A0A087YEJ4_POEFO Loading...

Biogenesis of lysosome-related organelles complex 1 subunit 1

AlphaFold DB (A0A3B3UH54), UniProt , Accession A0A087YEJ4, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 125 aa.

						>A0A087YEJ4_POEFO|A0A087YEJ4
MLSRLLKEHQAKQNERKELQEKRRREAIAAATCLTEALVDHLNVGVAQAYVNQRKLDHEVKTLQVQASQFSKQTAQWISMVEGFNQALKEIGDVENWARSIEMDMRTIATALEYVHKGQLQTTCS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	75.3	Confident	90.5	Very high	209 Å²	209	126.5 Å²	126.5	100%	1.03	63%	0.633	S	S	*	*				0	-54.7	0	-138.8	179.7	-177.1	0	0	112	S3 R4 L5	M1-S3 PolarHBondContact O-N 2.95Å; M1-R4 PolarHBondContact O-N 3.24Å; M1-L5 PolarHBondContact O-N 3.3Å
2	L	87.1	Confident	90.9	Very high	152 Å²	152	126.6 Å²	126.6	80%	0.796	63%	0.626	S	S	*	*	H	α-helix	trans	-60.2	-43.7	-178.2	-136.7	97.7	0	0	0	114.9	R4 L5 L6	L2-R4 VanDerWaalsContact C-N 3.27Å; L2-R4 PolarHBondContact O-N 3.16Å; L2-L5 WeakPolarHBondContact O-CB 3.5Å; L2-L5 PolarHBondContact O-N 3.32Å; L2-L6 PolarHBondContact O-N 3.37Å
3	S	87.4	Confident	91.3	Very high	91 Å²	91	124.7 Å²	124.7	64%	0.636	62%	0.615	S	S	*	*	H	α-helix	trans	-65.4	-28.7	-177.3	-160.8	0	0	0	0	113.3	M1 K7	M1-S3 PolarHBondContact O-N 2.95Å; S3-K7 PolarHBondContact O-N 3.39Å; S3-K7 VanDerWaalsContact O-N 3.16Å
4	R	89.8	Confident	91.6	Very high	187 Å²	187	121.8 Å²	121.8	71%	0.706	60%	0.603	S	S	*	*	H	α-helix	trans	-74.1	-43.3	175.2	-172	176.2	170.1	165.8	-1.6	111.4	M1 L2 L6 K7 E8	M1-R4 PolarHBondContact O-N 3.24Å; L2-R4 VanDerWaalsContact C-N 3.27Å; L2-R4 PolarHBondContact O-N 3.16Å; R4-L6 VanDerWaalsContact C-N 3.33Å; R4-L6 PolarHBondContact O-N 3.45Å; R4-K7 PolarHBondContact O-N 2.95Å; R4-E8 PolarHBondContact O-N 3.39Å
5	L	91.8	Very high	91.9	Very high	106 Å²	106	122.4 Å²	122.4	56%	0.555	60%	0.604	S	S	*	*	H	α-helix	trans	-60.5	-41.7	173.6	-79.7	157.5	0	0	0	111.8	M1 L2 E8 H9	M1-L5 PolarHBondContact O-N 3.3Å; L2-L5 WeakPolarHBondContact O-CB 3.5Å; L2-L5 PolarHBondContact O-N 3.32Å; L5-E8 PolarHBondContact O-N 3.29Å; L5-H9 WeakPolarHBondContact O-CB 3.44Å; L5-H9 PolarHBondContact O-N 3.32Å
6	L	93.2	Very high	92.2	Very high	111 Å²	111	126.2 Å²	126.2	58%	0.581	61%	0.609	S	S	*	*	H	α-helix	trans	-62.2	-46.1	176.1	-171.2	74.8	0	0	0	111.7	L2 R4 H9 Q10	L2-L6 PolarHBondContact O-N 3.37Å; R4-L6 VanDerWaalsContact C-N 3.33Å; R4-L6 PolarHBondContact O-N 3.45Å; L6-H9 PolarHBondContact O-N 2.97Å; L6-Q10 WeakPolarHBondContact O-CB 3.41Å; L6-Q10 PolarHBondContact O-N 2.97Å
7	K	93.6	Very high	92.5	Very high	166 Å²	166	126.8 Å²	126.8	72%	0.722	61%	0.608	S	S	*	*	H	α-helix	trans	-60.4	-44.9	176.1	-98	-174.8	174.2	-178.6	0	112.8	S3 R4 H9 Q10 A11	S3-K7 PolarHBondContact O-N 3.39Å; S3-K7 VanDerWaalsContact O-N 3.16Å; R4-K7 PolarHBondContact O-N 2.95Å; K7-H9 VanDerWaalsContact C-N 3.34Å; K7-Q10 PolarHBondContact O-N 3.29Å; K7-A11 WeakPolarHBondContact O-CB 3.5Å; K7-A11 PolarHBondContact O-N 2.98Å
8	E	93.5	Very high	92.7	Very high	97 Å²	97	127.6 Å²	127.6	45%	0.453	61%	0.611	S	S	.	*	H	α-helix	trans	-63.4	-40	176.8	-86.4	175.9	-174	0	0	112.3	R4 L5 A11 K12	R4-E8 PolarHBondContact O-N 3.39Å; L5-E8 PolarHBondContact O-N 3.29Å; E8-A11 PolarHBondContact O-N 3.41Å; E8-K12 PolarHBondContact O-N 2.87Å
9	H	93.6	Very high	93	Very high	118 Å²	118	125.7 Å²	125.7	55%	0.546	60%	0.604	S	S	.	*	H	α-helix	trans	-63.1	-47.2	175.6	-173.6	77.7	0	0	0	111.6	L5 L6 K7 A11 K12 Q13	L5-H9 WeakPolarHBondContact O-CB 3.44Å; L5-H9 PolarHBondContact O-N 3.32Å; L6-H9 PolarHBondContact O-N 2.97Å; K7-H9 VanDerWaalsContact C-N 3.34Å; H9-A11 VanDerWaalsContact C-N 3.31Å; H9-A11 PolarHBondContact O-N 3.44Å; H9-K12 PolarHBondContact O-N 3.02Å; H9-Q13 WeakPolarHBondContact O-CB 3.45Å; H9-Q13 PolarHBondContact O-N 3.49Å
10	Q	94.6	Very high	93.1	Very high	95 Å²	95	126.5 Å²	126.5	44%	0.444	61%	0.607	S	S	.	*	H	α-helix	trans	-59.5	-42.6	177.9	-157.3	81	35.6	0	0	111.6	L6 K7 Q13 N14	L6-Q10 WeakPolarHBondContact O-CB 3.41Å; L6-Q10 PolarHBondContact O-N 2.97Å; K7-Q10 PolarHBondContact O-N 3.29Å; Q10-Q13 PolarHBondContact O-N 3.33Å; Q10-N14 PolarHBondContact O-N 3.46Å
11	A	95.5	Very high	93.3	Very high	60 Å²	60	124.4 Å²	124.4	50%	0.496	60%	0.596	S	S	.	*	H	α-helix	trans	-61.9	-48.7	177.1	0	0	0	0	0	111.6	K7 E8 H9 Q13 N14 E15	K7-A11 WeakPolarHBondContact O-CB 3.5Å; K7-A11 PolarHBondContact O-N 2.98Å; E8-A11 PolarHBondContact O-N 3.41Å; H9-A11 VanDerWaalsContact C-N 3.31Å; H9-A11 PolarHBondContact O-N 3.44Å; A11-Q13 VanDerWaalsContact C-N 3.3Å; A11-Q13 PolarHBondContact O-N 3.03Å; A11-N14 PolarHBondContact O-N 3.29Å; A11-E15 WeakPolarHBondContact O-CB 3.33Å; A11-E15 PolarHBondContact O-N 3.45Å
12	K	95.8	Very high	94.4	Very high	127 Å²	127	120.3 Å²	120.3	55%	0.552	57%	0.573	S	S	*	*	H	α-helix	trans	-62.8	-35.5	176	-76.9	-177.9	177.8	176.5	0	112.7	E8 H9 R16	E8-K12 PolarHBondContact O-N 2.87Å; H9-K12 PolarHBondContact O-N 3.02Å; K12-R16 WeakPolarHBondContact O-CB 3.45Å; K12-R16 VanDerWaalsContact O-CG 3.28Å; K12-R16 WeakPolarHBondContact O-CG 3.49Å; K12-R16 PolarHBondContact O-N 2.93Å
13	Q	95.6	Very high	94.9	Very high	102 Å²	102	120.9 Å²	120.9	48%	0.477	57%	0.565	S	S	.	*	H	α-helix	trans	-67.2	-43.6	177.4	-168.7	-177.4	15.8	0	0	111.1	H9 Q10 A11 R16 K17	H9-Q13 WeakPolarHBondContact O-CB 3.45Å; H9-Q13 PolarHBondContact O-N 3.49Å; Q10-Q13 PolarHBondContact O-N 3.33Å; A11-Q13 VanDerWaalsContact C-N 3.3Å; A11-Q13 PolarHBondContact O-N 3.03Å; Q13-R16 PolarHBondContact O-N 3.43Å; Q13-K17 WeakPolarHBondContact O-CB 3.47Å; Q13-K17 PolarHBondContact O-N 2.93Å
14	N	95.6	Very high	95.4	Very high	84 Å²	84	124.2 Å²	124.2	45%	0.449	56%	0.563	S	S	.	*	H	α-helix	trans	-63	-45.4	175	-78.3	-4.1	0	0	0	111.4	Q10 A11 R16 K17 E18	Q10-N14 PolarHBondContact O-N 3.46Å; A11-N14 PolarHBondContact O-N 3.29Å; N14-R16 VanDerWaalsContact C-N 3.34Å; N14-R16 PolarHBondContact O-N 3.4Å; N14-K17 WeakPolarHBondContact O-CB 3.38Å; N14-K17 PolarHBondContact O-N 3.4Å; N14-K17 VanDerWaalsContact O-N 3.1Å; N14-E18 WeakPolarHBondContact O-CG 3.28Å; N14-E18 PolarHBondContact O-N 2.93Å
15	E	96.9	Very high	95.8	Very high	131 Å²	131	123.9 Å²	123.9	61%	0.612	56%	0.562	S	S	*	*	H	α-helix	trans	-58.5	-44.3	176.7	-173.9	-175.4	-166.3	0	0	111.8	A11 K17 E18 L19	A11-E15 WeakPolarHBondContact O-CB 3.33Å; A11-E15 PolarHBondContact O-N 3.45Å; E15-K17 VanDerWaalsContact C-N 3.34Å; E15-K17 PolarHBondContact O-N 2.93Å; E15-E18 PolarHBondContact O-N 3.1Å; E15-L19 WeakPolarHBondContact O-CB 3.48Å; E15-L19 PolarHBondContact O-N 3Å
16	R	96.6	Very high	96.1	Very high	183 Å²	183	123.9 Å²	123.9	69%	0.691	56%	0.559	S	S	*	*	H	α-helix	trans	-61.2	-42.1	174.7	-75.9	175.1	-178.1	-167.6	-0.1	112.1	K12 Q13 N14 L19 Q20	K12-R16 WeakPolarHBondContact O-CB 3.45Å; K12-R16 VanDerWaalsContact O-CG 3.28Å; K12-R16 WeakPolarHBondContact O-CG 3.49Å; K12-R16 PolarHBondContact O-N 2.93Å; Q13-R16 PolarHBondContact O-N 3.43Å; N14-R16 VanDerWaalsContact C-N 3.34Å; N14-R16 PolarHBondContact O-N 3.4Å; R16-L19 PolarHBondContact O-N 3.41Å; R16-Q20 WeakPolarHBondContact O-CB 3.44Å; R16-Q20 PolarHBondContact O-N 2.99Å
17	K	96.5	Very high	96.4	Very high	137 Å²	137	121.5 Å²	121.5	60%	0.596	56%	0.555	S	S	*	*	H	α-helix	trans	-64.7	-45	179.1	-169.6	179.3	179.5	-177.5	0	111.1	Q13 N14 E15 Q20 E21	Q13-K17 WeakPolarHBondContact O-CB 3.47Å; Q13-K17 PolarHBondContact O-N 2.93Å; N14-K17 WeakPolarHBondContact O-CB 3.38Å; N14-K17 PolarHBondContact O-N 3.4Å; N14-K17 VanDerWaalsContact O-N 3.1Å; E15-K17 VanDerWaalsContact C-N 3.34Å; E15-K17 PolarHBondContact O-N 2.93Å; K17-Q20 PolarHBondContact O-N 2.88Å; K17-E21 WeakPolarHBondContact O-CG 3.47Å; K17-E21 PolarHBondContact O-N 3.39Å
