.18Å; F12-L17 HydrophobicContact CB-CD1 4.26Å; F12-L17 HydrophobicContact CB-CD2 4.13Å; F12-L17 HydrophobicContact CD1-CD2 3.87Å; F12-L17 HydrophobicContact CG-CD2 4.34Å; F12-L31 HydrophobicContact CB-CD2 3.97Å; F12-L31 WeakPolarHBondContact O-CB 3.25Å; F12-L70 HydrophobicContact CD1-CD2 4.45Å; F12-L70 HydrophobicContact CE1-CD2 4.43Å; F12-A72 HydrophobicContact CD1-CB 3.87Å; F12-A72 HydrophobicContact CE1-CB 3.79Å; F12-V76 HydrophobicContact CD1-CB 4.49Å; F12-V76 HydrophobicContact CD1-CG1 4.19Å; F12-V76 HydrophobicContact CD1-CG2 3.62Å; F12-V76 HydrophobicContact CE1-CB 4.3Å; F12-V76 HydrophobicContact CE1-CG1 4.08Å; F12-V76 HydrophobicContact CE1-CG2 3.74Å; F12-V76 HydrophobicContact CZ-CG1 4.49Å
13	M	96.4	Very high	88.5	Confident	56 Å²	56	78.1 Å²	78.1	28%	0.276	41%	0.409	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59.8	138.8	176.8	-69.1	-67.6	-60	0	0	110.8	K10 K15 L31 R32 F34	K10-M13 WeakPolarHBondContact O-CB 3.45Å; K10-M13 VanDerWaalsContact O-CG 3.3Å; K10-M13 WeakPolarHBondContact O-CG 3.41Å; K10-M13 PolarHBondContact O-N 3.06Å; M13-K15 PolarHBondContact O-N 2.9Å; M13-K15 VanDerWaalsContact O-N 3.11Å; M13-L31 HydrophobicContact SD-CD2 4.06Å; M13-L31 HydrophobicContact SD-CG 4.08Å; M13-R32 WeakPolarHBondContact CE-O 3.19Å; M13-F34 HydrophobicContact CG-CE1 4.42Å; M13-F34 HydrophobicContact SD-CD1 3.87Å; M13-F34 HydrophobicContact SD-CE1 3.99Å
14	D	96.8	Very high	90.1	Very high	96 Å²	96	72.8 Å²	72.8	51%	0.513	41%	0.408	S	S	.	.	T	Hydrogen-bonded Turn	trans	58.5	18.4	-177.3	-56.6	-60.9	0	0	0	114.1	L31 R32	D14-L31 PolarHBondContact N-O 3.41Å; D14-R32 IonicContact OD1-CZ 2.82Å; D14-R32 IonicContact OD1-NH1 3.7Å; D14-R32 PolarHBondContact OD1-NH1 2.83Å
15	K	97	Very high	91.7	Very high	67 Å²	67	74 Å²	74	29%	0.291	39%	0.393	S	S	.	.	S	Bend	trans	-103.5	147.3	174.3	-56.8	-61.3	177.7	-177.1	0	111	F12 M13 L17 I30 L31 E74	F12-K15 VanDerWaalsContact O-CB 3.3Å; F12-K15 WeakPolarHBondContact O-CB 3.31Å; F12-K15 PolarHBondContact O-N 3.18Å; M13-K15 PolarHBondContact O-N 2.9Å; M13-K15 VanDerWaalsContact O-N 3.11Å; K15-L17 PolarHBondContact O-N 2.81Å; K15-I30 WeakPolarHBondContact O-CA 3.36Å; K15-L31 PolarHBondContact O-N 2.77Å; K15-L31 VanDerWaalsContact O-N 3.11Å; K15-E74 HydrophobicContact CD-CB 4.22Å; K15-E74 WeakPolarHBondContact CD-OE2 3.18Å; K15-E74 IonicContact NZ-OE2 3.54Å
16	K	97.4	Very high	93.1	Very high	73 Å²	73	67.9 Å²	67.9	32%	0.317	37%	0.365	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.2	123	169.5	-160.8	177.4	-177.1	172.9	0	110.7	G29 L73 E74	K16-G29 CarbonylContact C-O 3.5Å; K16-G29 WeakPolarHBondContact CA-O 3.3Å; K16-L73 HydrophobicContact CB-CB 4.43Å; K16-L73 HydrophobicContact CD-CD1 4.13Å; K16-L73 HydrophobicContact CG-CD1 4.12Å; K16-L73 PolarHBondContact O-N 2.91Å; K16-E74 HydrophobicContact CB-CG 4.31Å; K16-E74 WeakPolarHBondContact CB-OE1 3.23Å; K16-E74 PolarHBondContact N-OE1 3.32Å
17	L	97.5	Very high	94.4	Very high	0 Å²	0	63.4 Å²	63.4	0%	0	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.8	151.7	178.4	-59.5	-174.7	0	0	0	111.2	F12 K15 L19 Q28 G29 L31 M42 L70 E71 A72	F12-L17 HydrophobicContact CB-CD1 4.26Å; F12-L17 HydrophobicContact CB-CD2 4.13Å; F12-L17 HydrophobicContact CD1-CD2 3.87Å; F12-L17 HydrophobicContact CG-CD2 4.34Å; K15-L17 PolarHBondContact O-N 2.81Å; L17-L19 HydrophobicContact CB-CD2 4.39Å; L17-Q28 CarbonylContact O-C 3.55Å; L17-Q28 WeakPolarHBondContact O-CA 3.21Å; L17-G29 PolarHBondContact N-O 3.11Å; L17-G29 PolarHBondContact O-N 2.87Å; L17-L31 HydrophobicContact CD1-CB 3.77Å; L17-L31 HydrophobicContact CD1-CD2 4.09Å; L17-L31 HydrophobicContact CD1-CG 4.36Å; L17-L31 HydrophobicContact CG-CB 4.35Å; L17-M42 HydrophobicContact CB-CE 4.1Å; L17-L70 HydrophobicContact CD1-CD1 3.84Å; L17-L70 HydrophobicContact CD1-CD2 4.08Å; L17-L70 HydrophobicContact CD1-CG 4Å; L17-L70 HydrophobicContact CD2-CD2 4.12Å; L17-E71 CarbonylContact C-O 3.46Å; L17-E71 WeakPolarHBondContact CA-O 3.35Å; L17-A72 HydrophobicContact CD2-CB 4.03Å
