A0A087YFG9_POEFO Loading...

cAMP regulated phosphoprotein 19

Protein phosphatase inhibitor that specifically inhibits protein phosphatase 2A (PP2A) during mitosis.

AlphaFold DB (A0A3B3TYV3), UniProt , Accession A0A087YFG9, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 116 aa.

						>A0A087YFG9_POEFO|A0A087YFG9
MSEDNDETQTAEETPVEETESQDKVISPEKAEEAKLKARYPNLGHKPGGSDLLRKRLQKGQKYFDSGDYNMAKAKIKNKQLPTAAPEKTEITGDHIPTPQDLPQRKPSLVASKLAG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.6	Very low	46.2	Very low	233 Å²	233	151.5 Å²	151.5	100%	1.148	83%	0.825	S	S	*	*				0	91.5	0	-63.1	-48.9	-175.9	0	0	106.8
2	S	56	Low	46.1	Very low	103 Å²	103	154.8 Å²	154.8	72%	0.72	83%	0.83	S	S	*	*			trans	-72.6	129.3	162.9	37.2	0	0	0	0	107.9
3	E	57.1	Low	45.6	Very low	185 Å²	185	156.5 Å²	156.5	86%	0.864	83%	0.83	S	S	*	*			trans	-145.8	93.6	155.9	-100.3	137.8	-173	0	0	105.9
4	D	47.2	Very low	45.1	Very low	149 Å²	149	154.3 Å²	154.3	80%	0.797	83%	0.826	S	S	*	*			trans	-45.9	141.5	152.9	-60.2	-79.4	0	0	0	109.8
5	N	52.4	Low	44.8	Very low	158 Å²	158	152.3 Å²	152.3	85%	0.845	83%	0.825	S	S	*	*			trans	-129.4	118.3	163.2	-149	-35.7	0	0	0	108.8
6	D	47.3	Very low	44.6	Very low	129 Å²	129	149.7 Å²	149.7	69%	0.69	82%	0.815	S	S	*	*			trans	-40.5	141.8	-168.7	-74.5	-102	0	0	0	118.9
7	E	49.8	Very low	44.5	Very low	190 Å²	190	149.2 Å²	149.2	89%	0.888	81%	0.806	S	S	*	*			trans	-57.8	129	142.8	-73.6	-178.2	135.7	0	0	110.5
8	T	40.2	Very low	44.2	Very low	126 Å²	126	151.2 Å²	151.2	77%	0.773	81%	0.809	S	S	*	*			trans	-136.6	97.9	155	33	0	0	0	0	106.8
9	Q	37.4	Very low	43.8	Very low	176 Å²	176	150.4 Å²	150.4	82%	0.822	81%	0.81	S	S	*	*				50.2	109.1	100	-80.3	-171.7	1.2	0	0	115.6
10	T	34.2	Very low	43.9	Very low	131 Å²	131	150.8 Å²	150.8	80%	0.804	81%	0.807	S	S	*	*				58.6	109.1	123.7	-31.5	0	0	0	0	118.6
11	A	39.6	Very low	43.9	Very low	87 Å²	87	148.3 Å²	148.3	72%	0.719	80%	0.801	S	S	*	*				-164.8	114.9	129.4	0	0	0	0	0	109.4	E13	A11-E13 PolarHBondContact O-N 3.49Å
12	E	45.5	Very low	43.7	Very low	191 Å²	191	146.3 Å²	146.3	89%	0.893	79%	0.789	S	S	*	*			trans	-51.4	129.3	139.9	-81.7	-159.1	142	0	0	107
13	E	39	Very low	43.6	Very low	176 Å²	176	147.7 Å²	147.7	82%	0.822	79%	0.788	S	S	*	*			trans	-154.3	120.4	140.3	-72.3	-153.5	158.2	0	0	108.9	A11	A11-E13 PolarHBondContact O-N 3.49Å
14	T	38.8	Very low	43	Very low	126 Å²	126	148.1 Å²	148.1	77%	0.773	79%	0.787	S	S	*	*			trans	-55.2	143.3	154.4	46	0	0	0	0	110.4
15	P	40.3	Very low	43.1	Very low	125 Å²	125	147.2 Å²	147.2	81%	0.812	79%	0.787	S	S	*	*			trans	-114.3	103.4	140.2	29.2	-17.9	0	0	0	108.6
16	V	42.3	Very low	43.1	Very low	110 Å²	110	146.1 Å²	146.1	67%	0.667	78%	0.78	S	S	*	*			trans	-71.2	145.6	150	175.6	0	0	0	0	106.6
17	E	42.4	Very low	43.3	Very low	142 Å²	142	141.4 Å²	141.4	66%	0.664	76%	0.757	S	S	*	*			trans	77.6	109	169.5	-78.6	157.2	-155.3	0	0	117.6
18	E	39.6	Very low	43.8	Very low	184 Å²	184	136.8 Å²	136.8	86%	0.86	74%	0.744	S	S	*	*				-178.1	89.3	119.6	-96.7	178.4	-163.6	0	0	110.1
19	T	37.3	Very low	44.7	Very low	136 Å²	136	137.1 Å²	137.1	83%	0.834	74%	0.736	S	S	*	*			trans	-147.9	62.2	139.9	59.9	0	0	0	0	108.2	S21	T19-S21 VanDerWaalsContact C-N 3.3Å; T19-S21 PolarHBondContact O-N 3.14Å