18	E	96.8	Very high	96.6	Very high	141 Å²	141	117.9 Å²	117.9	66%	0.659	54%	0.543	S	S	*	.	H	α-helix	trans	-61.8	-43.8	175.8	-73.4	178	-179	0	0	111.8	N14 E15 Q20 E21 K22	N14-E18 WeakPolarHBondContact O-CG 3.28Å; N14-E18 PolarHBondContact O-N 2.93Å; E15-E18 PolarHBondContact O-N 3.1Å; E18-Q20 VanDerWaalsContact C-N 3.32Å; E18-Q20 PolarHBondContact O-N 2.91Å; E18-E21 PolarHBondContact O-N 3.44Å; E18-K22 WeakPolarHBondContact O-CB 3.47Å; E18-K22 PolarHBondContact O-N 3.38Å
19	L	97.4	Very high	96.8	Very high	91 Å²	91	116.2 Å²	116.2	48%	0.476	55%	0.546	S	S	.	.	H	α-helix	trans	-63.5	-39.1	177	-165.7	74.5	0	0	0	111.8	E15 R16 K22 R23	E15-L19 WeakPolarHBondContact O-CB 3.48Å; E15-L19 PolarHBondContact O-N 3Å; R16-L19 PolarHBondContact O-N 3.41Å; L19-K22 PolarHBondContact O-N 3.5Å; L19-R23 WeakPolarHBondContact O-CG 3.49Å; L19-R23 PolarHBondContact O-N 3.36Å
20	Q	96.8	Very high	97	Very high	142 Å²	142	113.6 Å²	113.6	66%	0.664	55%	0.545	S	S	*	.	H	α-helix	trans	-69.3	-40.8	178.6	-161.8	169.1	25.2	0	0	111.7	R16 K17 E18 R23 R24	R16-Q20 WeakPolarHBondContact O-CB 3.44Å; R16-Q20 PolarHBondContact O-N 2.99Å; K17-Q20 PolarHBondContact O-N 2.88Å; E18-Q20 VanDerWaalsContact C-N 3.32Å; E18-Q20 PolarHBondContact O-N 2.91Å; Q20-R23 PolarHBondContact O-N 2.89Å; Q20-R24 WeakPolarHBondContact O-CB 3.34Å; Q20-R24 PolarHBondContact O-N 3.42Å
21	E	97.3	Very high	97.2	Very high	82 Å²	82	111.7 Å²	111.7	38%	0.383	55%	0.545	S	S	.	.	H	α-helix	trans	-63.6	-39.9	172.8	-76.1	-57.7	139.7	0	0	112.1	K17 E18 R24 R25	K17-E21 WeakPolarHBondContact O-CG 3.47Å; K17-E21 PolarHBondContact O-N 3.39Å; E18-E21 PolarHBondContact O-N 3.44Å; E21-R24 PolarHBondContact O-N 3.43Å; E21-R25 WeakPolarHBondContact O-CG 3.26Å; E21-R25 PolarHBondContact O-N 2.97Å
22	K	97.8	Very high	97.4	Very high	124 Å²	124	111.7 Å²	111.7	54%	0.539	54%	0.539	S	S	.	.	H	α-helix	trans	-60.4	-51.7	174.1	-174.9	-179.7	176.2	-177.4	0	111.4	E18 L19 R24 R25 E26	E18-K22 WeakPolarHBondContact O-CB 3.47Å; E18-K22 PolarHBondContact O-N 3.38Å; L19-K22 PolarHBondContact O-N 3.5Å; K22-R24 VanDerWaalsContact C-N 3.29Å; K22-R24 PolarHBondContact O-N 2.94Å; K22-R25 PolarHBondContact O-N 3.4Å; K22-R25 VanDerWaalsContact O-N 3.16Å; K22-E26 WeakPolarHBondContact CE-OE1 3.42Å; K22-E26 WeakPolarHBondContact O-CG 3.33Å; K22-E26 PolarHBondContact O-N 2.89Å
23	R	98	Very high	97.5	Very high	164 Å²	164	109.5 Å²	109.5	62%	0.619	54%	0.538	S	S	*	.	H	α-helix	trans	-60.5	-38.4	177.6	-72.7	179.3	-177.4	-149.5	0.5	112.4	L19 Q20 E26 A27	L19-R23 WeakPolarHBondContact O-CG 3.49Å; L19-R23 PolarHBondContact O-N 3.36Å; Q20-R23 PolarHBondContact O-N 2.89Å; R23-E26 PolarHBondContact O-N 3.36Å; R23-A27 WeakPolarHBondContact O-CB 3.36Å; R23-A27 PolarHBondContact O-N 2.97Å
24	R	98.1	Very high	97.6	Very high	160 Å²	160	109.7 Å²	109.7	60%	0.604	54%	0.542	S	S	*	.	H	α-helix	trans	-61.7	-46.1	175.4	-178.3	-176.9	172	132.3	2.4	111	Q20 E21 K22 A27 I28	Q20-R24 WeakPolarHBondContact O-CB 3.34Å; Q20-R24 PolarHBondContact O-N 3.42Å; E21-R24 PolarHBondContact O-N 3.43Å; K22-R24 VanDerWaalsContact C-N 3.29Å; K22-R24 PolarHBondContact O-N 2.94Å; R24-A27 PolarHBondContact O-N 3.16Å; R24-I28 HydrophobicContact CG-CD1 3.95Å; R24-I28 VanDerWaalsContact O-CG1 3.26Å; R24-I28 WeakPolarHBondContact O-CG1 3.06Å; R24-I28 PolarHBondContact O-N 3.07Å
25	R	98.1	Very high	97.7	Very high	181 Å²	181	109.5 Å²	109.5	68%	0.683	54%	0.544	S	S	*	.	H	α-helix	trans	-62.9	-43.6	176.9	-72	175.8	-173.7	-175.1	1.1	112	E21 K22 I28 A29	E21-R25 WeakPolarHBondContact O-CG 3.26Å; E21-R25 PolarHBondContact O-N 2.97Å; K22-R25 PolarHBondContact O-N 3.4Å; K22-R25 VanDerWaalsContact O-N 3.16Å; R25-I28 PolarHBondContact O-N 2.92Å; R25-A29 WeakPolarHBondContact O-CB 3.42Å; R25-A29 PolarHBondContact O-N 3.32Å
26	E	98.1	Very high	97.8	Very high	106 Å²	106	109.2 Å²	109.2	50%	0.495	54%	0.543	S	S	.	.	H	α-helix	trans	-61.1	-45	176.1	-72.4	170	177.8	0	0	111.6	K22 R23 I28 A29 A30	K22-E26 WeakPolarHBondContact CE-OE1 3.42Å; K22-E26 WeakPolarHBondContact O-CG 3.33Å; K22-E26 PolarHBondContact O-N 2.89Å; R23-E26 PolarHBondContact O-N 3.36Å; E26-I28 PolarHBondContact O-N 3.41Å; E26-A29 PolarHBondContact O-N 3.38Å; E26-A30 WeakPolarHBondContact O-CB 3.38Å; E26-A30 PolarHBondContact O-N 2.99Å
27	A	98.3	Very high	97.9	Very high	61 Å²	61	103.2 Å²	103.2	50%	0.504	53%	0.533	S	S	.	.	H	α-helix	trans	-63.7	-41.5	177.5	0	0	0	0	0	112.3	R23 R24 A30 A31	R23-A27 WeakPolarHBondContact O-CB 3.36Å; R23-A27 PolarHBondContact O-N 2.97Å; R24-A27 PolarHBondContact O-N 3.16Å; A27-A30 PolarHBondContact O-N 3.43Å; A27-A31 WeakPolarHBondContact O-CB 3.41Å; A27-A31 PolarHBondContact O-N 2.94Å
28	I	98.1	Very high	97.9	Very high	90 Å²	90	101.5 Å²	101.5	46%	0.462	53%	0.529	S	S	.	.	H	α-helix	trans	-63.3	-47.9	175.7	-69.3	166.5	0	0	0	110.2	R24 R25 E26 A30 A31 T32	R24-I28 HydrophobicContact CG-CD1 3.95Å; R24-I28 VanDerWaalsContact O-CG1 3.26Å; R24-I28 WeakPolarHBondContact O-CG1 3.06Å; R24-I28 PolarHBondContact O-N 3.07Å; R25-I28 PolarHBondContact O-N 2.92Å; E26-I28 PolarHBondContact O-N 3.41Å; I28-A30 VanDerWaalsContact C-N 3.33Å; I28-A30 PolarHBondContact O-N 2.89Å; I28-A31 PolarHBondContact O-N 3.23Å; I28-T32 PolarHBondContact O-N 3.3Å; I28-T32 PolarHBondContact O-OG1 2.92Å; I28-T32 VanDerWaalsContact O-OG1 3.07Å
29	A	98.3	Very high	98	Very high	62 Å²	62	98.8 Å²	98.8	51%	0.512	52%	0.522	S	S	.	.	H	α-helix	trans	-60.6	-42.6	179.2	0	0	0	0	0	112.1	R25 E26 T32 C33	R25-A29 WeakPolarHBondContact O-CB 3.42Å; R25-A29 PolarHBondContact O-N 3.32Å; E26-A29 PolarHBondContact O-N 3.38Å; A29-T32 PolarHBondContact O-N 2.99Å; A29-C33 WeakPolarHBondContact O-CB 3.46Å; A29-C33 PolarHBondContact O-N 3.47Å
30	A	98.3	Very high	98	Very high	63 Å²	63	99.5 Å²	99.5	52%	0.521	53%	0.526	S	S	.	.	H	α-helix	trans	-63.9	-42.7	176.2	0	0	0	0	0	112	E26 A27 I28 C33 L34	E26-A30 WeakPolarHBondContact O-CB 3.38Å; E26-A30 PolarHBondContact O-N 2.99Å; A27-A30 PolarHBondContact O-N 3.43Å; I28-A30 VanDerWaalsContact C-N 3.33Å; I28-A30 PolarHBondContact O-N 2.89Å; A30-C33 PolarHBondContact O-N 3.42Å; A30-L34 WeakPolarHBondContact O-CB 3.3Å; A30-L34 PolarHBondContact O-N 2.93Å
31	A	98.4	Very high	98	Very high	54 Å²	54	99.6 Å²	99.6	45%	0.446	53%	0.526	S	S	.	.	H	α-helix	trans	-63.6	-44.9	176.6	0	0	0	0	0	111.7	A27 I28 L34 T35	A27-A31 WeakPolarHBondContact O-CB 3.41Å; A27-A31 PolarHBondContact O-N 2.94Å; I28-A31 PolarHBondContact O-N 3.23Å; A31-L34 PolarHBondContact O-N 3.49Å; A31-T35 WeakPolarHBondContact O-CG2 3.44Å; A31-T35 PolarHBondContact O-N 2.91Å; A31-T35 PolarHBondContact O-OG1 3.36Å
32	T	98.2	Very high	98.1	Very high	61 Å²	61	100.9 Å²	100.9	37%	0.374	54%	0.536	S	S	.	.	H	α-helix	trans	-59.7	-49.7	176.8	-58.6	0	0	0	0	111.3	I28 A29 L34 T35 E36	I28-T32 PolarHBondContact O-N 3.3Å; I28-T32 PolarHBondContact O-OG1 2.92Å; I28-T32 VanDerWaalsContact O-OG1 3.07Å; A29-T32 PolarHBondContact O-N 2.99Å; T32-L34 VanDerWaalsContact C-N 3.3Å; T32-L34 PolarHBondContact O-N 3.41Å; T32-T35 WeakPolarHBondContact CA-OG1 3.43Å; T32-T35 PolarHBondContact O-N 2.74Å; T32-T35 VanDerWaalsContact O-N 3.09Å; T32-T35 PolarHBondContact O-OG1 2.99Å; T32-E36 HydrophobicContact CG2-CG 4.46Å; T32-E36 WeakPolarHBondContact CG2-OE1 3.37Å; T32-E36 WeakPolarHBondContact O-CG 3.35Å; T32-E36 PolarHBondContact O-N 3.34Å
33	C	98.4	Very high	98.1	Very high	80 Å²	80	99.4 Å²	99.4	54%	0.541	53%	0.533	S	S	.	.	H	α-helix	trans	-57	-43.9	177.5	179.4	0	0	0	0	111.9	A29 A30 E36 A37	A29-C33 WeakPolarHBondContact O-CB 3.46Å; A29-C33 PolarHBondContact O-N 3.47Å; A30-C33 PolarHBondContact O-N 3.42Å; C33-E36 PolarHBondContact O-N 3.45Å; C33-A37 WeakPolarHBondContact O-CB 3.38Å; C33-A37 PolarHBondContact O-N 3.33Å