18	S	97.5	Very high	95.5	Very high	6 Å²	6	63.7 Å²	63.7	4%	0.042	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.7	119.5	170.3	169	0	0	0	0	108.2	H26 E71	S18-H26 PolarHBondContact OG-NE2 2.77Å; S18-E71 PolarHBondContact N-O 2.83Å; S18-E71 PolarHBondContact O-N 3.07Å
19	L	97.6	Very high	96.1	Very high	0 Å²	0	56.6 Å²	56.6	0%	0	30%	0.302	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.2	123.8	-177.1	-59	-169.5	0	0	0	111.4	L17 L21 H26 V27 L40 M42 I62 M69 L70	L17-L19 HydrophobicContact CB-CD2 4.39Å; L19-L21 HydrophobicContact CB-CD2 4.12Å; L19-H26 WeakPolarHBondContact O-CA 3.36Å; L19-H26 PolarHBondContact O-CD2 3.11Å; L19-H26 VanDerWaalsContact O-CD2 3.24Å; L19-V27 PolarHBondContact N-O 3.29Å; L19-V27 PolarHBondContact O-N 3.18Å; L19-L40 HydrophobicContact CD1-CD1 3.8Å; L19-L40 HydrophobicContact CD2-CD1 4.39Å; L19-M42 HydrophobicContact CD1-CE 4.26Å; L19-M42 HydrophobicContact CD1-SD 3.19Å; L19-M42 WeakPolarHBondContact CD1-SD 3.21Å; L19-M42 HydrophobicContact CG-CE 4.36Å; L19-M42 HydrophobicContact CG-SD 3.89Å; L19-I62 HydrophobicContact CD1-CD1 3.51Å; L19-M69 WeakPolarHBondContact CA-O 3.46Å; L19-L70 HydrophobicContact CD2-CB 3.63Å; L19-L70 HydrophobicContact CD2-CD1 3.73Å; L19-L70 HydrophobicContact CD2-CG 3.46Å; L19-L70 VanDerWaalsContact CD2-CG 3.46Å
20	K	97.4	Very high	96.4	Very high	100 Å²	100	57.5 Å²	57.5	44%	0.435	31%	0.306	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.3	126.5	165.5	-62.3	-175.6	179.5	175.5	0	108.9	I68 M69	K20-I68 WeakPolarHBondContact O-CB 3.34Å; K20-I68 PolarHBondContact O-N 3.4Å; K20-M69 HydrophobicContact CB-CB 4.14Å; K20-M69 HydrophobicContact CD-CB 4.49Å; K20-M69 HydrophobicContact CD-SD 4.32Å; K20-M69 HydrophobicContact CG-CB 4.49Å; K20-M69 PolarHBondContact N-O 3.07Å; K20-M69 PolarHBondContact O-N 3.25Å
21	L	97.6	Very high	96.7	Very high	11 Å²	11	49.3 Å²	49.3	6%	0.058	27%	0.271	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.5	163	-176.6	-52	179.9	0	0	0	111.2	L19 G24 R25 V27 I62 S66 I67	L19-L21 HydrophobicContact CB-CD2 4.12Å; L21-G24 PolarHBondContact O-N 3.32Å; L21-R25 HydrophobicContact CB-CB 4.19Å; L21-R25 PolarHBondContact N-O 2.82Å; L21-V27 HydrophobicContact CD1-CG2 3.89Å; L21-I62 HydrophobicContact CD1-CD1 4.44Å; L21-I62 HydrophobicContact CD1-CG2 4.44Å; L21-I62 HydrophobicContact CD2-CG2 3.75Å; L21-S66 CarbonylContact C-O 3.58Å; L21-S66 WeakPolarHBondContact CA-O 3.45Å; L21-I67 HydrophobicContact CD2-CG1 4.02Å
22	N	97.3	Very high	96.9	Very high	74 Å²	74	48.6 Å²	48.6	40%	0.396	27%	0.265	S	S	.	.	T	Hydrogen-bonded Turn	trans	-53.4	142.7	171.2	-70.4	-12	0	0	0	111.8	R25 N65 S66 I68	N22-R25 PolarHBondContact O-NE 3.34Å; N22-R25 PolarHBondContact O-NH2 2.85Å; N22-R25 VanDerWaalsContact O-NH2 3.16Å; N22-N65 PolarHBondContact ND2-O 3.43Å; N22-S66 PolarHBondContact N-O 3.3Å; N22-I68 WeakPolarHBondContact OD1-CD1 3.03Å; N22-I68 VanDerWaalsContact OD1-CG1 3.23Å; N22-I68 WeakPolarHBondContact OD1-CG1 3.15Å
23	G	94	Very high	97	Very high	81 Å²	81	47.8 Å²	47.8	84%	0.835	27%	0.266	S	S	*	.	T	Hydrogen-bonded Turn	trans	80.9	19.8	-177.7	0	0	0	0	0	114	R25	G23-R25 PolarHBondContact O-N 2.85Å
24	G	93.4	Very high	97	Very high	78 Å²	78	48.8 Å²	48.8	80%	0.804	27%	0.269	S	S	*	.	T	Hydrogen-bonded Turn	trans	72.2	13.1	177.5	0	0	0	0	0	114.3	L21	L21-G24 PolarHBondContact O-N 3.32Å
25	R	95.2	Very high	96.9	Very high	120 Å²	120	46.6 Å²	46.6	45%	0.453	26%	0.257	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.1	146.4	178.1	-68.1	175.5	-66	159	1.3	110.4	L21 N22 G23	L21-R25 HydrophobicContact CB-CB 4.19Å; L21-R25 PolarHBondContact N-O 2.82Å; N22-R25 PolarHBondContact O-NE 3.34Å; N22-R25 PolarHBondContact O-NH2 2.85Å; N22-R25 VanDerWaalsContact O-NH2 3.16Å; G23-R25 PolarHBondContact O-N 2.85Å
26	H	96.7	Very high	96.6	Very high	47 Å²	47	48.5 Å²	48.5	22%	0.218	28%	0.276	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.1	125.4	179.7	-179.5	-176.7	0	0	0	108.8	S18 L19 M48	S18-H26 PolarHBondContact OG-NE2 2.77Å; L19-H26 WeakPolarHBondContact O-CA 3.36Å; L19-H26 PolarHBondContact O-CD2 3.11Å; L19-H26 VanDerWaalsContact O-CD2 3.24Å; H26-M48 HydrophobicContact CB-CB 3.98Å; H26-M48 HydrophobicContact CB-CG 4.37Å; H26-M48 PolarHBondContact O-N 2.99Å