20	E	44.1	Very low	46	Very low	159 Å²	159	136 Å²	136	74%	0.743	73%	0.729	S	S	*	*			trans	-86.9	62.5	170.6	-59.4	-163.4	143.6	0	0	110.3
21	S	44.7	Very low	47.6	Very low	99 Å²	99	132.9 Å²	132.9	69%	0.692	72%	0.716	S	S	*	*			trans	-160.7	46.3	176.8	57.7	0	0	0	0	114	T19	T19-S21 VanDerWaalsContact C-N 3.3Å; T19-S21 PolarHBondContact O-N 3.14Å
22	Q	43.2	Very low	49.1	Very low	191 Å²	191	135 Å²	135	89%	0.893	71%	0.711	S	S	*	*			trans	-142	58.8	152.1	-69.4	-157.7	-5.3	0	0	109.3
23	D	52.6	Low	50.2	Low	131 Å²	131	132.2 Å²	132.2	70%	0.701	70%	0.698	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71.9	143.8	169.3	-161.5	2.4	0	0	0	109.3
24	K	46.3	Very low	52	Low	194 Å²	194	126.8 Å²	126.8	84%	0.843	68%	0.684	S	S	*	*	T	Hydrogen-bonded Turn	trans	103.1	-8	-179.2	-57.2	-177.3	-179.5	-170.4	0	120.3
25	V	48.4	Very low	54	Low	131 Å²	131	127.8 Å²	127.8	79%	0.794	68%	0.677	S	S	*	*			trans	-124.1	71.6	160	-171.5	0	0	0	0	107	S27	V25-S27 PolarHBondContact O-N 3.39Å
26	I	52.4	Low	55.6	Low	134 Å²	134	125.9 Å²	125.9	69%	0.687	66%	0.66	S	S	*	*			trans	-69.9	87.6	175.1	-59.4	166.2	0	0	0	106
27	S	50.8	Low	57.3	Low	30 Å²	30	124.6 Å²	124.6	21%	0.21	65%	0.645	C	S	.	*			trans	-51.3	133.8	179.7	173.8	0	0	0	0	109.3	V25 E29 K30	V25-S27 PolarHBondContact O-N 3.39Å; S27-E29 PolarHBondContact O-N 2.86Å; S27-E29 VanDerWaalsContact OG-CB 3.24Å; S27-E29 WeakPolarHBondContact OG-CB 3.11Å; S27-E29 WeakPolarHBondContact OG-CG 3.25Å; S27-E29 PolarHBondContact OG-N 2.67Å; S27-E29 PolarHBondContact OG-OE2 2.84Å; S27-K30 PolarHBondContact O-N 3.33Å
28	P	61.4	Low	59.1	Low	94 Å²	94	121.8 Å²	121.8	61%	0.61	65%	0.647	S	S	*	*	H	α-helix	trans	-51.2	-21.7	172.9	23	-34.3	0	0	0	112.6	K30 A31 E32	P28-K30 PolarHBondContact O-N 2.97Å; P28-A31 PolarHBondContact O-N 2.91Å; P28-E32 WeakPolarHBondContact O-CG 3.35Å; P28-E32 PolarHBondContact O-N 3.32Å
29	E	58.6	Low	61.3	Low	132 Å²	132	121.7 Å²	121.7	62%	0.617	64%	0.638	S	S	*	*	H	α-helix	trans	-58	-41.8	176.6	-60.8	166.3	156.5	0	0	112.8	S27 A31 E32 E33	S27-E29 PolarHBondContact O-N 2.86Å; S27-E29 VanDerWaalsContact OG-CB 3.24Å; S27-E29 WeakPolarHBondContact OG-CB 3.11Å; S27-E29 WeakPolarHBondContact OG-CG 3.25Å; S27-E29 PolarHBondContact OG-N 2.67Å; S27-E29 PolarHBondContact OG-OE2 2.84Å; E29-A31 PolarHBondContact O-N 3.27Å; E29-E32 PolarHBondContact O-N 2.87Å; E29-E33 WeakPolarHBondContact O-CB 3.43Å; E29-E33 WeakPolarHBondContact O-CG 3.39Å; E29-E33 PolarHBondContact O-N 3.39Å
30	K	65.3	Low	63.3	Low	153 Å²	153	121.9 Å²	121.9	67%	0.665	63%	0.625	S	S	*	*	H	α-helix	trans	-67.7	-36.1	179	-93	179.1	178.2	169.6	0	112.7	S27 P28 A34	S27-K30 PolarHBondContact O-N 3.33Å; P28-K30 PolarHBondContact O-N 2.97Å; K30-A34 PolarHBondContact O-N 3.47Å; K30-A34 VanDerWaalsContact O-N 3.11Å
31	A	67.9	Low	64.9	Low	66 Å²	66	118.7 Å²	118.7	55%	0.545	62%	0.617	S	S	.	*	H	α-helix	trans	-71.4	-38.3	178.1	0	0	0	0	0	111.7	P28 E29 A34 K35	P28-A31 PolarHBondContact O-N 2.91Å; E29-A31 PolarHBondContact O-N 3.27Å; A31-A34 PolarHBondContact O-N 3.32Å; A31-K35 PolarHBondContact O-N 3.27Å; A31-K35 VanDerWaalsContact O-N 3.11Å