34	L	98.1	Very high	98.1	Very high	106 Å²	106	95.6 Å²	95.6	56%	0.555	53%	0.528	S	S	*	.	H	α-helix	trans	-61.6	-45.7	175.5	177.8	63.6	0	0	0	111.7	A30 A31 T32 E36 A37 L38	A30-L34 WeakPolarHBondContact O-CB 3.3Å; A30-L34 PolarHBondContact O-N 2.93Å; A31-L34 PolarHBondContact O-N 3.49Å; T32-L34 VanDerWaalsContact C-N 3.3Å; T32-L34 PolarHBondContact O-N 3.41Å; L34-E36 VanDerWaalsContact C-N 3.35Å; L34-E36 PolarHBondContact O-N 3Å; L34-A37 PolarHBondContact O-N 3.19Å; L34-L38 HydrophobicContact CD1-CD1 4.14Å; L34-L38 HydrophobicContact CD1-CG 4.17Å; L34-L38 HydrophobicContact CG-CD1 3.98Å; L34-L38 HydrophobicContact CG-CG 4.42Å; L34-L38 WeakPolarHBondContact O-CB 3.45Å; L34-L38 VanDerWaalsContact O-CG 3.26Å; L34-L38 WeakPolarHBondContact O-CG 3.36Å; L34-L38 PolarHBondContact O-N 3.26Å
35	T	98.1	Very high	98	Very high	80 Å²	80	89.9 Å²	89.9	49%	0.491	52%	0.519	S	S	.	.	H	α-helix	trans	-64.3	-39	179.7	55.2	0	0	0	0	112.7	A31 T32 L38 V39	A31-T35 WeakPolarHBondContact O-CG2 3.44Å; A31-T35 PolarHBondContact O-N 2.91Å; A31-T35 PolarHBondContact O-OG1 3.36Å; T32-T35 WeakPolarHBondContact CA-OG1 3.43Å; T32-T35 PolarHBondContact O-N 2.74Å; T32-T35 VanDerWaalsContact O-N 3.09Å; T32-T35 PolarHBondContact O-OG1 2.99Å; T35-L38 PolarHBondContact O-N 3.09Å; T35-V39 VanDerWaalsContact O-CG2 3.3Å; T35-V39 WeakPolarHBondContact O-CG2 3.34Å; T35-V39 PolarHBondContact O-N 3.5Å
36	E	98.1	Very high	98.1	Very high	126 Å²	126	84.5 Å²	84.5	59%	0.589	51%	0.506	S	S	*	.	H	α-helix	trans	-63.5	-47.4	175.8	-72.1	173	178.4	0	0	111	T32 C33 L34 L38 V39 D40	T32-E36 HydrophobicContact CG2-CG 4.46Å; T32-E36 WeakPolarHBondContact CG2-OE1 3.37Å; T32-E36 WeakPolarHBondContact O-CG 3.35Å; T32-E36 PolarHBondContact O-N 3.34Å; C33-E36 PolarHBondContact O-N 3.45Å; L34-E36 VanDerWaalsContact C-N 3.35Å; L34-E36 PolarHBondContact O-N 3Å; E36-L38 VanDerWaalsContact C-N 3.33Å; E36-L38 PolarHBondContact O-N 3.48Å; E36-V39 PolarHBondContact O-N 2.93Å; E36-D40 PolarHBondContact O-N 3.23Å
37	A	98	Very high	98.1	Very high	57 Å²	57	82.1 Å²	82.1	47%	0.471	50%	0.504	S	S	.	.	H	α-helix	trans	-61.9	-39.2	177.5	0	0	0	0	0	112.6	C33 L34 H41	C33-A37 WeakPolarHBondContact O-CB 3.38Å; C33-A37 PolarHBondContact O-N 3.33Å; L34-A37 PolarHBondContact O-N 3.19Å; A37-H41 WeakPolarHBondContact O-CB 3.26Å; A37-H41 PolarHBondContact O-N 2.9Å
38	L	98.1	Very high	98.1	Very high	100 Å²	100	83.9 Å²	83.9	52%	0.524	50%	0.502	S	S	.	.	H	α-helix	trans	-66	-42.2	176.4	-74.4	172.9	0	0	0	112	L34 T35 E36 H41 L42	L34-L38 HydrophobicContact CD1-CD1 4.14Å; L34-L38 HydrophobicContact CD1-CG 4.17Å; L34-L38 HydrophobicContact CG-CD1 3.98Å; L34-L38 HydrophobicContact CG-CG 4.42Å; L34-L38 WeakPolarHBondContact O-CB 3.45Å; L34-L38 VanDerWaalsContact O-CG 3.26Å; L34-L38 WeakPolarHBondContact O-CG 3.36Å; L34-L38 PolarHBondContact O-N 3.26Å; T35-L38 PolarHBondContact O-N 3.09Å; E36-L38 VanDerWaalsContact C-N 3.33Å; E36-L38 PolarHBondContact O-N 3.48Å; L38-H41 PolarHBondContact O-N 2.95Å; L38-L42 WeakPolarHBondContact O-CB 3.43Å; L38-L42 PolarHBondContact O-N 3.41Å
39	V	98.2	Very high	98.1	Very high	84 Å²	84	82.2 Å²	82.2	51%	0.509	50%	0.502	S	S	.	.	H	α-helix	trans	-64.7	-45	177.4	168.5	0	0	0	0	110.6	T35 E36 L42 N43	T35-V39 VanDerWaalsContact O-CG2 3.3Å; T35-V39 WeakPolarHBondContact O-CG2 3.34Å; T35-V39 PolarHBondContact O-N 3.5Å; E36-V39 PolarHBondContact O-N 2.93Å; V39-L42 PolarHBondContact O-N 2.97Å; V39-N43 WeakPolarHBondContact CG1-ND2 3.44Å; V39-N43 WeakPolarHBondContact O-CB 3.39Å; V39-N43 PolarHBondContact O-N 3.38Å; V39-N43 PolarHBondContact O-ND2 3Å
40	D	98	Very high	98.1	Very high	106 Å²	106	86.3 Å²	86.3	57%	0.567	51%	0.505	S	S	*	.	H	α-helix	trans	-61.3	-45.9	177.3	-169.2	54.1	0	0	0	111.5	E36 L42 N43 V44	E36-D40 PolarHBondContact O-N 3.23Å; D40-L42 PolarHBondContact O-N 3.16Å; D40-N43 PolarHBondContact O-N 3.45Å; D40-V44 WeakPolarHBondContact O-CG2 3.37Å; D40-V44 PolarHBondContact O-N 3.35Å
41	H	97.1	Very high	98.1	Very high	144 Å²	144	86.6 Å²	86.6	67%	0.667	50%	0.5	S	S	*	.	H	α-helix	trans	-60.2	-43.7	176.6	-173.9	68	0	0	0	112.7	A37 L38 V44 G45	A37-H41 WeakPolarHBondContact O-CB 3.26Å; A37-H41 PolarHBondContact O-N 2.9Å; L38-H41 PolarHBondContact O-N 2.95Å; H41-V44 PolarHBondContact O-N 2.94Å; H41-G45 PolarHBondContact O-N 2.85Å
42	L	97.8	Very high	98.1	Very high	110 Å²	110	87.5 Å²	87.5	58%	0.576	50%	0.498	S	S	*	.	H	α-helix	trans	-62.7	-46	176.9	-164	167.7	0	0	0	110.4	L38 V39 D40 V44 G45 V46	L38-L42 WeakPolarHBondContact O-CB 3.43Å; L38-L42 PolarHBondContact O-N 3.41Å; V39-L42 PolarHBondContact O-N 2.97Å; D40-L42 PolarHBondContact O-N 3.16Å; L42-V44 PolarHBondContact O-N 3.42Å; L42-G45 PolarHBondContact O-N 3.4Å; L42-G45 VanDerWaalsContact O-N 3.16Å; L42-V46 HydrophobicContact CD2-CG2 3.6Å; L42-V46 WeakPolarHBondContact O-CG2 3.43Å; L42-V46 PolarHBondContact O-N 2.95Å
43	N	98	Very high	98.1	Very high	92 Å²	92	89.6 Å²	89.6	49%	0.492	50%	0.503	S	S	.	.	H	α-helix	trans	-59.8	-44.3	179.1	-72.6	-25.7	0	0	0	112	V39 D40 V46 A47	V39-N43 WeakPolarHBondContact CG1-ND2 3.44Å; V39-N43 WeakPolarHBondContact O-CB 3.39Å; V39-N43 PolarHBondContact O-N 3.38Å; V39-N43 PolarHBondContact O-ND2 3Å; D40-N43 PolarHBondContact O-N 3.45Å; N43-V46 PolarHBondContact O-N 3.46Å; N43-A47 WeakPolarHBondContact O-CB 3.41Å; N43-A47 PolarHBondContact O-N 3.4Å
44	V	97.9	Very high	98.1	Very high	85 Å²	85	95.1 Å²	95.1	52%	0.515	51%	0.513	S	S	.	.	H	α-helix	trans	-61.9	-45.5	174.6	173	0	0	0	0	110.8	D40 H41 L42 V46 A47 Q48	D40-V44 WeakPolarHBondContact O-CG2 3.37Å; D40-V44 PolarHBondContact O-N 3.35Å; H41-V44 PolarHBondContact O-N 2.94Å; L42-V44 PolarHBondContact O-N 3.42Å; V44-V46 VanDerWaalsContact C-N 3.35Å; V44-V46 PolarHBondContact O-N 3.04Å; V44-A47 PolarHBondContact O-N 2.93Å; V44-Q48 WeakPolarHBondContact O-CB 3.44Å; V44-Q48 PolarHBondContact O-N 2.91Å
45	G	97.5	Very high	98.2	Very high	39 Å²	39	95.8 Å²	95.8	40%	0.402	51%	0.511	S	S	.	.	H	α-helix	trans	-59.4	-43.5	177.4	0	0	0	0	0	112.8	H41 L42 Q48 A49	H41-G45 PolarHBondContact O-N 2.85Å; L42-G45 PolarHBondContact O-N 3.4Å; L42-G45 VanDerWaalsContact O-N 3.16Å; G45-Q48 PolarHBondContact O-N 3.44Å; G45-A49 WeakPolarHBondContact O-CB 3.37Å; G45-A49 PolarHBondContact O-N 2.95Å
46	V	98.4	Very high	98.2	Very high	69 Å²	69	96.8 Å²	96.8	42%	0.418	51%	0.513	S	S	.	.	H	α-helix	trans	-65.9	-45.1	176.5	168.6	0	0	0	0	111.1	L42 N43 V44 Q48 A49 Y50	L42-V46 HydrophobicContact CD2-CG2 3.6Å; L42-V46 WeakPolarHBondContact O-CG2 3.43Å; L42-V46 PolarHBondContact O-N 2.95Å; N43-V46 PolarHBondContact O-N 3.46Å; V44-V46 VanDerWaalsContact C-N 3.35Å; V44-V46 PolarHBondContact O-N 3.04Å; V46-Q48 VanDerWaalsContact C-N 3.29Å; V46-Q48 PolarHBondContact O-N 3.17Å; V46-A49 WeakPolarHBondContact O-CB 3.48Å; V46-A49 PolarHBondContact O-N 3.37Å; V46-Y50 HydrophobicContact CG1-CD2 3.79Å; V46-Y50 HydrophobicContact CG1-CE2 3.82Å; V46-Y50 WeakPolarHBondContact O-CD2 3.43Å; V46-Y50 PolarHBondContact O-N 2.93Å
47	A	98.1	Very high	98.2	Very high	55 Å²	55	94.6 Å²	94.6	46%	0.455	51%	0.505	S	S	.	.	H	α-helix	trans	-58.6	-42.7	176.6	0	0	0	0	0	111.5	N43 V44 Y50 V51	N43-A47 WeakPolarHBondContact O-CB 3.41Å; N43-A47 PolarHBondContact O-N 3.4Å; V44-A47 PolarHBondContact O-N 2.93Å; A47-Y50 PolarHBondContact O-N 2.94Å; A47-V51 WeakPolarHBondContact O-CG2 3.5Å; A47-V51 PolarHBondContact O-N 3.3Å
48	Q	98.4	Very high	98.2	Very high	98 Å²	98	98 Å²	98	46%	0.458	51%	0.511	S	S	.	.	H	α-helix	trans	-66	-40.4	176.3	-171.9	59.5	56.1	0	0	112.2	V44 G45 V46 Y50 V51 N52	V44-Q48 WeakPolarHBondContact O-CB 3.44Å; V44-Q48 PolarHBondContact O-N 2.91Å; G45-Q48 PolarHBondContact O-N 3.44Å; V46-Q48 VanDerWaalsContact C-N 3.29Å; V46-Q48 PolarHBondContact O-N 3.17Å; Q48-Y50 VanDerWaalsContact C-N 3.32Å; Q48-Y50 PolarHBondContact O-N 3.04Å; Q48-V51 PolarHBondContact O-N 3.38Å; Q48-N52 PolarHBondContact NE2-OD1 3.41Å; Q48-N52 WeakPolarHBondContact O-CB 3.49Å; Q48-N52 VanDerWaalsContact O-CG 3.25Å; Q48-N52 PolarHBondContact O-N 3.24Å; Q48-N52 PolarHBondContact O-OD1 3.4Å