27	V	97.8	Very high	96.3	Very high	9 Å²	9	52.3 Å²	52.3	6%	0.055	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.7	139	178.3	177	0	0	0	0	109	L19 L21 C45 L46 I57 I62	L19-V27 PolarHBondContact N-O 3.29Å; L19-V27 PolarHBondContact O-N 3.18Å; L21-V27 HydrophobicContact CD1-CG2 3.89Å; V27-C45 HydrophobicContact CG1-CB 3.96Å; V27-L46 CarbonylContact C-O 3.54Å; V27-L46 WeakPolarHBondContact CA-O 3.26Å; V27-I57 HydrophobicContact CG1-CD1 4.27Å; V27-I57 HydrophobicContact CG2-CD1 4.41Å; V27-I62 HydrophobicContact CG1-CD1 4.43Å
28	Q	97.9	Very high	96.1	Very high	32 Å²	32	56.9 Å²	56.9	15%	0.15	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.4	149	167.1	-60.8	-173.1	-0.6	0	0	109.8	L17 C45 L46 M48 L73	L17-Q28 CarbonylContact O-C 3.55Å; L17-Q28 WeakPolarHBondContact O-CA 3.21Å; Q28-C45 CarbonylContact O-C 3.55Å; Q28-C45 WeakPolarHBondContact O-CA 3.4Å; Q28-L46 PolarHBondContact N-O 2.9Å; Q28-L46 PolarHBondContact O-N 2.79Å; Q28-M48 HydrophobicContact CG-CG 4.31Å; Q28-M48 HydrophobicContact CG-SD 4.42Å; Q28-L73 HydrophobicContact CG-CD1 4.3Å
29	G	97.9	Very high	96	Very high	1 Å²	1	58.7 Å²	58.7	1%	0.01	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	171.8	-173.3	175.9	0	0	0	0	0	111.9	K16 L17 M42	K16-G29 CarbonylContact C-O 3.5Å; K16-G29 WeakPolarHBondContact CA-O 3.3Å; L17-G29 PolarHBondContact N-O 3.11Å; L17-G29 PolarHBondContact O-N 2.87Å; G29-M42 WeakPolarHBondContact O-CE 3.44Å
30	I	98.1	Very high	96	Very high	37 Å²	37	58.8 Å²	58.8	19%	0.19	33%	0.326	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98	128.7	-175.2	-57.1	174.6	0	0	0	109.7	K15 R32 M42 D43 D44	K15-I30 WeakPolarHBondContact O-CA 3.36Å; I30-R32 PolarHBondContact O-N 2.96Å; I30-M42 CarbonylContact O-C 3.55Å; I30-M42 WeakPolarHBondContact O-CA 3.3Å; I30-D43 PolarHBondContact N-O 2.76Å; I30-D43 PolarHBondContact O-N 3.16Å; I30-D44 HydrophobicContact CD1-CB 4.41Å
31	L	97.9	Very high	96.1	Very high	0 Å²	0	56.4 Å²	56.4	0%	0	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.4	119.1	175.5	-177.7	65.6	0	0	0	110.8	L9 F12 M13 D14 K15 L17 G33 L40	L9-L31 HydrophobicContact CB-CD2 4.37Å; F12-L31 HydrophobicContact CB-CD2 3.97Å; F12-L31 WeakPolarHBondContact O-CB 3.25Å; M13-L31 HydrophobicContact SD-CD2 4.06Å; M13-L31 HydrophobicContact SD-CG 4.08Å; D14-L31 PolarHBondContact N-O 3.41Å; K15-L31 PolarHBondContact O-N 2.77Å; K15-L31 VanDerWaalsContact O-N 3.11Å; L17-L31 HydrophobicContact CD1-CB 3.77Å; L17-L31 HydrophobicContact CD1-CD2 4.09Å; L17-L31 HydrophobicContact CD1-CG 4.36Å; L17-L31 HydrophobicContact CG-CB 4.35Å; L31-G33 WeakPolarHBondContact CD1-O 3.34Å; L31-L40 HydrophobicContact CD1-CB 4.1Å; L31-L40 HydrophobicContact CD1-CD1 4.43Å; L31-L40 HydrophobicContact CD1-CD2 4.03Å; L31-L40 HydrophobicContact CD1-CG 4.41Å
32	R	98.3	Very high	96.1	Very high	99 Å²	99	55.9 Å²	55.9	37%	0.374	32%	0.317	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.7	-18.2	177	-62.9	-55.4	-167.1	-171.7	-2	114.2	M13 D14 I30 V41 D43	M13-R32 WeakPolarHBondContact CE-O 3.19Å; D14-R32 IonicContact OD1-CZ 2.82Å; D14-R32 IonicContact OD1-NH1 3.7Å; D14-R32 PolarHBondContact OD1-NH1 2.83Å; I30-R32 PolarHBondContact O-N 2.96Å; R32-V41 HydrophobicContact CB-CB 4.47Å; R32-V41 HydrophobicContact CB-CG1 4.19Å; R32-V41 PolarHBondContact N-O 2.83Å; R32-D43 HydrophobicContact CG-CB 3.44Å; R32-D43 VanDerWaalsContact CG-CB 3.44Å; R32-D43 IonicContact CZ-OD2 3.06Å; R32-D43 IonicContact NE-OD2 3.94Å; R32-D43 PolarHBondContact NE-OD2 2.87Å; R32-D43 VanDerWaalsContact NE-OD2 3.08Å; R32-D43 IonicContact NH2-OD2 3.08Å; R32-D43 PolarHBondContact NH2-OD2 3.32Å
33	G	97.3	Very high	96.2	Very high	17 Å²	17	53.9 Å²	53.9	18%	0.175	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-176.1	160	179.8	0	0	0	0	0	112.3	L31 L40 V41	L31-G33 WeakPolarHBondContact CD1-O 3.34Å; G33-L40 WeakPolarHBondContact O-CA 3.5Å; G33-V41 PolarHBondContact N-O 3.03Å; G33-V41 PolarHBondContact O-N 3.35Å