32	E	70.5	Confident	66.3	Low	132 Å²	132	121.3 Å²	121.3	62%	0.617	62%	0.624	S	S	*	*	H	α-helix	trans	-67.8	-38.1	175	-71.5	-173.3	177	0	0	112	P28 E29 K35 L36	P28-E32 WeakPolarHBondContact O-CG 3.35Å; P28-E32 PolarHBondContact O-N 3.32Å; E29-E32 PolarHBondContact O-N 2.87Å; E32-K35 PolarHBondContact O-N 2.9Å; E32-L36 WeakPolarHBondContact O-CB 3.44Å; E32-L36 WeakPolarHBondContact O-CG 3.36Å; E32-L36 PolarHBondContact O-N 2.71Å
33	E	69.4	Low	67.6	Low	132 Å²	132	116.3 Å²	116.3	62%	0.617	60%	0.603	S	S	*	*	H	α-helix	trans	-63	-42.9	173.5	-77.4	-177.5	178.5	0	0	112.4	E29 K35 L36 K37	E29-E33 WeakPolarHBondContact O-CB 3.43Å; E29-E33 WeakPolarHBondContact O-CG 3.39Å; E29-E33 PolarHBondContact O-N 3.39Å; E33-K35 PolarHBondContact O-N 3.38Å; E33-L36 PolarHBondContact O-N 3.11Å; E33-K37 VanDerWaalsContact O-CB 3.25Å; E33-K37 WeakPolarHBondContact O-CB 3.49Å; E33-K37 PolarHBondContact O-N 3.18Å
34	A	75.3	Confident	68.2	Low	62 Å²	62	111.7 Å²	111.7	51%	0.512	59%	0.586	S	S	.	*	H	α-helix	trans	-63.5	-42	176.5	0	0	0	0	0	112	K30 A31 K37 A38	K30-A34 PolarHBondContact O-N 3.47Å; K30-A34 VanDerWaalsContact O-N 3.11Å; A31-A34 PolarHBondContact O-N 3.32Å; A34-K37 PolarHBondContact O-N 3.24Å; A34-A38 WeakPolarHBondContact O-CB 3.44Å; A34-A38 PolarHBondContact O-N 3.31Å
35	K	81.3	Confident	69.1	Low	146 Å²	146	111.2 Å²	111.2	64%	0.635	59%	0.586	S	S	*	*	H	α-helix	trans	-65.7	-41.2	175.6	-171.2	174.4	-177	176	0	111.5	A31 E32 E33 K37 A38 R39	A31-K35 PolarHBondContact O-N 3.27Å; A31-K35 VanDerWaalsContact O-N 3.11Å; E32-K35 PolarHBondContact O-N 2.9Å; E33-K35 PolarHBondContact O-N 3.38Å; K35-K37 VanDerWaalsContact C-N 3.35Å; K35-A38 PolarHBondContact O-N 2.77Å; K35-R39 WeakPolarHBondContact O-CB 3.34Å; K35-R39 WeakPolarHBondContact O-CG 3.19Å; K35-R39 PolarHBondContact O-N 3.11Å
36	L	74.8	Confident	70	Confident	86 Å²	86	111 Å²	111	45%	0.45	58%	0.575	S	S	.	*	H	α-helix	trans	-65.1	-38.8	174.5	-83.3	168.3	0	0	0	111.7	E32 E33 R39 Y40 L43	E32-L36 WeakPolarHBondContact O-CB 3.44Å; E32-L36 WeakPolarHBondContact O-CG 3.36Å; E32-L36 PolarHBondContact O-N 2.71Å; E33-L36 PolarHBondContact O-N 3.11Å; L36-R39 PolarHBondContact O-N 2.85Å; L36-Y40 HydrophobicContact CD2-CD2 3.94Å; L36-Y40 HydrophobicContact CD2-CE2 3.78Å; L36-Y40 WeakPolarHBondContact O-CB 3.18Å; L36-Y40 WeakPolarHBondContact O-CD2 3.19Å; L36-Y40 PolarHBondContact O-N 3.48Å; L36-L43 HydrophobicContact CB-CD2 4.38Å
37	K	78.2	Confident	70.4	Confident	82 Å²	82	111.2 Å²	111.2	36%	0.357	59%	0.585	S	S	.	*	H	α-helix	trans	-66	-41.6	176.4	-173.1	58.8	171.1	171.7	0	112.2	E33 A34 K35 Y40 P41	E33-K37 VanDerWaalsContact O-CB 3.25Å; E33-K37 WeakPolarHBondContact O-CB 3.49Å; E33-K37 PolarHBondContact O-N 3.18Å; A34-K37 PolarHBondContact O-N 3.24Å; K35-K37 VanDerWaalsContact C-N 3.35Å; K37-Y40 CarbonylContact O-C 3.57Å; K37-Y40 PolarHBondContact O-N 2.67Å; K37-P41 PolarHBondContact NZ-O 3.48Å
38	A	78.8	Confident	71.3	Confident	84 Å²	84	112.8 Å²	112.8	69%	0.694	61%	0.606	S	S	*	*	H	α-helix	trans	-66.9	-35.9	174.5	0	0	0	0	0	112.4	A34 K35	A34-A38 WeakPolarHBondContact O-CB 3.44Å; A34-A38 PolarHBondContact O-N 3.31Å; K35-A38 PolarHBondContact O-N 2.77Å
39	R	87.2	Confident	72	Confident	182 Å²	182	110.7 Å²	110.7	69%	0.687	60%	0.602	S	S	*	*	H	α-helix	trans	-72.3	-32.9	175.1	-73.5	-64.9	-155.3	-170.3	5.2	112.9	K35 L36	K35-R39 WeakPolarHBondContact O-CB 3.34Å; K35-R39 WeakPolarHBondContact O-CG 3.19Å; K35-R39 PolarHBondContact O-N 3.11Å; L36-R39 PolarHBondContact O-N 2.85Å