49	A	98.5	Very high	98.3	Very high	56 Å²	56	98.5 Å²	98.5	46%	0.463	51%	0.511	S	S	.	.	H	α-helix	trans	-60.1	-42.8	175.2	0	0	0	0	0	111.5	G45 V46 N52 Q53	G45-A49 WeakPolarHBondContact O-CB 3.37Å; G45-A49 PolarHBondContact O-N 2.95Å; V46-A49 WeakPolarHBondContact O-CB 3.48Å; V46-A49 PolarHBondContact O-N 3.37Å; A49-N52 PolarHBondContact O-N 3.35Å; A49-Q53 WeakPolarHBondContact O-CB 3.44Å; A49-Q53 PolarHBondContact O-N 2.85Å
50	Y	98.6	Very high	98.3	Very high	148 Å²	148	98.6 Å²	98.6	58%	0.58	51%	0.512	S	S	*	.	H	α-helix	trans	-61.6	-43.3	174.1	-93	-76.7	0	0	0	112.8	V46 A47 Q48 N52 Q53 R54	V46-Y50 HydrophobicContact CG1-CD2 3.79Å; V46-Y50 HydrophobicContact CG1-CE2 3.82Å; V46-Y50 WeakPolarHBondContact O-CD2 3.43Å; V46-Y50 PolarHBondContact O-N 2.93Å; A47-Y50 PolarHBondContact O-N 2.94Å; Q48-Y50 VanDerWaalsContact C-N 3.32Å; Q48-Y50 PolarHBondContact O-N 3.04Å; Y50-N52 VanDerWaalsContact C-N 3.33Å; Y50-N52 PolarHBondContact O-N 3.43Å; Y50-Q53 PolarHBondContact O-N 3.5Å; Y50-R54 WeakPolarHBondContact O-CG 3.47Å; Y50-R54 PolarHBondContact O-N 3.46Å
51	V	98.6	Very high	98.3	Very high	69 Å²	69	100.2 Å²	100.2	42%	0.418	51%	0.513	S	S	.	.	H	α-helix	trans	-61.9	-43.9	176	169.7	0	0	0	0	110.8	A47 Q48 R54 K55	A47-V51 WeakPolarHBondContact O-CG2 3.5Å; A47-V51 PolarHBondContact O-N 3.3Å; Q48-V51 PolarHBondContact O-N 3.38Å; V51-R54 PolarHBondContact O-N 3.11Å; V51-K55 HydrophobicContact CG1-CD 4.46Å; V51-K55 WeakPolarHBondContact O-CG 3.46Å; V51-K55 PolarHBondContact O-N 3.38Å; V51-K55 VanDerWaalsContact O-N 3.11Å
52	N	98.6	Very high	98.4	Very high	73 Å²	73	95.9 Å²	95.9	39%	0.39	50%	0.497	S	S	.	.	H	α-helix	trans	-65.2	-42.7	178.5	-69.2	-7.1	0	0	0	111.6	Q48 A49 Y50 R54 K55 L56	Q48-N52 PolarHBondContact NE2-OD1 3.41Å; Q48-N52 WeakPolarHBondContact O-CB 3.49Å; Q48-N52 VanDerWaalsContact O-CG 3.25Å; Q48-N52 PolarHBondContact O-N 3.24Å; Q48-N52 PolarHBondContact O-OD1 3.4Å; A49-N52 PolarHBondContact O-N 3.35Å; Y50-N52 VanDerWaalsContact C-N 3.33Å; Y50-N52 PolarHBondContact O-N 3.43Å; N52-R54 VanDerWaalsContact C-N 3.34Å; N52-R54 PolarHBondContact O-N 3.24Å; N52-K55 PolarHBondContact O-N 2.86Å; N52-L56 WeakPolarHBondContact O-CG 3.27Å; N52-L56 PolarHBondContact O-N 3.19Å
53	Q	98.5	Very high	98.4	Very high	105 Å²	105	95.8 Å²	95.8	49%	0.491	50%	0.497	S	S	.	.	H	α-helix	trans	-57.3	-47.2	175.1	-177.3	179.2	-1.1	0	0	111.3	A49 Y50 K55 L56 D57	A49-Q53 WeakPolarHBondContact O-CB 3.44Å; A49-Q53 PolarHBondContact O-N 2.85Å; Y50-Q53 PolarHBondContact O-N 3.5Å; Q53-K55 VanDerWaalsContact C-N 3.3Å; Q53-K55 PolarHBondContact O-N 3.29Å; Q53-L56 PolarHBondContact O-N 2.91Å; Q53-D57 PolarHBondContact O-N 3.24Å
54	R	98.5	Very high	98.4	Very high	196 Å²	196	98 Å²	98	74%	0.74	50%	0.504	S	S	*	.	H	α-helix	trans	-62.3	-36.1	178	-73.2	-173.9	65.5	-175.7	-0.6	113.2	Y50 V51 N52 H58	Y50-R54 WeakPolarHBondContact O-CG 3.47Å; Y50-R54 PolarHBondContact O-N 3.46Å; V51-R54 PolarHBondContact O-N 3.11Å; N52-R54 VanDerWaalsContact C-N 3.34Å; N52-R54 PolarHBondContact O-N 3.24Å; R54-H58 PolarHBondContact O-N 3.48Å
55	K	98.5	Very high	98.5	Very high	119 Å²	119	97.9 Å²	97.9	52%	0.517	50%	0.504	S	S	.	.	H	α-helix	trans	-66.1	-48.5	174.8	-72.5	177.5	179.8	-179.3	0	110.8	V51 N52 Q53 D57 H58 E59	V51-K55 HydrophobicContact CG1-CD 4.46Å; V51-K55 WeakPolarHBondContact O-CG 3.46Å; V51-K55 PolarHBondContact O-N 3.38Å; V51-K55 VanDerWaalsContact O-N 3.11Å; N52-K55 PolarHBondContact O-N 2.86Å; Q53-K55 VanDerWaalsContact C-N 3.3Å; Q53-K55 PolarHBondContact O-N 3.29Å; K55-D57 VanDerWaalsContact C-N 3.34Å; K55-D57 PolarHBondContact O-N 3.43Å; K55-H58 WeakPolarHBondContact O-CB 3.32Å; K55-H58 PolarHBondContact O-N 2.84Å; K55-H58 VanDerWaalsContact O-N 3.11Å; K55-E59 WeakPolarHBondContact O-CG 3.44Å; K55-E59 PolarHBondContact O-N 3.19Å
56	L	98.7	Very high	98.5	Very high	101 Å²	101	100.1 Å²	100.1	53%	0.529	50%	0.504	S	S	.	.	H	α-helix	trans	-58.6	-44.4	176.6	-72.7	171.6	0	0	0	111.7	N52 Q53 H58 E59 V60	N52-L56 WeakPolarHBondContact O-CG 3.27Å; N52-L56 PolarHBondContact O-N 3.19Å; Q53-L56 PolarHBondContact O-N 2.91Å; L56-H58 PolarHBondContact O-N 2.92Å; L56-E59 PolarHBondContact O-N 3.35Å; L56-V60 WeakPolarHBondContact O-CB 3.39Å; L56-V60 VanDerWaalsContact O-CG2 3.27Å; L56-V60 WeakPolarHBondContact O-CG2 3.47Å; L56-V60 PolarHBondContact O-N 3.2Å
57	D	98.5	Very high	98.5	Very high	80 Å²	80	99.8 Å²	99.8	43%	0.428	51%	0.508	S	S	.	.	H	α-helix	trans	-59.3	-36.5	177.1	-73.8	-20.2	0	0	0	112.3	Q53 K55 K61	Q53-D57 PolarHBondContact O-N 3.24Å; K55-D57 VanDerWaalsContact C-N 3.34Å; K55-D57 PolarHBondContact O-N 3.43Å; D57-K61 WeakPolarHBondContact O-CG 3.45Å; D57-K61 PolarHBondContact O-N 2.96Å
58	H	98.5	Very high	98.6	Very high	129 Å²	129	100 Å²	100	60%	0.597	51%	0.506	S	S	*	.	H	α-helix	trans	-71.5	-43.6	176.5	-177.4	68.5	0	0	0	112.2	R54 K55 L56 K61 T62	R54-H58 PolarHBondContact O-N 3.48Å; K55-H58 WeakPolarHBondContact O-CB 3.32Å; K55-H58 PolarHBondContact O-N 2.84Å; K55-H58 VanDerWaalsContact O-N 3.11Å; L56-H58 PolarHBondContact O-N 2.92Å; H58-K61 PolarHBondContact O-N 2.91Å; H58-T62 WeakPolarHBondContact O-CB 3.43Å; H58-T62 PolarHBondContact O-N 3.39Å; H58-T62 PolarHBondContact O-OG1 3.42Å
59	E	98.6	Very high	98.6	Very high	110 Å²	110	100.3 Å²	100.3	51%	0.514	51%	0.507	S	S	.	.	H	α-helix	trans	-61.8	-43.7	176.4	-72.2	175.6	-168.3	0	0	111.2	K55 L56 K61 T62 L63	K55-E59 WeakPolarHBondContact O-CG 3.44Å; K55-E59 PolarHBondContact O-N 3.19Å; L56-E59 PolarHBondContact O-N 3.35Å; E59-K61 PolarHBondContact O-N 3.11Å; E59-T62 PolarHBondContact O-N 3.27Å; E59-L63 WeakPolarHBondContact O-CB 3.49Å; E59-L63 WeakPolarHBondContact O-CG 3.33Å; E59-L63 PolarHBondContact O-N 2.92Å
60	V	98.6	Very high	98.6	Very high	87 Å²	87	103.5 Å²	103.5	53%	0.527	51%	0.511	S	S	.	.	H	α-helix	trans	-59.8	-47.3	176.4	168.7	0	0	0	0	111.3	L56 T62 L63 Q64	L56-V60 WeakPolarHBondContact O-CB 3.39Å; L56-V60 VanDerWaalsContact O-CG2 3.27Å; L56-V60 WeakPolarHBondContact O-CG2 3.47Å; L56-V60 PolarHBondContact O-N 3.2Å; V60-T62 VanDerWaalsContact C-N 3.31Å; V60-T62 PolarHBondContact O-N 2.9Å; V60-L63 PolarHBondContact O-N 2.98Å; V60-Q64 WeakPolarHBondContact O-CB 3.41Å; V60-Q64 PolarHBondContact O-N 3.09Å
61	K	98.6	Very high	98.6	Very high	139 Å²	139	100.4 Å²	100.4	60%	0.604	51%	0.511	S	S	*	.	H	α-helix	trans	-61.3	-42.3	177.2	-75.3	174.6	-175.3	176.9	0	111.7	D57 H58 E59 Q64 V65	D57-K61 WeakPolarHBondContact O-CG 3.45Å; D57-K61 PolarHBondContact O-N 2.96Å; H58-K61 PolarHBondContact O-N 2.91Å; E59-K61 PolarHBondContact O-N 3.11Å; K61-Q64 PolarHBondContact O-N 2.85Å; K61-V65 WeakPolarHBondContact O-CG2 3.38Å; K61-V65 PolarHBondContact O-N 3.08Å; K61-V65 VanDerWaalsContact O-N 3.09Å
62	T	98.6	Very high	98.6	Very high	53 Å²	53	103.7 Å²	103.7	33%	0.325	52%	0.519	S	S	.	.	H	α-helix	trans	-62.7	-48.1	177.9	-60.1	0	0	0	0	111	H58 E59 V60 Q64 V65 Q66	H58-T62 WeakPolarHBondContact O-CB 3.43Å; H58-T62 PolarHBondContact O-N 3.39Å; H58-T62 PolarHBondContact O-OG1 3.42Å; E59-T62 PolarHBondContact O-N 3.27Å; V60-T62 VanDerWaalsContact C-N 3.31Å; V60-T62 PolarHBondContact O-N 2.9Å; T62-Q64 VanDerWaalsContact C-N 3.33Å; T62-Q64 PolarHBondContact O-N 3.33Å; T62-V65 PolarHBondContact O-N 3.47Å; T62-Q66 WeakPolarHBondContact O-CG 3.44Å; T62-Q66 PolarHBondContact O-N 3.23Å
63	L	98.7	Very high	98.6	Very high	109 Å²	109	103.7 Å²	103.7	57%	0.571	52%	0.517	S	S	*	.	H	α-helix	trans	-59.3	-42.5	176.8	-78.9	166.9	0	0	0	111.9	E59 V60 V65 Q66 A67	E59-L63 WeakPolarHBondContact O-CB 3.49Å; E59-L63 WeakPolarHBondContact O-CG 3.33Å; E59-L63 PolarHBondContact O-N 2.92Å; V60-L63 PolarHBondContact O-N 2.98Å; L63-V65 PolarHBondContact O-N 3.31Å; L63-Q66 PolarHBondContact O-N 3.41Å; L63-A67 WeakPolarHBondContact O-CB 3.38Å; L63-A67 PolarHBondContact O-N 3.4Å