34	F	96.9	Very high	96.3	Very high	76 Å²	76	54.7 Å²	54.7	33%	0.333	29%	0.291	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-149.2	162.6	174.9	66.3	-83.2	0	0	0	110.3	P7 L9 K10 M13 N39 L40	P7-F34 HydrophobicContact CG-CD2 4.27Å; P7-F34 HydrophobicContact CG-CE2 4.43Å; L9-F34 HydrophobicContact CB-CD1 3.77Å; L9-F34 HydrophobicContact CB-CD2 4.01Å; L9-F34 HydrophobicContact CB-CE1 3.89Å; L9-F34 HydrophobicContact CB-CE2 4.11Å; L9-F34 HydrophobicContact CB-CG 3.84Å; L9-F34 HydrophobicContact CB-CZ 4.06Å; L9-F34 HydrophobicContact CD1-CB 4.02Å; L9-F34 HydrophobicContact CD1-CD2 4.2Å; L9-F34 HydrophobicContact CD1-CG 4.08Å; K10-F34 HydrophobicContact CB-CE1 4.49Å; K10-F34 HydrophobicContact CB-CZ 4.37Å; M13-F34 HydrophobicContact CG-CE1 4.42Å; M13-F34 HydrophobicContact SD-CD1 3.87Å; M13-F34 HydrophobicContact SD-CE1 3.99Å; F34-N39 WeakPolarHBondContact CA-O 3.3Å; F34-L40 HydrophobicContact CB-CD2 3.66Å
35	D	94	Very high	96.5	Very high	50 Å²	50	51 Å²	51	27%	0.267	25%	0.253	S	S	.	.			trans	-120.8	174.6	173.9	76.6	12	0	0	0	111.8	F37 M38 N39	D35-F37 PolarHBondContact O-N 3.16Å; D35-F37 VanDerWaalsContact O-N 3.12Å; D35-F37 WeakPolarHBondContact OD1-CA 3.32Å; D35-F37 WeakPolarHBondContact OD1-CB 3.19Å; D35-F37 PolarHBondContact OD1-N 3.05Å; D35-M38 PolarHBondContact O-N 2.89Å; D35-M38 PolarHBondContact OD1-N 2.78Å; D35-M38 VanDerWaalsContact OD1-N 3.15Å; D35-N39 PolarHBondContact N-O 3.36Å; D35-N39 VanDerWaalsContact N-O 3.16Å; D35-N39 PolarHBondContact OD1-N 2.79Å; D35-N39 PolarHBondContact OD1-ND2 2.97Å; D35-N39 WeakPolarHBondContact OD2-CB 3.21Å; D35-N39 PolarHBondContact OD2-ND2 3.24Å
36	P	91.6	Very high	96.7	Very high	107 Å²	107	46.9 Å²	46.9	70%	0.695	24%	0.24	S	C	*	.	T	Hydrogen-bonded Turn	trans	-61.3	-16.7	178.9	-26.2	36.7	0	0	0	115.3	M38	P36-M38 VanDerWaalsContact C-N 3.35Å
37	F	90.8	Very high	96.7	Very high	153 Å²	153	47.9 Å²	47.9	67%	0.671	24%	0.244	S	C	*	.	T	Hydrogen-bonded Turn	trans	-95.1	9.1	177.5	-55.6	-72.9	0	0	0	112.6	D35 N39	D35-F37 PolarHBondContact O-N 3.16Å; D35-F37 VanDerWaalsContact O-N 3.12Å; D35-F37 WeakPolarHBondContact OD1-CA 3.32Å; D35-F37 WeakPolarHBondContact OD1-CB 3.19Å; D35-F37 PolarHBondContact OD1-N 3.05Å; F37-N39 PolarHBondContact O-N 3.28Å
38	M	93.2	Very high	96.6	Very high	96 Å²	96	49.8 Å²	49.8	47%	0.473	25%	0.253	S	S	.	.			trans	60.6	24.4	-174.7	-58.1	-176.7	-67	0	0	113.7	P7 D35 P36 G64	P7-M38 HydrophobicContact CB-CG 3.74Å; P7-M38 HydrophobicContact CB-SD 4.25Å; P7-M38 HydrophobicContact CG-CG 3.74Å; D35-M38 PolarHBondContact O-N 2.89Å; D35-M38 PolarHBondContact OD1-N 2.78Å; D35-M38 VanDerWaalsContact OD1-N 3.15Å; P36-M38 VanDerWaalsContact C-N 3.35Å; M38-G64 WeakPolarHBondContact O-CA 3.39Å
39	N	95.9	Very high	96.2	Very high	45 Å²	45	49.2 Å²	49.2	24%	0.241	26%	0.256	C	S	.	.			trans	-68.8	135.7	163.4	-55.1	-52.2	0	0	0	108	F34 D35 F37 I62 R63 G64	F34-N39 WeakPolarHBondContact CA-O 3.3Å; D35-N39 PolarHBondContact N-O 3.36Å; D35-N39 VanDerWaalsContact N-O 3.16Å; D35-N39 PolarHBondContact OD1-N 2.79Å; D35-N39 PolarHBondContact OD1-ND2 2.97Å; D35-N39 WeakPolarHBondContact OD2-CB 3.21Å; D35-N39 PolarHBondContact OD2-ND2 3.24Å; F37-N39 PolarHBondContact O-N 3.28Å; N39-I62 CarbonylContact C-O 3.58Å; N39-I62 VanDerWaalsContact CA-O 3.26Å; N39-I62 WeakPolarHBondContact CA-O 3.39Å; N39-R63 WeakPolarHBondContact OD1-CA 3.46Å; N39-G64 PolarHBondContact OD1-N 3.15Å
40	L	97.9	Very high	95.7	Very high	1 Å²	1	55 Å²	55	1%	0.005	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.7	138.9	-173.8	-51.9	-176.8	0	0	0	110.3	L9 L19 L31 G33 F34 M42 V61 I62 I67 L70	L9-L40 HydrophobicContact CD1-CD2 3.63Å; L19-L40 HydrophobicContact CD1-CD1 3.8Å; L19-L40 HydrophobicContact CD2-CD1 4.39Å; L31-L40 HydrophobicContact CD1-CB 4.1Å; L31-L40 HydrophobicContact CD1-CD1 4.43Å; L31-L40 HydrophobicContact CD1-CD2 4.03Å; L31-L40 HydrophobicContact CD1-CG 4.41Å; G33-L40 WeakPolarHBondContact O-CA 3.5Å; F34-L40 HydrophobicContact CB-CD2 3.66Å; L40-M42 HydrophobicContact CB-CG 4.33Å; L40-V61 CarbonylContact O-C 3.53Å; L40-V61 WeakPolarHBondContact O-CA 3.37Å; L40-I62 HydrophobicContact CB-CB 4.49Å; L40-I62 PolarHBondContact N-O 2.85Å; L40-I62 PolarHBondContact O-N 3.16Å; L40-I67 HydrophobicContact CD1-CD1 3.46Å; L40-I67 VanDerWaalsContact CD1-CD1 3.46Å; L40-I67 HydrophobicContact CG-CD1 3.71Å; L40-L70 HydrophobicContact CD1-CD1 4.14Å