40	Y	78.3	Confident	73.1	Confident	140 Å²	140	107.5 Å²	107.5	55%	0.549	59%	0.594	S	S	.	*			trans	-131.1	79.9	-175.4	-55.4	-71.3	0	0	0	109.7	L36 K37 N42 L43	L36-Y40 HydrophobicContact CD2-CD2 3.94Å; L36-Y40 HydrophobicContact CD2-CE2 3.78Å; L36-Y40 WeakPolarHBondContact O-CB 3.18Å; L36-Y40 WeakPolarHBondContact O-CD2 3.19Å; L36-Y40 PolarHBondContact O-N 3.48Å; K37-Y40 CarbonylContact O-C 3.57Å; K37-Y40 PolarHBondContact O-N 2.67Å; Y40-N42 PolarHBondContact O-N 3.28Å; Y40-N42 VanDerWaalsContact O-N 3.14Å; Y40-L43 HydrophobicContact CD2-CD2 4.39Å; Y40-L43 WeakPolarHBondContact O-CB 3.39Å; Y40-L43 PolarHBondContact O-N 3.47Å
41	P	77.6	Confident	73.6	Confident	91 Å²	91	103.6 Å²	103.6	59%	0.591	58%	0.58	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.4	-31.9	179.4	17.7	-29.1	0	0	0	112.5	K37 L43	K37-P41 PolarHBondContact NZ-O 3.48Å; P41-L43 VanDerWaalsContact C-N 3.29Å; P41-L43 PolarHBondContact O-N 3.06Å
42	N	74.4	Confident	74.2	Confident	154 Å²	154	106.7 Å²	106.7	82%	0.824	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.6	0.6	175.5	-61.6	-35.4	0	0	0	114.7	Y40 G44	Y40-N42 PolarHBondContact O-N 3.28Å; Y40-N42 VanDerWaalsContact O-N 3.14Å; N42-G44 PolarHBondContact O-N 3.37Å
43	L	70.2	Confident	74.6	Confident	87 Å²	87	105.6 Å²	105.6	46%	0.455	59%	0.585	S	S	.	*			trans	-76	42.1	171.3	-163	64.1	0	0	0	110.1	L36 Y40 P41	L36-L43 HydrophobicContact CB-CD2 4.38Å; Y40-L43 HydrophobicContact CD2-CD2 4.39Å; Y40-L43 WeakPolarHBondContact O-CB 3.39Å; Y40-L43 PolarHBondContact O-N 3.47Å; P41-L43 VanDerWaalsContact C-N 3.29Å; P41-L43 PolarHBondContact O-N 3.06Å
44	G	65.4	Low	75.1	Confident	34 Å²	34	102.5 Å²	102.5	35%	0.351	57%	0.567	S	S	.	*			trans	-50.8	152.8	-179	0	0	0	0	0	111.8	N42 K46	N42-G44 PolarHBondContact O-N 3.37Å; G44-K46 PolarHBondContact O-N 3.42Å
45	H	64.6	Low	75.4	Confident	183 Å²	183	105.8 Å²	105.8	85%	0.847	57%	0.57	S	S	*	*			trans	-58.3	79.3	165.9	-58.7	130.5	0	0	0	108.6
46	K	67.3	Low	75.4	Confident	127 Å²	127	108.5 Å²	108.5	55%	0.552	58%	0.576	S	S	*	*			trans	-64.1	126.6	174.6	-77.4	-177.7	164.6	177.9	0	106	G44 G48 G49	G44-K46 PolarHBondContact O-N 3.42Å; K46-G48 PolarHBondContact O-N 2.83Å; K46-G49 PolarHBondContact O-N 3.31Å
47	P	62.1	Low	75.6	Confident	138 Å²	138	111.6 Å²	111.6	90%	0.896	59%	0.592	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.3	110.5	172.3	23.7	-31.5	0	0	0	107.1
48	G	68.2	Low	75.6	Confident	63 Å²	63	114.4 Å²	114.4	65%	0.649	61%	0.607	S	S	*	*	T	Hydrogen-bonded Turn	trans	131.2	3.6	-171.2	0	0	0	0	0	116.9	K46	K46-G48 PolarHBondContact O-N 2.83Å
49	G	77	Confident	75.3	Confident	51 Å²	51	117.5 Å²	117.5	53%	0.526	61%	0.605	S	S	.	*			trans	71.8	-155.3	168.4	0	0	0	0	0	114.9	K46	K46-G49 PolarHBondContact O-N 3.31Å
50	S	80.9	Confident	74.6	Confident	64 Å²	64	110.9 Å²	110.9	45%	0.448	59%	0.593	S	S	.	*			trans	-58.7	137.5	-174.1	172.8	0	0	0	0	113.5	L52 L53 R54	S50-L52 PolarHBondContact O-N 3.48Å; S50-L52 VanDerWaalsContact O-N 3.12Å; S50-L52 PolarHBondContact OG-N 3.36Å; S50-L53 WeakPolarHBondContact O-CB 3.48Å; S50-L53 PolarHBondContact O-N 2.98Å; S50-R54 PolarHBondContact O-N 2.95Å