64	Q	98.6	Very high	98.6	Very high	137 Å²	137	101.9 Å²	101.9	64%	0.64	51%	0.514	S	S	*	.	H	α-helix	trans	-61.9	-43.5	177.8	-174.2	179.3	2	0	0	112.1	V60 K61 T62 S68	V60-Q64 WeakPolarHBondContact O-CB 3.41Å; V60-Q64 PolarHBondContact O-N 3.09Å; K61-Q64 PolarHBondContact O-N 2.85Å; T62-Q64 VanDerWaalsContact C-N 3.33Å; T62-Q64 PolarHBondContact O-N 3.33Å; Q64-S68 PolarHBondContact O-N 2.98Å; Q64-S68 VanDerWaalsContact O-N 3.08Å
65	V	98.6	Very high	98.6	Very high	84 Å²	84	95.3 Å²	95.3	51%	0.509	50%	0.501	S	S	.	.	H	α-helix	trans	-63	-46.9	176.3	171	0	0	0	0	110.6	K61 T62 L63 S68 Q69	K61-V65 WeakPolarHBondContact O-CG2 3.38Å; K61-V65 PolarHBondContact O-N 3.08Å; K61-V65 VanDerWaalsContact O-N 3.09Å; T62-V65 PolarHBondContact O-N 3.47Å; L63-V65 PolarHBondContact O-N 3.31Å; V65-S68 PolarHBondContact O-N 3.25Å; V65-Q69 WeakPolarHBondContact O-CG 3.36Å; V65-Q69 PolarHBondContact O-N 2.84Å
66	Q	98.6	Very high	98.6	Very high	86 Å²	86	95.7 Å²	95.7	40%	0.402	51%	0.505	S	S	.	.	H	α-helix	trans	-61.9	-44.8	178.7	-72.3	175.7	-10.5	0	0	111.9	T62 L63 S68 Q69 F70	T62-Q66 WeakPolarHBondContact O-CG 3.44Å; T62-Q66 PolarHBondContact O-N 3.23Å; L63-Q66 PolarHBondContact O-N 3.41Å; Q66-S68 VanDerWaalsContact C-N 3.32Å; Q66-S68 PolarHBondContact O-N 3.05Å; Q66-Q69 PolarHBondContact O-N 3.47Å; Q66-Q69 VanDerWaalsContact O-N 3.15Å; Q66-F70 HydrophobicContact CB-CE2 4.31Å; Q66-F70 VanDerWaalsContact O-CD2 3.26Å; Q66-F70 WeakPolarHBondContact O-CD2 3.41Å; Q66-F70 WeakPolarHBondContact O-CG 3.46Å; Q66-F70 PolarHBondContact O-N 3.48Å
67	A	98.7	Very high	98.6	Very high	61 Å²	61	98.3 Å²	98.3	50%	0.504	51%	0.508	S	S	.	.	H	α-helix	trans	-59.8	-42.1	177.1	0	0	0	0	0	112.1	L63 F70 S71	L63-A67 WeakPolarHBondContact O-CB 3.38Å; L63-A67 PolarHBondContact O-N 3.4Å; A67-F70 PolarHBondContact O-N 2.96Å; A67-S71 WeakPolarHBondContact O-CB 3.26Å; A67-S71 PolarHBondContact O-N 3.11Å
68	S	98.6	Very high	98.6	Very high	59 Å²	59	98.8 Å²	98.8	41%	0.413	51%	0.509	S	S	.	.	H	α-helix	trans	-64.5	-40.6	175	-178	0	0	0	0	112.2	Q64 V65 Q66 S71 K72	Q64-S68 PolarHBondContact O-N 2.98Å; Q64-S68 VanDerWaalsContact O-N 3.08Å; V65-S68 PolarHBondContact O-N 3.25Å; Q66-S68 VanDerWaalsContact C-N 3.32Å; Q66-S68 PolarHBondContact O-N 3.05Å; S68-S71 PolarHBondContact O-N 2.86Å; S68-K72 WeakPolarHBondContact O-CG 3.49Å; S68-K72 PolarHBondContact O-N 3.42Å; S68-K72 VanDerWaalsContact O-N 3.11Å
69	Q	98.7	Very high	98.6	Very high	105 Å²	105	96.1 Å²	96.1	49%	0.491	51%	0.505	S	S	.	.	H	α-helix	trans	-64.3	-45.4	176.3	-72.3	175.6	5.1	0	0	111.8	V65 Q66 S71 K72 Q73	V65-Q69 WeakPolarHBondContact O-CG 3.36Å; V65-Q69 PolarHBondContact O-N 2.84Å; Q66-Q69 PolarHBondContact O-N 3.47Å; Q66-Q69 VanDerWaalsContact O-N 3.15Å; Q69-S71 PolarHBondContact O-N 2.95Å; Q69-K72 PolarHBondContact O-N 3.43Å; Q69-Q73 WeakPolarHBondContact O-CG 3.41Å; Q69-Q73 PolarHBondContact O-N 3.49Å
70	F	98.6	Very high	98.6	Very high	124 Å²	124	97.5 Å²	97.5	54%	0.544	51%	0.514	S	S	.	.	H	α-helix	trans	-61.9	-43.8	176.7	-71.5	-45.5	0	0	0	111.9	Q66 A67 K72 Q73 T74	Q66-F70 HydrophobicContact CB-CE2 4.31Å; Q66-F70 VanDerWaalsContact O-CD2 3.26Å; Q66-F70 WeakPolarHBondContact O-CD2 3.41Å; Q66-F70 WeakPolarHBondContact O-CG 3.46Å; Q66-F70 PolarHBondContact O-N 3.48Å; A67-F70 PolarHBondContact O-N 2.96Å; F70-K72 VanDerWaalsContact C-N 3.29Å; F70-K72 PolarHBondContact O-N 2.97Å; F70-Q73 PolarHBondContact O-N 3.45Å; F70-Q73 VanDerWaalsContact O-N 3.15Å; F70-T74 PolarHBondContact O-N 3.23Å; F70-T74 PolarHBondContact O-OG1 3.01Å
71	S	98.6	Very high	98.6	Very high	82 Å²	82	97.3 Å²	97.3	57%	0.573	51%	0.512	S	S	*	.	H	α-helix	trans	-56.6	-43	175.3	177.7	0	0	0	0	112.2	A67 S68 Q69 T74 A75	A67-S71 WeakPolarHBondContact O-CB 3.26Å; A67-S71 PolarHBondContact O-N 3.11Å; S68-S71 PolarHBondContact O-N 2.86Å; Q69-S71 PolarHBondContact O-N 2.95Å; S71-T74 PolarHBondContact O-N 3.15Å; S71-A75 PolarHBondContact O-N 3.05Å
72	K	98.7	Very high	98.6	Very high	138 Å²	138	96.5 Å²	96.5	60%	0.6	51%	0.511	S	S	*	.	H	α-helix	trans	-63.9	-44.8	175.5	-71.8	176.3	-178.1	-179.1	0	112.3	S68 Q69 F70 A75 Q76	S68-K72 WeakPolarHBondContact O-CG 3.49Å; S68-K72 PolarHBondContact O-N 3.42Å; S68-K72 VanDerWaalsContact O-N 3.11Å; Q69-K72 PolarHBondContact O-N 3.43Å; F70-K72 VanDerWaalsContact C-N 3.29Å; F70-K72 PolarHBondContact O-N 2.97Å; K72-A75 PolarHBondContact O-N 2.84Å; K72-Q76 WeakPolarHBondContact O-CG 3.44Å; K72-Q76 PolarHBondContact O-N 3.04Å
73	Q	98.7	Very high	98.6	Very high	74 Å²	74	96 Å²	96	35%	0.346	52%	0.517	S	S	.	.	H	α-helix	trans	-63.3	-42.8	178.3	-71.5	176.2	14.2	0	0	111.5	Q69 F70 A75 Q76 W77	Q69-Q73 WeakPolarHBondContact O-CG 3.41Å; Q69-Q73 PolarHBondContact O-N 3.49Å; F70-Q73 PolarHBondContact O-N 3.45Å; F70-Q73 VanDerWaalsContact O-N 3.15Å; Q73-A75 VanDerWaalsContact C-N 3.34Å; Q73-A75 PolarHBondContact O-N 3.15Å; Q73-Q76 WeakPolarHBondContact O-CB 3.36Å; Q73-Q76 PolarHBondContact O-N 2.93Å; Q73-Q76 VanDerWaalsContact O-N 3.17Å; Q73-W77 PolarHBondContact O-N 3.33Å
74	T	98.8	Very high	98.6	Very high	67 Å²	67	97 Å²	97	41%	0.411	52%	0.517	S	S	.	.	H	α-helix	trans	-60.5	-43.3	175.9	-56.3	0	0	0	0	111.5	F70 S71 Q76 W77 I78	F70-T74 PolarHBondContact O-N 3.23Å; F70-T74 PolarHBondContact O-OG1 3.01Å; S71-T74 PolarHBondContact O-N 3.15Å; T74-Q76 VanDerWaalsContact C-N 3.32Å; T74-Q76 PolarHBondContact O-N 2.97Å; T74-W77 PolarHBondContact O-N 3.26Å; T74-I78 HydrophobicContact CG2-CD1 4.17Å; T74-I78 WeakPolarHBondContact O-CG1 3.34Å; T74-I78 PolarHBondContact O-N 3.43Å
75	A	98.6	Very high	98.6	Very high	58 Å²	58	94.2 Å²	94.2	48%	0.479	51%	0.506	S	S	.	.	H	α-helix	trans	-61.7	-39.5	175.7	0	0	0	0	0	112.4	S71 K72 Q73 I78 S79	S71-A75 PolarHBondContact O-N 3.05Å; K72-A75 PolarHBondContact O-N 2.84Å; Q73-A75 VanDerWaalsContact C-N 3.34Å; Q73-A75 PolarHBondContact O-N 3.15Å; A75-I78 PolarHBondContact O-N 3.32Å; A75-S79 PolarHBondContact O-N 3.17Å
76	Q	98.7	Very high	98.6	Very high	127 Å²	127	94.3 Å²	94.3	59%	0.593	50%	0.501	S	S	*	.	H	α-helix	trans	-64.4	-42.3	175.2	-71.3	172	-13.2	0	0	112.2	K72 Q73 T74 S79 M80	K72-Q76 WeakPolarHBondContact O-CG 3.44Å; K72-Q76 PolarHBondContact O-N 3.04Å; Q73-Q76 WeakPolarHBondContact O-CB 3.36Å; Q73-Q76 PolarHBondContact O-N 2.93Å; Q73-Q76 VanDerWaalsContact O-N 3.17Å; T74-Q76 VanDerWaalsContact C-N 3.32Å; T74-Q76 PolarHBondContact O-N 2.97Å; Q76-S79 PolarHBondContact O-N 2.98Å; Q76-M80 PolarHBondContact O-N 2.92Å
77	W	98.8	Very high	98.6	Very high	155 Å²	155	92.3 Å²	92.3	59%	0.587	50%	0.499	S	S	*	.	H	α-helix	trans	-64.2	-40.4	176.1	-65.3	-21.2	0	0	0	112.4	Q73 T74 M80 V81	Q73-W77 PolarHBondContact O-N 3.33Å; T74-W77 PolarHBondContact O-N 3.26Å; W77-M80 PolarHBondContact O-N 2.99Å; W77-V81 WeakPolarHBondContact O-CG2 3.38Å; W77-V81 PolarHBondContact O-N 3.35Å
78	I	98.6	Very high	98.6	Very high	90 Å²	90	93.5 Å²	93.5	46%	0.462	50%	0.496	S	S	.	.	H	α-helix	trans	-58.1	-51	174	-70.1	167.5	0	0	0	110	T74 A75 M80 V81 E82	T74-I78 HydrophobicContact CG2-CD1 4.17Å; T74-I78 WeakPolarHBondContact O-CG1 3.34Å; T74-I78 PolarHBondContact O-N 3.43Å; A75-I78 PolarHBondContact O-N 3.32Å; I78-M80 VanDerWaalsContact C-N 3.27Å; I78-M80 PolarHBondContact O-N 2.87Å; I78-V81 PolarHBondContact O-N 3.12Å; I78-V81 VanDerWaalsContact O-N 3.12Å; I78-E82 HydrophobicContact CG2-CG 4.31Å; I78-E82 WeakPolarHBondContact O-CG 3.45Å; I78-E82 PolarHBondContact O-N 3.29Å
79	S	98.6	Very high	98.6	Very high	74 Å²	74	96.9 Å²	96.9	52%	0.517	50%	0.504	S	S	.	.	H	α-helix	trans	-59.3	-37.9	179.1	179.3	0	0	0	0	112.7	A75 Q76 E82 G83	A75-S79 PolarHBondContact O-N 3.17Å; Q76-S79 PolarHBondContact O-N 2.98Å; S79-E82 PolarHBondContact O-N 3.36Å; S79-G83 PolarHBondContact O-N 3.27Å