41	V	98.2	Very high	95.1	Very high	51 Å²	51	57.7 Å²	57.7	31%	0.309	33%	0.331	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.3	120.1	162.4	-176.2	0	0	0	0	106.6	R32 G33 M59 V61	R32-V41 HydrophobicContact CB-CB 4.47Å; R32-V41 HydrophobicContact CB-CG1 4.19Å; R32-V41 PolarHBondContact N-O 2.83Å; G33-V41 PolarHBondContact N-O 3.03Å; G33-V41 PolarHBondContact O-N 3.35Å; V41-M59 HydrophobicContact CG1-CG 4.44Å; V41-V61 HydrophobicContact CG2-CG2 4.45Å
42	M	98.3	Very high	94.5	Very high	0 Å²	0	60.4 Å²	60.4	0%	0	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.4	148.3	176.5	-63.2	-171.6	71.6	0	0	111	L17 L19 G29 I30 L40 C45 M59 V60 I62	L17-M42 HydrophobicContact CB-CE 4.1Å; L19-M42 HydrophobicContact CD1-CE 4.26Å; L19-M42 HydrophobicContact CD1-SD 3.19Å; L19-M42 WeakPolarHBondContact CD1-SD 3.21Å; L19-M42 HydrophobicContact CG-CE 4.36Å; L19-M42 HydrophobicContact CG-SD 3.89Å; G29-M42 WeakPolarHBondContact O-CE 3.44Å; I30-M42 CarbonylContact O-C 3.55Å; I30-M42 WeakPolarHBondContact O-CA 3.3Å; L40-M42 HydrophobicContact CB-CG 4.33Å; M42-C45 WeakPolarHBondContact CB-SG 3.44Å; M42-M59 CarbonylContact O-C 3.54Å; M42-M59 VanDerWaalsContact O-CA 3.31Å; M42-M59 WeakPolarHBondContact O-CA 3.46Å; M42-V60 HydrophobicContact CB-CG2 4.15Å; M42-V60 PolarHBondContact N-O 2.91Å; M42-V60 PolarHBondContact O-N 3.49Å; M42-I62 HydrophobicContact CG-CD1 4.42Å; M42-I62 HydrophobicContact SD-CD1 3.67Å
43	D	98.3	Very high	94.3	Very high	31 Å²	31	61.2 Å²	61.2	17%	0.166	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.3	160.8	-176.5	-168.9	26.3	0	0	0	110.3	I30 R32 C45	I30-D43 PolarHBondContact N-O 2.76Å; I30-D43 PolarHBondContact O-N 3.16Å; R32-D43 HydrophobicContact CG-CB 3.44Å; R32-D43 VanDerWaalsContact CG-CB 3.44Å; R32-D43 IonicContact CZ-OD2 3.06Å; R32-D43 IonicContact NE-OD2 3.94Å; R32-D43 PolarHBondContact NE-OD2 2.87Å; R32-D43 VanDerWaalsContact NE-OD2 3.08Å; R32-D43 IonicContact NH2-OD2 3.08Å; R32-D43 PolarHBondContact NH2-OD2 3.32Å; D43-C45 PolarHBondContact O-N 2.86Å
44	D	97.5	Very high	94.2	Very high	99 Å²	99	65.6 Å²	65.6	53%	0.529	38%	0.383	S	S	.	.	E	Extended strand (participates in β ladder)	trans	48.1	40.7	-173.9	-65.5	-37.7	0	0	0	113.2	I30	I30-D44 HydrophobicContact CD1-CB 4.41Å
45	C	98.1	Very high	94.2	Very high	0 Å²	0	64.9 Å²	64.9	0%	0	38%	0.382	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.9	141.1	-173.2	-80.3	0	0	0	0	113.6	V27 Q28 M42 D43 I57 G58 V60	V27-C45 HydrophobicContact CG1-CB 3.96Å; Q28-C45 CarbonylContact O-C 3.55Å; Q28-C45 WeakPolarHBondContact O-CA 3.4Å; M42-C45 WeakPolarHBondContact CB-SG 3.44Å; D43-C45 PolarHBondContact O-N 2.86Å; C45-I57 HydrophobicContact CB-CD1 3.89Å; C45-I57 HydrophobicContact CB-CG1 3.46Å; C45-I57 VanDerWaalsContact CB-CG1 3.46Å; C45-I57 WeakPolarHBondContact O-CG1 3.48Å; C45-I57 PolarHBondContact O-N 2.89Å; C45-G58 VanDerWaalsContact CB-O 3.25Å; C45-G58 WeakPolarHBondContact CB-O 3.17Å; C45-G58 PolarHBondContact N-O 2.85Å; C45-G58 PolarHBondContact O-N 3.41Å; C45-V60 HydrophobicContact CB-CG2 3.96Å; C45-V60 VanDerWaalsContact SG-CG2 3.54Å
46	L	97.6	Very high	94.3	Very high	34 Å²	34	68 Å²	68	18%	0.178	40%	0.403	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.4	122.5	171.6	-59.9	175	0	0	0	108.9	V27 Q28 N55 T56	V27-L46 CarbonylContact C-O 3.54Å; V27-L46 WeakPolarHBondContact CA-O 3.26Å; Q28-L46 PolarHBondContact N-O 2.9Å; Q28-L46 PolarHBondContact O-N 2.79Å; L46-N55 CarbonylContact C-O 3.55Å; L46-N55 WeakPolarHBondContact CA-O 3.34Å; L46-T56 HydrophobicContact CD2-CG2 4.36Å; L46-T56 WeakPolarHBondContact CD2-OG1 3.09Å