51	D	77.2	Confident	74.4	Confident	71 Å²	71	111.7 Å²	111.7	38%	0.38	60%	0.602	S	S	.	*	H	α-helix	trans	-51.8	-32.3	171.6	-89.3	21.9	0	0	0	113.2	R54 K55	D51-R54 IonicContact OD1-CZ 3.12Å; D51-R54 IonicContact OD1-NH1 2.67Å; D51-R54 PolarHBondContact OD1-NH1 2.97Å; D51-R54 IonicContact OD1-NH2 2.71Å; D51-R54 PolarHBondContact OD1-NH2 3.4Å; D51-R54 IonicContact OD2-NH2 3.24Å; D51-R54 PolarHBondContact OD2-NH2 3.46Å; D51-K55 WeakPolarHBondContact O-CB 3.46Å; D51-K55 WeakPolarHBondContact O-CG 3.24Å; D51-K55 PolarHBondContact O-N 3.06Å
52	L	79.8	Confident	74.4	Confident	131 Å²	131	115.2 Å²	115.2	69%	0.686	61%	0.608	S	S	*	*	H	α-helix	trans	-67.9	-46.1	176.5	-174.4	67.9	0	0	0	111.4	S50 R54 K55 R56	S50-L52 PolarHBondContact O-N 3.48Å; S50-L52 VanDerWaalsContact O-N 3.12Å; S50-L52 PolarHBondContact OG-N 3.36Å; L52-R54 VanDerWaalsContact C-N 3.34Å; L52-K55 PolarHBondContact O-N 3.42Å; L52-R56 WeakPolarHBondContact O-CB 3.48Å; L52-R56 PolarHBondContact O-N 2.92Å
53	L	78.3	Confident	74.6	Confident	110 Å²	110	117.3 Å²	117.3	58%	0.576	61%	0.606	S	S	*	*	H	α-helix	trans	-63.9	-42	176.8	-69.4	172.1	0	0	0	110.5	S50 K55 R56 L57	S50-L53 WeakPolarHBondContact O-CB 3.48Å; S50-L53 PolarHBondContact O-N 2.98Å; L53-K55 PolarHBondContact O-N 2.75Å; L53-R56 PolarHBondContact O-N 3.14Å; L53-R56 VanDerWaalsContact O-N 3.16Å; L53-L57 WeakPolarHBondContact O-CB 3.32Å; L53-L57 PolarHBondContact O-N 3.4Å
54	R	80.6	Confident	75.2	Confident	66 Å²	66	118.8 Å²	118.8	25%	0.249	61%	0.609	C	S	.	*	H	α-helix	trans	-62.1	-43.8	176	-169.3	174.8	65.8	-101.3	-0.6	112.2	S50 D51 L52 R56 L57 Q58	S50-R54 PolarHBondContact O-N 2.95Å; D51-R54 IonicContact OD1-CZ 3.12Å; D51-R54 IonicContact OD1-NH1 2.67Å; D51-R54 PolarHBondContact OD1-NH1 2.97Å; D51-R54 IonicContact OD1-NH2 2.71Å; D51-R54 PolarHBondContact OD1-NH2 3.4Å; D51-R54 IonicContact OD2-NH2 3.24Å; D51-R54 PolarHBondContact OD2-NH2 3.46Å; L52-R54 VanDerWaalsContact C-N 3.34Å; R54-R56 VanDerWaalsContact C-N 3.29Å; R54-R56 PolarHBondContact O-N 3.22Å; R54-L57 PolarHBondContact O-N 3.12Å; R54-Q58 HydrophobicContact CG-CG 4.17Å; R54-Q58 WeakPolarHBondContact O-CB 3.38Å; R54-Q58 WeakPolarHBondContact O-CG 3.32Å; R54-Q58 PolarHBondContact O-N 2.99Å
55	K	82.5	Confident	76.2	Confident	132 Å²	132	122.1 Å²	122.1	57%	0.574	62%	0.618	S	S	*	*	H	α-helix	trans	-63	-35.7	174.2	-79.3	177.2	178.7	174.1	0	112.4	D51 L52 L53 K59	D51-K55 WeakPolarHBondContact O-CB 3.46Å; D51-K55 WeakPolarHBondContact O-CG 3.24Å; D51-K55 PolarHBondContact O-N 3.06Å; L52-K55 PolarHBondContact O-N 3.42Å; L53-K55 PolarHBondContact O-N 2.75Å; K55-K59 VanDerWaalsContact O-CB 3.31Å; K55-K59 WeakPolarHBondContact O-CB 3.31Å; K55-K59 WeakPolarHBondContact O-CG 3.46Å; K55-K59 PolarHBondContact O-N 3.46Å; K55-K59 VanDerWaalsContact O-N 3.1Å
56	R	80.4	Confident	77.1	Confident	203 Å²	203	118.2 Å²	118.2	77%	0.766	61%	0.612	S	S	*	*	H	α-helix	trans	-71.6	-41.2	177.7	-169.1	178	177	94.6	0.7	111.6	L52 L53 R54 K59	L52-R56 WeakPolarHBondContact O-CB 3.48Å; L52-R56 PolarHBondContact O-N 2.92Å; L53-R56 PolarHBondContact O-N 3.14Å; L53-R56 VanDerWaalsContact O-N 3.16Å; R54-R56 VanDerWaalsContact C-N 3.29Å; R54-R56 PolarHBondContact O-N 3.22Å; R56-K59 CarbonylContact O-C 3.41Å