80	M	98.6	Very high	98.6	Very high	139 Å²	139	96.9 Å²	96.9	69%	0.685	50%	0.504	S	S	*	.	H	α-helix	trans	-65.4	-42.9	176.3	-171.8	179	-64.3	0	0	112.1	Q76 W77 I78 G83 F84	Q76-M80 PolarHBondContact O-N 2.92Å; W77-M80 PolarHBondContact O-N 2.99Å; I78-M80 VanDerWaalsContact C-N 3.27Å; I78-M80 PolarHBondContact O-N 2.87Å; M80-G83 PolarHBondContact O-N 3.46Å; M80-F84 WeakPolarHBondContact O-CB 3.37Å; M80-F84 PolarHBondContact O-N 3.4Å
81	V	98.7	Very high	98.6	Very high	83 Å²	83	96.2 Å²	96.2	50%	0.503	51%	0.505	S	S	.	.	H	α-helix	trans	-66.9	-40.2	177	172.3	0	0	0	0	111.2	W77 I78 F84 N85	W77-V81 WeakPolarHBondContact O-CG2 3.38Å; W77-V81 PolarHBondContact O-N 3.35Å; I78-V81 PolarHBondContact O-N 3.12Å; I78-V81 VanDerWaalsContact O-N 3.12Å; V81-F84 PolarHBondContact O-N 3.13Å; V81-N85 WeakPolarHBondContact O-CB 3.45Å; V81-N85 PolarHBondContact O-N 2.94Å; V81-N85 PolarHBondContact O-ND2 2.88Å
82	E	98.6	Very high	98.6	Very high	121 Å²	121	93.8 Å²	93.8	57%	0.565	49%	0.493	S	S	*	.	H	α-helix	trans	-61.5	-45.8	174.4	-73	173.6	167.1	0	0	111.5	I78 S79 F84 N85 Q86	I78-E82 HydrophobicContact CG2-CG 4.31Å; I78-E82 WeakPolarHBondContact O-CG 3.45Å; I78-E82 PolarHBondContact O-N 3.29Å; S79-E82 PolarHBondContact O-N 3.36Å; E82-F84 VanDerWaalsContact C-N 3.34Å; E82-F84 PolarHBondContact O-N 3.32Å; E82-N85 PolarHBondContact O-N 3.29Å; E82-Q86 PolarHBondContact O-N 3.33Å
83	G	98.6	Very high	98.5	Very high	44 Å²	44	91.5 Å²	91.5	45%	0.454	49%	0.487	S	S	.	.	H	α-helix	trans	-60.9	-41.8	175	0	0	0	0	0	112.6	S79 M80 Q86 A87	S79-G83 PolarHBondContact O-N 3.27Å; M80-G83 PolarHBondContact O-N 3.46Å; G83-Q86 PolarHBondContact O-N 3.06Å; G83-A87 PolarHBondContact O-N 3Å
84	F	98.4	Very high	98.5	Very high	130 Å²	130	92 Å²	92	57%	0.57	50%	0.495	S	S	*	.	H	α-helix	trans	-62.7	-45.7	174.9	178.8	-104.4	0	0	0	112.3	M80 V81 E82 Q86 A87 L88	M80-F84 WeakPolarHBondContact O-CB 3.37Å; M80-F84 PolarHBondContact O-N 3.4Å; V81-F84 PolarHBondContact O-N 3.13Å; E82-F84 VanDerWaalsContact C-N 3.34Å; E82-F84 PolarHBondContact O-N 3.32Å; F84-Q86 VanDerWaalsContact C-N 3.26Å; F84-Q86 PolarHBondContact O-N 3.25Å; F84-A87 PolarHBondContact O-N 3.37Å; F84-L88 HydrophobicContact CD1-CD1 4.02Å; F84-L88 HydrophobicContact CE1-CD1 3.45Å; F84-L88 VanDerWaalsContact CE1-CD1 3.45Å; F84-L88 HydrophobicContact CE1-CG 4.09Å; F84-L88 HydrophobicContact CZ-CD1 3.86Å; F84-L88 HydrophobicContact CZ-CD2 4.27Å; F84-L88 HydrophobicContact CZ-CG 4.12Å; F84-L88 PolarHBondContact O-N 2.87Å
85	N	98.6	Very high	98.5	Very high	78 Å²	78	94.1 Å²	94.1	42%	0.417	50%	0.5	S	S	.	.	H	α-helix	trans	-61.8	-35.7	176.5	-77.3	-26.1	0	0	0	112.2	V81 E82 L88 K89	V81-N85 WeakPolarHBondContact O-CB 3.45Å; V81-N85 PolarHBondContact O-N 2.94Å; V81-N85 PolarHBondContact O-ND2 2.88Å; E82-N85 PolarHBondContact O-N 3.29Å; N85-L88 PolarHBondContact O-N 3.46Å; N85-K89 WeakPolarHBondContact O-CG 3.4Å; N85-K89 PolarHBondContact O-N 3.49Å; N85-K89 VanDerWaalsContact O-N 3.16Å
86	Q	98.7	Very high	98.5	Very high	86 Å²	86	95.2 Å²	95.2	40%	0.402	50%	0.498	S	S	.	.	H	α-helix	trans	-66.1	-45.6	176	-176.9	54.4	37.4	0	0	111.4	E82 G83 F84 L88 K89 E90	E82-Q86 PolarHBondContact O-N 3.33Å; G83-Q86 PolarHBondContact O-N 3.06Å; F84-Q86 VanDerWaalsContact C-N 3.26Å; F84-Q86 PolarHBondContact O-N 3.25Å; Q86-L88 VanDerWaalsContact C-N 3.28Å; Q86-L88 PolarHBondContact O-N 2.93Å; Q86-K89 WeakPolarHBondContact O-CB 3.39Å; Q86-K89 PolarHBondContact O-N 3.09Å; Q86-K89 VanDerWaalsContact O-N 3.09Å; Q86-E90 PolarHBondContact NE2-OE1 3.42Å; Q86-E90 VanDerWaalsContact NE2-OE1 3.13Å; Q86-E90 PolarHBondContact O-N 3.44Å; Q86-E90 VanDerWaalsContact O-N 3.09Å
87	A	98.6	Very high	98.5	Very high	44 Å²	44	97.1 Å²	97.1	36%	0.364	50%	0.5	S	S	.	.	H	α-helix	trans	-59.6	-38.1	175.3	0	0	0	0	0	112.4	G83 F84 K89 E90 I91	G83-A87 PolarHBondContact O-N 3Å; F84-A87 PolarHBondContact O-N 3.37Å; A87-K89 PolarHBondContact O-N 3.16Å; A87-E90 PolarHBondContact O-N 3.36Å; A87-I91 WeakPolarHBondContact O-CG1 3.46Å; A87-I91 PolarHBondContact O-N 3.33Å
88	L	98.6	Very high	98.5	Very high	86 Å²	86	92.4 Å²	92.4	45%	0.45	49%	0.494	S	S	.	.	H	α-helix	trans	-63.7	-38.2	174.7	-73.5	179.1	0	0	0	112.9	F84 N85 Q86 I91 G92	F84-L88 HydrophobicContact CD1-CD1 4.02Å; F84-L88 HydrophobicContact CE1-CD1 3.45Å; F84-L88 VanDerWaalsContact CE1-CD1 3.45Å; F84-L88 HydrophobicContact CE1-CG 4.09Å; F84-L88 HydrophobicContact CZ-CD1 3.86Å; F84-L88 HydrophobicContact CZ-CD2 4.27Å; F84-L88 HydrophobicContact CZ-CG 4.12Å; F84-L88 PolarHBondContact O-N 2.87Å; N85-L88 PolarHBondContact O-N 3.46Å; Q86-L88 VanDerWaalsContact C-N 3.28Å; Q86-L88 PolarHBondContact O-N 2.93Å; L88-I91 PolarHBondContact O-N 3.05Å; L88-G92 PolarHBondContact O-N 3.29Å; L88-G92 VanDerWaalsContact O-N 3.08Å
89	K	98.5	Very high	98.4	Very high	130 Å²	130	94.5 Å²	94.5	57%	0.565	50%	0.496	S	S	*	.	H	α-helix	trans	-63.4	-45.4	175.2	-70.5	173.3	-175.1	172.6	0	111.3	N85 Q86 A87 I91 G92 D93	N85-K89 WeakPolarHBondContact O-CG 3.4Å; N85-K89 PolarHBondContact O-N 3.49Å; N85-K89 VanDerWaalsContact O-N 3.16Å; Q86-K89 WeakPolarHBondContact O-CB 3.39Å; Q86-K89 PolarHBondContact O-N 3.09Å; Q86-K89 VanDerWaalsContact O-N 3.09Å; A87-K89 PolarHBondContact O-N 3.16Å; K89-I91 VanDerWaalsContact C-N 3.29Å; K89-I91 PolarHBondContact O-N 3.44Å; K89-G92 CarbonylContact O-C 3.56Å; K89-G92 WeakPolarHBondContact O-CA 3.43Å; K89-G92 PolarHBondContact O-N 3.05Å; K89-D93 PolarHBondContact O-N 3.06Å
90	E	98.3	Very high	98.4	Very high	105 Å²	105	93.7 Å²	93.7	49%	0.491	49%	0.49	S	S	.	.	H	α-helix	trans	-60.8	-38.9	178.6	-70.4	169.1	-164.3	0	0	111.9	Q86 A87 G92 D93 V94	Q86-E90 PolarHBondContact NE2-OE1 3.42Å; Q86-E90 VanDerWaalsContact NE2-OE1 3.13Å; Q86-E90 PolarHBondContact O-N 3.44Å; Q86-E90 VanDerWaalsContact O-N 3.09Å; A87-E90 PolarHBondContact O-N 3.36Å; E90-G92 VanDerWaalsContact C-N 3.34Å; E90-D93 PolarHBondContact O-N 3.48Å; E90-V94 WeakPolarHBondContact O-CG2 3.39Å; E90-V94 PolarHBondContact O-N 3.09Å
91	I	98.1	Very high	98.4	Very high	110 Å²	110	91.8 Å²	91.8	56%	0.564	48%	0.482	S	S	*	.	H	α-helix	trans	-61.7	-43.3	172	-69.2	169.7	0	0	0	110.9	A87 L88 K89 D93 V94 E95	A87-I91 WeakPolarHBondContact O-CG1 3.46Å; A87-I91 PolarHBondContact O-N 3.33Å; L88-I91 PolarHBondContact O-N 3.05Å; K89-I91 VanDerWaalsContact C-N 3.29Å; K89-I91 PolarHBondContact O-N 3.44Å; I91-D93 VanDerWaalsContact C-N 3.33Å; I91-D93 PolarHBondContact O-N 2.97Å; I91-V94 PolarHBondContact O-N 3.28Å; I91-E95 PolarHBondContact O-N 3.08Å
92	G	98.1	Very high	98.4	Very high	31 Å²	31	92.4 Å²	92.4	32%	0.32	48%	0.479	S	S	.	.	H	α-helix	trans	-61.5	-39.3	175.7	0	0	0	0	0	113.1	L88 K89 E90 E95 N96	L88-G92 PolarHBondContact O-N 3.29Å; L88-G92 VanDerWaalsContact O-N 3.08Å; K89-G92 CarbonylContact O-C 3.56Å; K89-G92 WeakPolarHBondContact O-CA 3.43Å; K89-G92 PolarHBondContact O-N 3.05Å; E90-G92 VanDerWaalsContact C-N 3.34Å; G92-E95 PolarHBondContact O-N 3Å; G92-N96 WeakPolarHBondContact O-CB 3.49Å; G92-N96 PolarHBondContact O-N 3.31Å
93	D	98.4	Very high	98.4	Very high	90 Å²	90	92.9 Å²	92.9	48%	0.481	48%	0.483	S	S	.	.	H	α-helix	trans	-62.9	-43.1	175.6	-67.7	-27.4	0	0	0	111.1	K89 E90 I91 N96 W97	K89-D93 PolarHBondContact O-N 3.06Å; E90-D93 PolarHBondContact O-N 3.48Å; I91-D93 VanDerWaalsContact C-N 3.33Å; I91-D93 PolarHBondContact O-N 2.97Å; D93-N96 PolarHBondContact O-N 3.33Å; D93-W97 PolarHBondContact O-N 2.94Å
94	V	98.3	Very high	98.3	Very high	85 Å²	85	95.4 Å²	95.4	52%	0.515	49%	0.486	S	S	.	.	H	α-helix	trans	-63.7	-42.8	175.3	172.6	0	0	0	0	111.7	E90 I91 N96 W97 A98	E90-V94 WeakPolarHBondContact O-CG2 3.39Å; E90-V94 PolarHBondContact O-N 3.09Å; I91-V94 PolarHBondContact O-N 3.28Å; V94-N96 VanDerWaalsContact C-N 3.29Å; V94-N96 PolarHBondContact O-N 3.01Å; V94-W97 HydrophobicContact CG2-CE3 4.4Å; V94-W97 HydrophobicContact CG2-CZ3 4.44Å; V94-W97 PolarHBondContact O-N 3.3Å; V94-A98 WeakPolarHBondContact O-CB 3.3Å; V94-A98 PolarHBondContact O-N 3.33Å