47	E	97	Very high	94.6	Very high	67 Å²	67	66.1 Å²	66.1	31%	0.313	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.8	127.5	165	-178.3	-179	-138.6	0	0	109.3	Q54 N55 I57	E47-Q54 WeakPolarHBondContact O-CA 3.32Å; E47-N55 HydrophobicContact CB-CB 4.34Å; E47-N55 PolarHBondContact N-O 3.27Å; E47-N55 PolarHBondContact O-N 2.83Å; E47-I57 HydrophobicContact CB-CD1 4.35Å; E47-I57 HydrophobicContact CB-CG2 4.27Å
48	M	95.2	Very high	94.9	Very high	49 Å²	49	60 Å²	60	24%	0.241	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.3	101.2	177.5	-52	-64.7	-67.3	0	0	108.7	H26 Q28 Q54	H26-M48 HydrophobicContact CB-CB 3.98Å; H26-M48 HydrophobicContact CB-CG 4.37Å; H26-M48 PolarHBondContact O-N 2.99Å; Q28-M48 HydrophobicContact CG-CG 4.31Å; Q28-M48 HydrophobicContact CG-SD 4.42Å; M48-Q54 HydrophobicContact CE-CG 4.14Å; M48-Q54 HydrophobicContact SD-CG 3.9Å
49	G	89.8	Confident	95.1	Very high	20 Å²	20	61.5 Å²	61.5	21%	0.206	37%	0.374	C	S	.	.			trans	-84.6	174.6	178.6	0	0	0	0	0	113.9	G52 Q53	G49-G52 PolarHBondContact O-N 2.87Å; G49-Q53 PolarHBondContact N-O 3.22Å
50	P	87.3	Confident	95.2	Very high	123 Å²	123	60.8 Å²	60.8	80%	0.799	37%	0.371	S	S	*	.	G	3₁₀ helix	trans	-56.8	144.5	175.9	-20.8	32.1	0	0	0	112	G52 Q53	P50-G52 PolarHBondContact O-N 2.9Å; P50-Q53 PolarHBondContact O-N 3.04Å
51	G	86.1	Confident	95.2	Very high	94 Å²	94	66.2 Å²	66.2	97%	0.969	40%	0.404	S	S	*	.	G	3₁₀ helix	trans	68.6	15.5	177.4	0	0	0	0	0	114.9
52	G	86.6	Confident	95.2	Very high	57 Å²	57	64.4 Å²	64.4	59%	0.588	39%	0.393	S	S	*	.	G	3₁₀ helix	trans	84	10.2	177.9	0	0	0	0	0	114.5	G49 P50 Q54	G49-G52 PolarHBondContact O-N 2.87Å; P50-G52 PolarHBondContact O-N 2.9Å; G52-Q54 PolarHBondContact O-N 2.93Å
53	Q	93	Very high	95.1	Very high	116 Å²	116	72.2 Å²	72.2	54%	0.542	42%	0.422	S	S	.	.			trans	-59.5	136.8	171.6	-173.5	175.6	44.9	0	0	110.1	G49 P50	G49-Q53 PolarHBondContact N-O 3.22Å; P50-Q53 PolarHBondContact O-N 3.04Å
54	Q	95.6	Very high	95	Very high	109 Å²	109	71 Å²	71	51%	0.509	42%	0.416	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.5	121.5	176.6	-63.6	-176.2	0.3	0	0	109.3	E47 M48 G52	E47-Q54 WeakPolarHBondContact O-CA 3.32Å; M48-Q54 HydrophobicContact CE-CG 4.14Å; M48-Q54 HydrophobicContact SD-CG 3.9Å; G52-Q54 PolarHBondContact O-N 2.93Å
55	N	96	Very high	94.9	Very high	60 Å²	60	72 Å²	72	32%	0.321	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.5	122.6	176.8	-61.8	-33.2	0	0	0	109	L46 E47 I57	L46-N55 CarbonylContact C-O 3.55Å; L46-N55 WeakPolarHBondContact CA-O 3.34Å; E47-N55 HydrophobicContact CB-CB 4.34Å; E47-N55 PolarHBondContact N-O 3.27Å; E47-N55 PolarHBondContact O-N 2.83Å; N55-I57 PolarHBondContact O-N 2.84Å
56	T	97.3	Very high	94.9	Very high	115 Å²	115	73.5 Å²	73.5	71%	0.706	43%	0.432	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-75.4	122.2	174.2	-52.9	0	0	0	0	109.7	L46	L46-T56 HydrophobicContact CD2-CG2 4.36Å; L46-T56 WeakPolarHBondContact CD2-OG1 3.09Å
57	I	97.2	Very high	94.9	Very high	69 Å²	69	73.8 Å²	73.8	35%	0.354	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116	-2.5	-178.4	63.7	178.4	0	0	0	112.6	V27 C45 E47 N55 V60	V27-I57 HydrophobicContact CG1-CD1 4.27Å; V27-I57 HydrophobicContact CG2-CD1 4.41Å; C45-I57 HydrophobicContact CB-CD1 3.89Å; C45-I57 HydrophobicContact CB-CG1 3.46Å; C45-I57 VanDerWaalsContact CB-CG1 3.46Å; C45-I57 WeakPolarHBondContact O-CG1 3.48Å; C45-I57 PolarHBondContact O-N 2.89Å; E47-I57 HydrophobicContact CB-CD1 4.35Å; E47-I57 HydrophobicContact CB-CG2 4.27Å; N55-I57 PolarHBondContact O-N 2.84Å; I57-V60 HydrophobicContact CB-CG1 4.25Å; I57-V60 HydrophobicContact CD1-CG1 3.75Å; I57-V60 HydrophobicContact CD1-CG2 4.49Å; I57-V60 HydrophobicContact CG1-CG1 3.78Å
58	G	97.1	Very high	94.9	Very high	25 Å²	25	75.8 Å²	75.8	26%	0.258	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	69.9	-134.7	172.7	0	0	0	0	0	112.7	C45	C45-G58 VanDerWaalsContact CB-O 3.25Å; C45-G58 WeakPolarHBondContact CB-O 3.17Å; C45-G58 PolarHBondContact N-O 2.85Å; C45-G58 PolarHBondContact O-N 3.41Å