57	L	79.7	Confident	78.3	Confident	150 Å²	150	113.7 Å²	113.7	79%	0.785	60%	0.602	S	S	*	*	H	α-helix	trans	-74.5	-37.3	-180	-158.2	69.4	0	0	0	112.1	L53 R54 K59 G60	L53-L57 WeakPolarHBondContact O-CB 3.32Å; L53-L57 PolarHBondContact O-N 3.4Å; R54-L57 PolarHBondContact O-N 3.12Å; L57-K59 VanDerWaalsContact C-N 3.35Å; L57-G60 PolarHBondContact O-N 2.94Å
58	Q	77.3	Confident	79.6	Confident	142 Å²	142	110.3 Å²	110.3	66%	0.664	58%	0.576	S	S	*	*	H	α-helix	trans	-70.8	-28.8	174.3	-73.2	176.4	-17	0	0	112.8	R54 G60	R54-Q58 HydrophobicContact CG-CG 4.17Å; R54-Q58 WeakPolarHBondContact O-CB 3.38Å; R54-Q58 WeakPolarHBondContact O-CG 3.32Å; R54-Q58 PolarHBondContact O-N 2.99Å; Q58-G60 PolarHBondContact O-N 3.26Å
59	K	71.9	Confident	80.6	Confident	149 Å²	149	113.4 Å²	113.4	65%	0.648	57%	0.569	S	S	*	*	S	Bend	trans	-76.5	59	163.6	-77.7	173.8	171.9	176.4	0	109.5	K55 R56 L57	K55-K59 VanDerWaalsContact O-CB 3.31Å; K55-K59 WeakPolarHBondContact O-CB 3.31Å; K55-K59 WeakPolarHBondContact O-CG 3.46Å; K55-K59 PolarHBondContact O-N 3.46Å; K55-K59 VanDerWaalsContact O-N 3.1Å; R56-K59 CarbonylContact O-C 3.41Å; L57-K59 VanDerWaalsContact C-N 3.35Å
60	G	72.2	Confident	81.2	Confident	43 Å²	43	116.5 Å²	116.5	44%	0.443	57%	0.573	S	S	.	*			trans	-54.8	-171.8	174.2	0	0	0	0	0	112.6	L57 Q58 K62	L57-G60 PolarHBondContact O-N 2.94Å; Q58-G60 PolarHBondContact O-N 3.26Å; G60-K62 WeakPolarHBondContact O-CG 3.13Å; G60-K62 PolarHBondContact O-N 3.41Å
61	Q	75.2	Confident	81.5	Confident	157 Å²	157	118 Å²	118	73%	0.734	57%	0.574	S	S	*	*			trans	-49.1	105	176	-94.3	-75.7	-12.4	0	0	110.5	Y63	Q61-Y63 HydrophobicContact CB-CE2 4.27Å; Q61-Y63 WeakPolarHBondContact O-CD2 3.5Å; Q61-Y63 PolarHBondContact O-N 3.1Å; Q61-Y63 VanDerWaalsContact O-N 3.09Å
62	K	77.4	Confident	81.6	Confident	164 Å²	164	116.7 Å²	116.7	71%	0.713	57%	0.573	S	S	*	*			trans	-82.1	94.1	178.8	-60.5	-155.6	78.5	166.9	0	106.4	G60	G60-K62 WeakPolarHBondContact O-CG 3.13Å; G60-K62 PolarHBondContact O-N 3.41Å
63	Y	78.4	Confident	81.6	Confident	199 Å²	199	115.4 Å²	115.4	78%	0.78	56%	0.562	S	S	*	*	P	Polyproline II helix	trans	-60.7	138.9	165.3	-58	-74.1	0	0	0	108.4	Q61 D65	Q61-Y63 HydrophobicContact CB-CE2 4.27Å; Q61-Y63 WeakPolarHBondContact O-CD2 3.5Å; Q61-Y63 PolarHBondContact O-N 3.1Å; Q61-Y63 VanDerWaalsContact O-N 3.09Å; Y63-D65 PolarHBondContact O-N 2.82Å
64	F	83.6	Confident	81.5	Confident	117 Å²	117	112.4 Å²	112.4	51%	0.513	55%	0.553	S	S	.	*	P	Polyproline II helix	trans	-65.4	121.7	176.9	-168.5	-113.9	0	0	0	108.7	D68 Y69 A72	F64-D68 HydrophobicContact CD1-CB 4.14Å; F64-D68 HydrophobicContact CD2-CB 3.46Å; F64-D68 VanDerWaalsContact CD2-CB 3.46Å; F64-D68 VanDerWaalsContact CE1-C 3.47Å; F64-D68 HydrophobicContact CE1-CB 3.94Å; F64-D68 HydrophobicContact CE2-CB 3.17Å; F64-D68 HydrophobicContact CG-CB 3.96Å; F64-D68 HydrophobicContact CZ-CB 3.46Å; F64-D68 VanDerWaalsContact CZ-CB 3.46Å; F64-D68 WeakPolarHBondContact CZ-O 3.45Å; F64-Y69 HydrophobicContact CD1-CD2 4.46Å; F64-Y69 VanDerWaalsContact CE1-CB 3.46Å; F64-Y69 AromaticContact CE1-CD2 3.76Å; F64-Y69 HydrophobicContact CE1-CD2 3.76Å; F64-Y69 HydrophobicContact CE1-CG 4.03Å; F64-Y69 VanDerWaalsContact CZ-CA 3.41Å; F64-A72 HydrophobicContact CZ-CB 4.09Å