95	E	98.4	Very high	98.3	Very high	110 Å²	110	94.8 Å²	94.8	51%	0.514	49%	0.486	S	S	.	.	H	α-helix	trans	-60.1	-42.2	175.8	-169.7	-166.9	150.1	0	0	111.1	I91 G92 A98 R99	I91-E95 PolarHBondContact O-N 3.08Å; G92-E95 PolarHBondContact O-N 3Å; E95-A98 PolarHBondContact O-N 3.43Å; E95-R99 WeakPolarHBondContact O-CB 3.48Å; E95-R99 PolarHBondContact O-N 2.68Å; E95-R99 IonicContact OE1-CZ 2.89Å; E95-R99 IonicContact OE1-NH2 2.73Å; E95-R99 PolarHBondContact OE1-NH2 3.3Å
96	N	98.4	Very high	98.2	Very high	82 Å²	82	98.7 Å²	98.7	44%	0.439	50%	0.495	S	S	.	.	H	α-helix	trans	-62.9	-44.6	177.6	-171.6	62.8	0	0	0	111.7	G92 D93 V94 R99 S100	G92-N96 WeakPolarHBondContact O-CB 3.49Å; G92-N96 PolarHBondContact O-N 3.31Å; D93-N96 PolarHBondContact O-N 3.33Å; V94-N96 VanDerWaalsContact C-N 3.29Å; V94-N96 PolarHBondContact O-N 3.01Å; N96-R99 PolarHBondContact O-N 3.27Å; N96-S100 PolarHBondContact O-N 3.38Å; N96-S100 PolarHBondContact O-OG 2.98Å
97	W	98.3	Very high	98.1	Very high	167 Å²	167	98.7 Å²	98.7	63%	0.633	50%	0.501	S	S	*	.	H	α-helix	trans	-60.8	-44.8	174.2	-66.5	-19.7	0	0	0	112.6	D93 V94 R99 S100 I101	D93-W97 PolarHBondContact O-N 2.94Å; V94-W97 HydrophobicContact CG2-CE3 4.4Å; V94-W97 HydrophobicContact CG2-CZ3 4.44Å; V94-W97 PolarHBondContact O-N 3.3Å; W97-R99 VanDerWaalsContact C-N 3.29Å; W97-R99 PolarHBondContact O-N 2.96Å; W97-S100 PolarHBondContact O-N 2.99Å; W97-I101 VanDerWaalsContact O-CG1 3.3Å; W97-I101 WeakPolarHBondContact O-CG1 3.49Å; W97-I101 PolarHBondContact O-N 3.37Å
98	A	98.4	Very high	98.1	Very high	55 Å²	55	100.8 Å²	100.8	46%	0.455	51%	0.506	S	S	.	.	H	α-helix	trans	-59.4	-42	178.2	0	0	0	0	0	111.6	V94 E95 I101 E102	V94-A98 WeakPolarHBondContact O-CB 3.3Å; V94-A98 PolarHBondContact O-N 3.33Å; E95-A98 PolarHBondContact O-N 3.43Å; A98-I101 PolarHBondContact O-N 3.43Å; A98-E102 WeakPolarHBondContact O-CB 3.29Å; A98-E102 PolarHBondContact O-N 3.23Å
99	R	98.3	Very high	98	Very high	134 Å²	134	98.9 Å²	98.9	51%	0.506	50%	0.502	S	S	.	.	H	α-helix	trans	-65.6	-42.4	177.2	-165.2	-175.1	-58.7	143	-0.5	112.5	E95 N96 W97 E102 M103	E95-R99 WeakPolarHBondContact O-CB 3.48Å; E95-R99 PolarHBondContact O-N 2.68Å; E95-R99 IonicContact OE1-CZ 2.89Å; E95-R99 IonicContact OE1-NH2 2.73Å; E95-R99 PolarHBondContact OE1-NH2 3.3Å; N96-R99 PolarHBondContact O-N 3.27Å; W97-R99 VanDerWaalsContact C-N 3.29Å; W97-R99 PolarHBondContact O-N 2.96Å; R99-E102 PolarHBondContact O-N 3.4Å; R99-M103 PolarHBondContact O-N 3.01Å
100	S	98.4	Very high	97.8	Very high	57 Å²	57	97.2 Å²	97.2	40%	0.399	50%	0.503	S	S	.	.	H	α-helix	trans	-60	-46.9	174.4	-67.5	0	0	0	0	111.4	N96 W97 E102 M103 D104	N96-S100 PolarHBondContact O-N 3.38Å; N96-S100 PolarHBondContact O-OG 2.98Å; W97-S100 PolarHBondContact O-N 2.99Å; S100-E102 VanDerWaalsContact C-N 3.34Å; S100-E102 PolarHBondContact O-N 3.34Å; S100-M103 PolarHBondContact O-N 2.93Å; S100-D104 PolarHBondContact O-N 2.93Å
101	I	98.1	Very high	97.7	Very high	100 Å²	100	94.9 Å²	94.9	51%	0.513	50%	0.501	S	S	.	.	H	α-helix	trans	-61.3	-42.9	177.3	-67.2	165.2	0	0	0	111.1	W97 A98 M103 D104 M105	W97-I101 VanDerWaalsContact O-CG1 3.3Å; W97-I101 WeakPolarHBondContact O-CG1 3.49Å; W97-I101 PolarHBondContact O-N 3.37Å; A98-I101 PolarHBondContact O-N 3.43Å; I101-M103 VanDerWaalsContact C-N 3.33Å; I101-M103 PolarHBondContact O-N 3.46Å; I101-D104 PolarHBondContact O-N 3.35Å; I101-M105 HydrophobicContact CG2-CG 4.34Å; I101-M105 WeakPolarHBondContact O-CB 3.5Å; I101-M105 VanDerWaalsContact O-CG 3.29Å; I101-M105 WeakPolarHBondContact O-CG 3.36Å; I101-M105 PolarHBondContact O-N 2.97Å
102	E	98.2	Very high	97.5	Very high	95 Å²	95	95.2 Å²	95.2	44%	0.444	50%	0.504	S	S	.	.	H	α-helix	trans	-59.5	-45.3	177	-170.3	-166.9	160.3	0	0	111.4	A98 R99 S100 M105 R106	A98-E102 WeakPolarHBondContact O-CB 3.29Å; A98-E102 PolarHBondContact O-N 3.23Å; R99-E102 PolarHBondContact O-N 3.4Å; S100-E102 VanDerWaalsContact C-N 3.34Å; S100-E102 PolarHBondContact O-N 3.34Å; E102-M105 PolarHBondContact O-N 3.32Å; E102-R106 WeakPolarHBondContact O-CG 3.45Å; E102-R106 PolarHBondContact O-N 2.89Å; E102-R106 IonicContact OE1-CZ 2.68Å; E102-R106 VanDerWaalsContact OE1-CZ 3.25Å; E102-R106 IonicContact OE1-NE 3.25Å; E102-R106 PolarHBondContact OE1-NE 3.02Å; E102-R106 IonicContact OE1-NH2 3.87Å; E102-R106 PolarHBondContact OE1-NH2 3.47Å
103	M	97.8	Very high	97.2	Very high	131 Å²	131	98.8 Å²	98.8	65%	0.645	51%	0.512	S	S	*	.	H	α-helix	trans	-63.4	-43.1	179	-176.5	166.1	171.8	0	0	112.1	R99 S100 I101 R106 T107	R99-M103 PolarHBondContact O-N 3.01Å; S100-M103 PolarHBondContact O-N 2.93Å; I101-M103 VanDerWaalsContact C-N 3.33Å; I101-M103 PolarHBondContact O-N 3.46Å; M103-R106 PolarHBondContact O-N 3.35Å; M103-T107 PolarHBondContact O-N 3.11Å; M103-T107 PolarHBondContact O-OG1 2.9Å
104	D	97.9	Very high	97	Very high	98 Å²	98	103.5 Å²	103.5	52%	0.524	52%	0.524	S	S	.	.	H	α-helix	trans	-62.1	-45.3	175.7	-70.2	-17.9	0	0	0	111.1	S100 I101 R106 T107 I108	S100-D104 PolarHBondContact O-N 2.93Å; I101-D104 PolarHBondContact O-N 3.35Å; D104-R106 PolarHBondContact O-N 2.92Å; D104-T107 WeakPolarHBondContact O-CB 3.35Å; D104-T107 PolarHBondContact O-N 3.41Å; D104-T107 VanDerWaalsContact O-N 3.11Å; D104-I108 WeakPolarHBondContact O-CG1 3.34Å; D104-I108 PolarHBondContact O-N 3.4Å
105	M	97.8	Very high	96.7	Very high	116 Å²	116	103.4 Å²	103.4	57%	0.571	52%	0.524	S	S	*	.	H	α-helix	trans	-63.8	-39.6	178.5	-72.6	-65.1	158.7	0	0	112.6	I101 E102 T107 I108 A109	I101-M105 HydrophobicContact CG2-CG 4.34Å; I101-M105 WeakPolarHBondContact O-CB 3.5Å; I101-M105 VanDerWaalsContact O-CG 3.29Å; I101-M105 WeakPolarHBondContact O-CG 3.36Å; I101-M105 PolarHBondContact O-N 2.97Å; E102-M105 PolarHBondContact O-N 3.32Å; M105-T107 VanDerWaalsContact C-N 3.3Å; M105-T107 PolarHBondContact O-N 2.91Å; M105-I108 PolarHBondContact O-N 3.45Å; M105-I108 HydrophobicContact SD-CD1 4.31Å; M105-A109 WeakPolarHBondContact O-CB 3.38Å; M105-A109 PolarHBondContact O-N 2.89Å
106	R	97.1	Very high	96.1	Very high	160 Å²	160	103.5 Å²	103.5	60%	0.604	52%	0.524	S	S	*	.	H	α-helix	trans	-62	-39.3	172.7	-73.7	175.1	-179.6	-85.4	1.4	111.6	E102 M103 D104 T110	E102-R106 WeakPolarHBondContact O-CG 3.45Å; E102-R106 PolarHBondContact O-N 2.89Å; E102-R106 IonicContact OE1-CZ 2.68Å; E102-R106 VanDerWaalsContact OE1-CZ 3.25Å; E102-R106 IonicContact OE1-NE 3.25Å; E102-R106 PolarHBondContact OE1-NE 3.02Å; E102-R106 IonicContact OE1-NH2 3.87Å; E102-R106 PolarHBondContact OE1-NH2 3.47Å; M103-R106 PolarHBondContact O-N 3.35Å; D104-R106 PolarHBondContact O-N 2.92Å; R106-T110 WeakPolarHBondContact O-CB 3.41Å; R106-T110 PolarHBondContact O-N 3.48Å; R106-T110 PolarHBondContact O-OG1 3.44Å
107	T	97.1	Very high	95.5	Very high	87 Å²	87	105.3 Å²	105.3	53%	0.534	53%	0.528	S	S	.	.	H	α-helix	trans	-65.5	-46.6	177.6	-57.3	0	0	0	0	111	M103 D104 M105 T110 A111	M103-T107 PolarHBondContact O-N 3.11Å; M103-T107 PolarHBondContact O-OG1 2.9Å; D104-T107 WeakPolarHBondContact O-CB 3.35Å; D104-T107 PolarHBondContact O-N 3.41Å; D104-T107 VanDerWaalsContact O-N 3.11Å; M105-T107 VanDerWaalsContact C-N 3.3Å; M105-T107 PolarHBondContact O-N 2.91Å; T107-T110 PolarHBondContact O-N 3.39Å; T107-A111 PolarHBondContact O-N 2.93Å
108	I	96.8	Very high	94.4	Very high	88 Å²	88	98.8 Å²	98.8	45%	0.451	51%	0.513	S	S	.	.	H	α-helix	trans	-59.1	-49.6	176.1	-67.8	166.6	0	0	0	110.7	D104 M105 T110 A111 L112	D104-I108 WeakPolarHBondContact O-CG1 3.34Å; D104-I108 PolarHBondContact O-N 3.4Å; M105-I108 PolarHBondContact O-N 3.45Å; M105-I108 HydrophobicContact SD-CD1 4.31Å; I108-T110 VanDerWaalsContact C-N 3.32Å; I108-T110 PolarHBondContact O-N 2.94Å; I108-A111 PolarHBondContact O-N 2.71Å; I108-L112 HydrophobicContact CG2-CD1 3.88Å; I108-L112 HydrophobicContact CG2-CG 4.34Å; I108-L112 WeakPolarHBondContact O-CG 3.38Å; I108-L112 PolarHBondContact O-N 2.73Å