59	M	97.6	Very high	94.9	Very high	127 Å²	127	78.2 Å²	78.2	63%	0.626	46%	0.457	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-84.5	126.2	178.6	-173.3	178.3	-67.9	0	0	111.1	V41 M42	V41-M59 HydrophobicContact CG1-CG 4.44Å; M42-M59 CarbonylContact O-C 3.54Å; M42-M59 VanDerWaalsContact O-CA 3.31Å; M42-M59 WeakPolarHBondContact O-CA 3.46Å
60	V	97.6	Very high	95.2	Very high	30 Å²	30	79.7 Å²	79.7	18%	0.182	46%	0.46	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.6	151.8	-177	-59.2	0	0	0	0	112.1	M42 C45 I57 I62	M42-V60 HydrophobicContact CB-CG2 4.15Å; M42-V60 PolarHBondContact N-O 2.91Å; M42-V60 PolarHBondContact O-N 3.49Å; C45-V60 HydrophobicContact CB-CG2 3.96Å; C45-V60 VanDerWaalsContact SG-CG2 3.54Å; I57-V60 HydrophobicContact CB-CG1 4.25Å; I57-V60 HydrophobicContact CD1-CG1 3.75Å; I57-V60 HydrophobicContact CD1-CG2 4.49Å; I57-V60 HydrophobicContact CG1-CG1 3.78Å; V60-I62 HydrophobicContact CG2-CD1 4.29Å; V60-I62 HydrophobicContact CG2-CG1 4.18Å
61	V	97.8	Very high	95.5	Very high	114 Å²	114	78.8 Å²	78.8	69%	0.691	45%	0.445	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-107.4	125.4	169.2	-178.5	0	0	0	0	108.7	L40 V41	L40-V61 CarbonylContact O-C 3.53Å; L40-V61 WeakPolarHBondContact O-CA 3.37Å; V41-V61 HydrophobicContact CG2-CG2 4.45Å
62	I	97.7	Very high	96	Very high	13 Å²	13	75.8 Å²	75.8	7%	0.067	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110	126.9	-179.7	-62.5	173.7	0	0	0	108.9	L19 L21 V27 N39 L40 M42 V60 I67	L19-I62 HydrophobicContact CD1-CD1 3.51Å; L21-I62 HydrophobicContact CD1-CD1 4.44Å; L21-I62 HydrophobicContact CD1-CG2 4.44Å; L21-I62 HydrophobicContact CD2-CG2 3.75Å; V27-I62 HydrophobicContact CG1-CD1 4.43Å; N39-I62 CarbonylContact C-O 3.58Å; N39-I62 VanDerWaalsContact CA-O 3.26Å; N39-I62 WeakPolarHBondContact CA-O 3.39Å; L40-I62 HydrophobicContact CB-CB 4.49Å; L40-I62 PolarHBondContact N-O 2.85Å; L40-I62 PolarHBondContact O-N 3.16Å; M42-I62 HydrophobicContact CG-CD1 4.42Å; M42-I62 HydrophobicContact SD-CD1 3.67Å; V60-I62 HydrophobicContact CG2-CD1 4.29Å; V60-I62 HydrophobicContact CG2-CG1 4.18Å; I62-I67 HydrophobicContact CG2-CD1 4.04Å; I62-I67 HydrophobicContact CG2-CG1 3.72Å
63	R	97.6	Very high	96.3	Very high	165 Å²	165	76.7 Å²	76.7	62%	0.623	40%	0.402	S	S	*	.			trans	-72.3	129.7	176.7	-172.6	-179.3	178.5	119.8	0.6	110.5	N39 N65 S66	N39-R63 WeakPolarHBondContact OD1-CA 3.46Å; R63-N65 VanDerWaalsContact C-N 3.31Å; R63-N65 PolarHBondContact O-N 3.12Å; R63-S66 WeakPolarHBondContact O-CB 3.47Å; R63-S66 PolarHBondContact O-N 2.94Å
64	G	95.4	Very high	96	Very high	4 Å²	4	75.1 Å²	75.1	4%	0.041	40%	0.395	C	S	.	.	G	3₁₀ helix	trans	-54.8	-41.9	-176.5	0	0	0	0	0	113.9	M38 N39 S66 I67	M38-G64 WeakPolarHBondContact O-CA 3.39Å; N39-G64 PolarHBondContact OD1-N 3.15Å; G64-S66 PolarHBondContact O-N 3.04Å; G64-I67 WeakPolarHBondContact O-CB 3.33Å; G64-I67 PolarHBondContact O-N 3.25Å
65	N	96.4	Very high	95.6	Very high	121 Å²	121	81.2 Å²	81.2	65%	0.647	41%	0.413	S	S	*	.	G	3₁₀ helix	trans	-62.5	-15.2	177.2	-67	-0.8	0	0	0	114.6	N22 R63	N22-N65 PolarHBondContact ND2-O 3.43Å; R63-N65 VanDerWaalsContact C-N 3.31Å; R63-N65 PolarHBondContact O-N 3.12Å
66	S	97.3	Very high	94.8	Very high	31 Å²	31	83.1 Å²	83.1	22%	0.217	43%	0.427	C	S	.	.	G	3₁₀ helix	trans	-91.7	-8.7	176.8	-64.1	0	0	0	0	113.2	L21 N22 R63 G64	L21-S66 CarbonylContact C-O 3.58Å; L21-S66 WeakPolarHBondContact CA-O 3.45Å; N22-S66 PolarHBondContact N-O 3.3Å; R63-S66 WeakPolarHBondContact O-CB 3.47Å; R63-S66 PolarHBondContact O-N 2.94Å; G64-S66 PolarHBondContact O-N 3.04Å
67	I	96.8	Very high	94.6	Very high	40 Å²	40	81.5 Å²	81.5	21%	0.205	41%	0.413	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85	119.7	-178.1	-55.6	173.5	0	0	0	108.6	L21 L40 I62 G64	L21-I67 HydrophobicContact CD2-CG1 4.02Å; L40-I67 HydrophobicContact CD1-CD1 3.46Å; L40-I67 VanDerWaalsContact CD1-CD1 3.46Å; L40-I67 HydrophobicContact CG-CD1 3.71Å; I62-I67 HydrophobicContact CG2-CD1 4.04Å; I62-I67 HydrophobicContact CG2-CG1 3.72Å; G64-I67 WeakPolarHBondContact O-CB 3.33Å; G64-I67 PolarHBondContact O-N 3.25Å