65	D	84.9	Confident	81.1	Confident	104 Å²	104	116.6 Å²	116.6	56%	0.556	57%	0.573	S	S	*	*	P	Polyproline II helix	trans	-66.2	142.9	174.2	-171.7	-4.2	0	0	0	108.1	Y63 G67 D68	Y63-D65 PolarHBondContact O-N 2.82Å; D65-G67 PolarHBondContact O-N 3.16Å; D65-D68 WeakPolarHBondContact O-CB 3.34Å; D65-D68 PolarHBondContact O-N 3.29Å
66	S	85.3	Confident	80.3	Confident	101 Å²	101	115.3 Å²	115.3	71%	0.706	57%	0.572	S	S	*	*	H	α-helix	trans	-49.3	-28.9	173.3	61.3	0	0	0	0	113
67	G	91.6	Very high	79.7	Confident	33 Å²	33	114.4 Å²	114.4	34%	0.34	57%	0.573	S	S	.	*	H	α-helix	trans	-72.6	-30.4	173.5	0	0	0	0	0	115.2	D65 Y69 N70	D65-G67 PolarHBondContact O-N 3.16Å; G67-Y69 PolarHBondContact O-N 2.97Å; G67-N70 PolarHBondContact O-N 2.72Å
68	D	89.9	Confident	78.9	Confident	66 Å²	66	113.3 Å²	113.3	35%	0.353	57%	0.568	S	S	.	*	H	α-helix	trans	-67.4	-26.7	177.7	-73.2	-27.5	0	0	0	111.4	F64 D65 N70 M71 A72	F64-D68 HydrophobicContact CD1-CB 4.14Å; F64-D68 HydrophobicContact CD2-CB 3.46Å; F64-D68 VanDerWaalsContact CD2-CB 3.46Å; F64-D68 VanDerWaalsContact CE1-C 3.47Å; F64-D68 HydrophobicContact CE1-CB 3.94Å; F64-D68 HydrophobicContact CE2-CB 3.17Å; F64-D68 HydrophobicContact CG-CB 3.96Å; F64-D68 HydrophobicContact CZ-CB 3.46Å; F64-D68 VanDerWaalsContact CZ-CB 3.46Å; F64-D68 WeakPolarHBondContact CZ-O 3.45Å; D65-D68 WeakPolarHBondContact O-CB 3.34Å; D65-D68 PolarHBondContact O-N 3.29Å; D68-N70 VanDerWaalsContact C-N 3.34Å; D68-N70 PolarHBondContact O-N 3.47Å; D68-M71 HydrophobicContact CB-CE 4.49Å; D68-M71 PolarHBondContact O-N 3.42Å; D68-M71 WeakPolarHBondContact OD1-CE 3.2Å; D68-A72 WeakPolarHBondContact O-CB 3.05Å; D68-A72 PolarHBondContact O-N 3.3Å
69	Y	89.4	Confident	78	Confident	128 Å²	128	113.9 Å²	113.9	50%	0.502	57%	0.568	S	S	.	*	H	α-helix	trans	-60.3	-45.9	179.8	-161.9	-86.7	0	0	0	111.7	F64 G67 A72 K73	F64-Y69 HydrophobicContact CD1-CD2 4.46Å; F64-Y69 VanDerWaalsContact CE1-CB 3.46Å; F64-Y69 AromaticContact CE1-CD2 3.76Å; F64-Y69 HydrophobicContact CE1-CD2 3.76Å; F64-Y69 HydrophobicContact CE1-CG 4.03Å; F64-Y69 VanDerWaalsContact CZ-CA 3.41Å; G67-Y69 PolarHBondContact O-N 2.97Å; Y69-A72 PolarHBondContact O-N 3.09Å; Y69-K73 HydrophobicContact CD1-CG 3.89Å; Y69-K73 HydrophobicContact CE1-CD 4.26Å; Y69-K73 HydrophobicContact CE1-CG 3.66Å; Y69-K73 WeakPolarHBondContact O-CB 3.29Å; Y69-K73 VanDerWaalsContact O-CG 3.29Å; Y69-K73 WeakPolarHBondContact O-CG 3.38Å; Y69-K73 PolarHBondContact O-N 2.8Å; Y69-K73 WeakPolarHBondContact OH-CE 3.2Å
70	N	88.8	Confident	77.3	Confident	117 Å²	117	115.5 Å²	115.5	63%	0.626	58%	0.578	S	S	*	*	H	α-helix	trans	-68.9	-38.8	-179.2	-71.8	-15.6	0	0	0	111.3	G67 D68 K73 A74	G67-N70 PolarHBondContact O-N 2.72Å; D68-N70 VanDerWaalsContact C-N 3.34Å; D68-N70 PolarHBondContact O-N 3.47Å; N70-K73 PolarHBondContact O-N 3.33Å; N70-A74 WeakPolarHBondContact O-CB 3.2Å; N70-A74 PolarHBondContact O-N 3Å
71	M	86.9	Confident	76.2	Confident	95 Å²	95	118.1 Å²	118.1	47%	0.468	58%	0.582	S	S	.	*	H	α-helix	trans	-66.6	-42	176	-69.5	-170.4	-73.4	0	0	112.3	D68 A74 K75	D68-M71 HydrophobicContact CB-CE 4.49Å; D68-M71 PolarHBondContact O-N 3.42Å; D68-M71 WeakPolarHBondContact OD1-CE 3.2Å; M71-A74 PolarHBondContact O-N 2.84Å; M71-K75 WeakPolarHBondContact O-CB 3.43Å; M71-K75 WeakPolarHBondContact O-CG 3.39Å; M71-K75 PolarHBondContact O-N 3.38Å