109	A	96.4	Very high	92.8	Very high	46 Å²	46	101.8 Å²	101.8	38%	0.38	52%	0.517	S	S	.	.	H	α-helix	trans	-57.7	-45.1	178.6	0	0	0	0	0	111.7	M105 A111 L112 E113	M105-A109 WeakPolarHBondContact O-CB 3.38Å; M105-A109 PolarHBondContact O-N 2.89Å; A109-A111 PolarHBondContact O-N 2.95Å; A109-L112 PolarHBondContact O-N 3.45Å; A109-E113 PolarHBondContact O-N 2.99Å
110	T	95.7	Very high	91.1	Very high	95 Å²	95	100 Å²	100	58%	0.583	52%	0.517	S	S	*	.	H	α-helix	trans	-61.7	-44	178	-53.7	0	0	0	0	111.9	R106 T107 I108 E113 Y114	R106-T110 WeakPolarHBondContact O-CB 3.41Å; R106-T110 PolarHBondContact O-N 3.48Å; R106-T110 PolarHBondContact O-OG1 3.44Å; T107-T110 PolarHBondContact O-N 3.39Å; I108-T110 VanDerWaalsContact C-N 3.32Å; I108-T110 PolarHBondContact O-N 2.94Å; T110-E113 PolarHBondContact O-N 3.23Å; T110-Y114 PolarHBondContact O-N 3.04Å
111	A	94.9	Very high	89.1	Confident	55 Å²	55	104.4 Å²	104.4	46%	0.455	53%	0.532	S	S	.	.	H	α-helix	trans	-64.3	-42.7	177.6	0	0	0	0	0	112.1	T107 I108 A109 Y114 V115	T107-A111 PolarHBondContact O-N 2.93Å; I108-A111 PolarHBondContact O-N 2.71Å; A109-A111 PolarHBondContact O-N 2.95Å; A111-Y114 PolarHBondContact O-N 3.02Å; A111-V115 WeakPolarHBondContact O-CG2 3.33Å; A111-V115 PolarHBondContact O-N 3.42Å
112	L	94.6	Very high	87.1	Confident	118 Å²	118	104.7 Å²	104.7	62%	0.618	54%	0.538	S	S	*	.	H	α-helix	trans	-62.6	-43.7	176.3	-71.6	173.6	0	0	0	111.9	I108 A109 Y114 V115 H116	I108-L112 HydrophobicContact CG2-CD1 3.88Å; I108-L112 HydrophobicContact CG2-CG 4.34Å; I108-L112 WeakPolarHBondContact O-CG 3.38Å; I108-L112 PolarHBondContact O-N 2.73Å; A109-L112 PolarHBondContact O-N 3.45Å; L112-Y114 VanDerWaalsContact C-N 3.32Å; L112-Y114 PolarHBondContact O-N 3.34Å; L112-V115 PolarHBondContact O-N 3.06Å; L112-H116 WeakPolarHBondContact O-CB 3.44Å; L112-H116 PolarHBondContact O-N 3.29Å
113	E	92.8	Very high	84.9	Confident	106 Å²	106	105.3 Å²	105.3	50%	0.495	55%	0.548	S	S	.	.	H	α-helix	trans	-59.9	-42.1	174.4	-82	-168.4	-155.3	0	0	112.5	A109 T110 H116 K117	A109-E113 PolarHBondContact O-N 2.99Å; T110-E113 PolarHBondContact O-N 3.23Å; E113-H116 PolarHBondContact O-N 3.41Å; E113-K117 WeakPolarHBondContact O-CB 3.46Å; E113-K117 WeakPolarHBondContact O-CG 3.38Å; E113-K117 PolarHBondContact O-N 2.83Å; E113-K117 IonicContact OE2-NZ 2.83Å; E113-K117 PolarHBondContact OE2-NZ 2.91Å
114	Y	92.9	Very high	82.7	Confident	188 Å²	188	104.7 Å²	104.7	74%	0.737	56%	0.556	S	S	*	*	H	α-helix	trans	-62.5	-47.7	179.1	-177.8	-96.9	0	0	0	111.6	T110 A111 L112 H116 K117 G118	T110-Y114 PolarHBondContact O-N 3.04Å; A111-Y114 PolarHBondContact O-N 3.02Å; L112-Y114 VanDerWaalsContact C-N 3.32Å; L112-Y114 PolarHBondContact O-N 3.34Å; Y114-H116 VanDerWaalsContact C-N 3.34Å; Y114-H116 PolarHBondContact O-N 3.38Å; Y114-K117 PolarHBondContact O-N 3.45Å; Y114-G118 PolarHBondContact O-N 3.31Å
115	V	91.9	Very high	80	Confident	83 Å²	83	108 Å²	108	50%	0.503	59%	0.587	S	S	.	*	H	α-helix	trans	-59.6	-44.9	176.7	172.6	0	0	0	0	111	A111 L112 G118 Q119	A111-V115 WeakPolarHBondContact O-CG2 3.33Å; A111-V115 PolarHBondContact O-N 3.42Å; L112-V115 PolarHBondContact O-N 3.06Å; V115-G118 PolarHBondContact O-N 3.4Å; V115-Q119 WeakPolarHBondContact O-CG 3.38Å; V115-Q119 PolarHBondContact O-N 3.06Å
116	H	87.2	Confident	79.1	Confident	112 Å²	112	107.6 Å²	107.6	52%	0.519	59%	0.587	S	S	.	*	H	α-helix	trans	-63.4	-45.5	179.2	-175.8	63.4	0	0	0	112.6	L112 E113 Y114 Q119 L120	L112-H116 WeakPolarHBondContact O-CB 3.44Å; L112-H116 PolarHBondContact O-N 3.29Å; E113-H116 PolarHBondContact O-N 3.41Å; Y114-H116 VanDerWaalsContact C-N 3.34Å; Y114-H116 PolarHBondContact O-N 3.38Å; H116-Q119 PolarHBondContact O-N 2.94Å; H116-L120 PolarHBondContact O-N 3.42Å
117	K	84.9	Confident	78.2	Confident	121 Å²	121	104.8 Å²	104.8	53%	0.526	59%	0.587	S	S	.	*	H	α-helix	trans	-66.2	-37.3	177.6	-71.9	169.8	-177.3	158.6	0	112.2	E113 Y114 L120 Q121	E113-K117 WeakPolarHBondContact O-CB 3.46Å; E113-K117 WeakPolarHBondContact O-CG 3.38Å; E113-K117 PolarHBondContact O-N 2.83Å; E113-K117 IonicContact OE2-NZ 2.83Å; E113-K117 PolarHBondContact OE2-NZ 2.91Å; Y114-K117 PolarHBondContact O-N 3.45Å; K117-L120 PolarHBondContact O-N 3.19Å; K117-Q121 PolarHBondContact O-N 3.37Å
118	G	76	Confident	77.1	Confident	30 Å²	30	105.8 Å²	105.8	31%	0.309	59%	0.59	S	S	.	*	H	α-helix	trans	-63.8	-40.8	175.2	0	0	0	0	0	113	Y114 V115 L120 Q121 T122	Y114-G118 PolarHBondContact O-N 3.31Å; V115-G118 PolarHBondContact O-N 3.4Å; G118-L120 VanDerWaalsContact C-N 3.34Å; G118-L120 PolarHBondContact O-N 2.8Å; G118-Q121 PolarHBondContact O-N 3.22Å; G118-T122 PolarHBondContact O-N 3.29Å; G118-T122 PolarHBondContact O-OG1 3.44Å; G118-T122 VanDerWaalsContact O-OG1 3.1Å
119	Q	64.6	Low	76	Confident	117 Å²	117	106.9 Å²	106.9	55%	0.547	60%	0.598	S	S	.	*	H	α-helix	trans	-60.6	-41	175.4	-75.5	174.8	-10.9	0	0	112.4	V115 H116 Q121 T122 T123	V115-Q119 WeakPolarHBondContact O-CG 3.38Å; V115-Q119 PolarHBondContact O-N 3.06Å; H116-Q119 PolarHBondContact O-N 2.94Å; Q119-Q121 VanDerWaalsContact C-N 3.35Å; Q119-Q121 PolarHBondContact O-N 3.46Å; Q119-T122 WeakPolarHBondContact CA-OG1 3.48Å; Q119-T122 PolarHBondContact O-N 3.32Å; Q119-T122 PolarHBondContact O-OG1 3.39Å; Q119-T123 WeakPolarHBondContact O-CG2 3.42Å; Q119-T123 PolarHBondContact O-N 3.22Å; Q119-T123 PolarHBondContact O-OG1 3.44Å
120	L	61.4	Low	74.7	Confident	97 Å²	97	110.7 Å²	110.7	51%	0.508	61%	0.611	S	S	.	*	H	α-helix	trans	-66.3	-31.8	178.5	-71.2	167.5	0	0	0	113.4	H116 K117 G118 T123	H116-L120 PolarHBondContact O-N 3.42Å; K117-L120 PolarHBondContact O-N 3.19Å; G118-L120 VanDerWaalsContact C-N 3.34Å; G118-L120 PolarHBondContact O-N 2.8Å; L120-T123 WeakPolarHBondContact CA-OG1 3.44Å; L120-T123 PolarHBondContact O-OG1 3.1Å
121	Q	56.4	Low	73.3	Confident	149 Å²	149	111.7 Å²	111.7	70%	0.696	61%	0.613	S	S	*	*	H	α-helix	trans	-73.1	-38.8	175.2	-77.2	-177.3	-20.2	0	0	112.4	K117 G118 Q119 T123 C124 S125	K117-Q121 PolarHBondContact O-N 3.37Å; G118-Q121 PolarHBondContact O-N 3.22Å; Q119-Q121 VanDerWaalsContact C-N 3.35Å; Q119-Q121 PolarHBondContact O-N 3.46Å; Q121-T123 VanDerWaalsContact C-N 3.3Å; Q121-T123 PolarHBondContact O-N 3.37Å; Q121-C124 PolarHBondContact O-N 3.38Å; Q121-S125 PolarHBondContact O-OG 3Å
122	T	56.2	Low	71.8	Confident	106 Å²	106	115.8 Å²	115.8	65%	0.65	62%	0.624	S	S	*	*	H	α-helix	trans	-68.4	-25.2	175.6	37.1	0	0	0	0	114	G118 Q119	G118-T122 PolarHBondContact O-N 3.29Å; G118-T122 PolarHBondContact O-OG1 3.44Å; G118-T122 VanDerWaalsContact O-OG1 3.1Å; Q119-T122 WeakPolarHBondContact CA-OG1 3.48Å; Q119-T122 PolarHBondContact O-N 3.32Å; Q119-T122 PolarHBondContact O-OG1 3.39Å
123	T	52.5	Low	70	Confident	108 Å²	108	115.6 Å²	115.6	66%	0.663	63%	0.625	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.8	-10.5	177.3	49.6	0	0	0	0	114.3	Q119 L120 Q121	Q119-T123 WeakPolarHBondContact O-CG2 3.42Å; Q119-T123 PolarHBondContact O-N 3.22Å; Q119-T123 PolarHBondContact O-OG1 3.44Å; L120-T123 WeakPolarHBondContact CA-OG1 3.44Å; L120-T123 PolarHBondContact O-OG1 3.1Å; Q121-T123 VanDerWaalsContact C-N 3.3Å; Q121-T123 PolarHBondContact O-N 3.37Å
124	C	50.4	Low	68.1	Low	119 Å²	119	116.4 Å²	116.4	80%	0.804	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-106.2	10.5	179.8	-93	0	0	0	0	113.7	Q121	Q121-C124 PolarHBondContact O-N 3.38Å
125	S	42.6	Very low	65.8	Low	167 Å²	167	109.9 Å²	109.9	100%	1.168	63%	0.627	S	S	*	*			trans	-108.6	0	175.2	-56.3	0	0	0	0	111.6	Q121	Q121-S125 PolarHBondContact O-OG 3Å

Retrieved 125 of 125 residues in 464.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).