68	I	97.1	Very high	94.5	Very high	110 Å²	110	82.2 Å²	82.2	56%	0.564	42%	0.416	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-91	-42.6	174.1	-59.9	176.8	0	0	0	109.8	K20 N22	K20-I68 WeakPolarHBondContact O-CB 3.34Å; K20-I68 PolarHBondContact O-N 3.4Å; N22-I68 WeakPolarHBondContact OD1-CD1 3.03Å; N22-I68 VanDerWaalsContact OD1-CG1 3.23Å; N22-I68 WeakPolarHBondContact OD1-CG1 3.15Å
69	M	95.6	Very high	94.3	Very high	99 Å²	99	85.3 Å²	85.3	49%	0.488	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.6	143.7	-175.4	-174.7	177.8	-76.5	0	0	110.6	L19 K20	L19-M69 WeakPolarHBondContact CA-O 3.46Å; K20-M69 HydrophobicContact CB-CB 4.14Å; K20-M69 HydrophobicContact CD-CB 4.49Å; K20-M69 HydrophobicContact CD-SD 4.32Å; K20-M69 HydrophobicContact CG-CB 4.49Å; K20-M69 PolarHBondContact N-O 3.07Å; K20-M69 PolarHBondContact O-N 3.25Å
70	L	95.3	Very high	94.2	Very high	51 Å²	51	82.9 Å²	82.9	27%	0.267	41%	0.413	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.3	130.2	174.1	-180	158	0	0	0	108.4	L9 F12 L17 L19 L40	L9-L70 HydrophobicContact CD2-CD1 3.75Å; F12-L70 HydrophobicContact CD1-CD2 4.45Å; F12-L70 HydrophobicContact CE1-CD2 4.43Å; L17-L70 HydrophobicContact CD1-CD1 3.84Å; L17-L70 HydrophobicContact CD1-CD2 4.08Å; L17-L70 HydrophobicContact CD1-CG 4Å; L17-L70 HydrophobicContact CD2-CD2 4.12Å; L19-L70 HydrophobicContact CD2-CB 3.63Å; L19-L70 HydrophobicContact CD2-CD1 3.73Å; L19-L70 HydrophobicContact CD2-CG 3.46Å; L19-L70 VanDerWaalsContact CD2-CG 3.46Å; L40-L70 HydrophobicContact CD1-CD1 4.14Å
71	E	95.4	Very high	93.9	Very high	105 Å²	105	86.2 Å²	86.2	49%	0.491	43%	0.427	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.4	135.7	179.6	-178.5	178.4	-167.2	0	0	109.6	L17 S18	L17-E71 CarbonylContact C-O 3.46Å; L17-E71 WeakPolarHBondContact CA-O 3.35Å; S18-E71 PolarHBondContact N-O 2.83Å; S18-E71 PolarHBondContact O-N 3.07Å
72	A	95.1	Very high	93.7	Very high	30 Å²	30	84.3 Å²	84.3	25%	0.248	41%	0.41	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.2	129.4	172.9	0	0	0	0	0	110.2	F12 L17 E74 V76	F12-A72 HydrophobicContact CD1-CB 3.87Å; F12-A72 HydrophobicContact CE1-CB 3.79Å; L17-A72 HydrophobicContact CD2-CB 4.03Å; A72-E74 VanDerWaalsContact C-N 3.29Å; A72-E74 WeakPolarHBondContact CB-O 3.47Å; A72-V76 HydrophobicContact CB-CG2 3.64Å
73	L	93.3	Very high	93.4	Very high	77 Å²	77	89.4 Å²	89.4	40%	0.403	43%	0.434	S	S	.	.	S	Bend	trans	-88.4	-6.7	173.1	-59.4	-176.9	0	0	0	112	K16 Q28	K16-L73 HydrophobicContact CB-CB 4.43Å; K16-L73 HydrophobicContact CD-CD1 4.13Å; K16-L73 HydrophobicContact CG-CD1 4.12Å; K16-L73 PolarHBondContact O-N 2.91Å; Q28-L73 HydrophobicContact CG-CD1 4.3Å
74	E	87.7	Confident	93.1	Very high	83 Å²	83	83.6 Å²	83.6	39%	0.388	42%	0.42	S	S	.	.	S	Bend	trans	-119.2	160.6	177.6	-66	175.8	-160.5	0	0	110.3	K15 K16 A72 V76	K15-E74 HydrophobicContact CD-CB 4.22Å; K15-E74 WeakPolarHBondContact CD-OE2 3.18Å; K15-E74 IonicContact NZ-OE2 3.54Å; K16-E74 HydrophobicContact CB-CG 4.31Å; K16-E74 WeakPolarHBondContact CB-OE1 3.23Å; K16-E74 PolarHBondContact N-OE1 3.32Å; A72-E74 VanDerWaalsContact C-N 3.29Å; A72-E74 WeakPolarHBondContact CB-O 3.47Å; E74-V76 PolarHBondContact O-N 3.25Å
75	R	85.8	Confident	92.9	Very high	236 Å²	236	90.3 Å²	90.3	89%	0.891	45%	0.451	S	S	*	.			trans	-68.3	132.6	174.1	-169.6	174	179.9	170.4	0	110.2
76	V	78.9	Confident	92.6	Very high	100 Å²	100	87.5 Å²	87.5	61%	0.606	43%	0.433	S	S	*	.			trans	-116.9	0	-179.2	179.7	0	0	0	0	110	K11 F12 A72 E74	K11-V76 HydrophobicContact CB-CG1 3.71Å; K11-V76 HydrophobicContact CD-CG1 3.75Å; K11-V76 HydrophobicContact CG-CG1 3.58Å; F12-V76 HydrophobicContact CD1-CB 4.49Å; F12-V76 HydrophobicContact CD1-CG1 4.19Å; F12-V76 HydrophobicContact CD1-CG2 3.62Å; F12-V76 HydrophobicContact CE1-CB 4.3Å; F12-V76 HydrophobicContact CE1-CG1 4.08Å; F12-V76 HydrophobicContact CE1-CG2 3.74Å; F12-V76 HydrophobicContact CZ-CG1 4.49Å; A72-V76 HydrophobicContact CB-CG2 3.64Å; E74-V76 PolarHBondContact O-N 3.25Å

Retrieved 76 of 76 residues in 26.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).