72	A	78.9	Confident	75.2	Confident	43 Å²	43	116.4 Å²	116.4	36%	0.355	58%	0.584	S	S	.	*	H	α-helix	trans	-63.9	-44.2	177	0	0	0	0	0	111.5	F64 D68 Y69 K75 I76	F64-A72 HydrophobicContact CZ-CB 4.09Å; D68-A72 WeakPolarHBondContact O-CB 3.05Å; D68-A72 PolarHBondContact O-N 3.3Å; Y69-A72 PolarHBondContact O-N 3.09Å; A72-K75 PolarHBondContact O-N 3.43Å; A72-I76 WeakPolarHBondContact O-CG1 3.03Å; A72-I76 PolarHBondContact O-N 2.98Å
73	K	79.8	Confident	73.8	Confident	105 Å²	105	113.8 Å²	113.8	46%	0.457	58%	0.582	S	S	.	*	H	α-helix	trans	-65.9	-35.3	175.1	-71.9	-67.5	-167.9	175.6	0	112.9	Y69 N70 I76 K77	Y69-K73 HydrophobicContact CD1-CG 3.89Å; Y69-K73 HydrophobicContact CE1-CD 4.26Å; Y69-K73 HydrophobicContact CE1-CG 3.66Å; Y69-K73 WeakPolarHBondContact O-CB 3.29Å; Y69-K73 VanDerWaalsContact O-CG 3.29Å; Y69-K73 WeakPolarHBondContact O-CG 3.38Å; Y69-K73 PolarHBondContact O-N 2.8Å; Y69-K73 WeakPolarHBondContact OH-CE 3.2Å; N70-K73 PolarHBondContact O-N 3.33Å; K73-I76 HydrophobicContact CD-CD1 3.9Å; K73-I76 WeakPolarHBondContact O-CG1 3.47Å; K73-K77 PolarHBondContact O-N 3.43Å
74	A	76.8	Confident	72.6	Confident	47 Å²	47	108.4 Å²	108.4	39%	0.388	58%	0.578	S	S	.	*	H	α-helix	trans	-72.6	-38.3	175.9	0	0	0	0	0	112.4	N70 M71 I76 K77 N78	N70-A74 WeakPolarHBondContact O-CB 3.2Å; N70-A74 PolarHBondContact O-N 3Å; M71-A74 PolarHBondContact O-N 2.84Å; A74-I76 VanDerWaalsContact C-N 3.35Å; A74-I76 PolarHBondContact O-N 2.9Å; A74-K77 PolarHBondContact O-N 3.29Å; A74-N78 WeakPolarHBondContact O-CB 3.21Å; A74-N78 PolarHBondContact O-N 2.88Å
75	K	73.3	Confident	71	Confident	153 Å²	153	106.6 Å²	106.6	67%	0.665	59%	0.585	S	S	*	*	H	α-helix	trans	-62.3	-37.8	176.7	-76.4	169.4	-175.2	176.5	0	112.7	M71 A72 N78	M71-K75 WeakPolarHBondContact O-CB 3.43Å; M71-K75 WeakPolarHBondContact O-CG 3.39Å; M71-K75 PolarHBondContact O-N 3.38Å; A72-K75 PolarHBondContact O-N 3.43Å; K75-N78 CarbonylContact O-C 3.15Å
76	I	64.8	Low	69.5	Low	106 Å²	106	106.7 Å²	106.7	54%	0.544	59%	0.592	S	S	.	*	H	α-helix	trans	-73.5	-30	174.6	57	177.3	0	0	0	113	A72 K73 A74	A72-I76 WeakPolarHBondContact O-CG1 3.03Å; A72-I76 PolarHBondContact O-N 2.98Å; K73-I76 HydrophobicContact CD-CD1 3.9Å; K73-I76 WeakPolarHBondContact O-CG1 3.47Å; A74-I76 VanDerWaalsContact C-N 3.35Å; A74-I76 PolarHBondContact O-N 2.9Å
77	K	68.2	Low	67.7	Low	184 Å²	184	110.1 Å²	110.1	80%	0.8	60%	0.597	S	S	*	*	H	α-helix	trans	-76.5	-35.9	176.1	-170.9	179.1	178.1	-176.8	0	111.8	K73 A74 K79	K73-K77 PolarHBondContact O-N 3.43Å; A74-K77 PolarHBondContact O-N 3.29Å; K77-K79 PolarHBondContact O-N 3.36Å
78	N	62.1	Low	66.1	Low	126 Å²	126	117.7 Å²	117.7	67%	0.674	62%	0.62	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.1	43.2	168.7	-68.8	-21.2	0	0	0	111.2	A74 K75 Q80	A74-N78 WeakPolarHBondContact O-CB 3.21Å; A74-N78 PolarHBondContact O-N 2.88Å; K75-N78 CarbonylContact O-C 3.15Å; N78-Q80 PolarHBondContact O-N 2.84Å
79	K	59.6	Low	64.3	Low	154 Å²	154	119.7 Å²	119.7	67%	0.67	64%	0.635	S	S	*	*			trans	-71.6	57.2	155.1	-97.7	-179.7	165.7	-179.5	0	109.4	K77 L81	K77-K79 PolarHBondContact O-N 3.36Å; K79-L81 HydrophobicContact CB-CD1 4.3Å; K79-L81 HydrophobicContact CD-CD1 4.07Å; K79-L81 HydrophobicContact CG-CD1 3.86Å; K79-L81 PolarHBondContact O-N 3.49Å; K79-L81 VanDerWaalsContact O-N 3.08Å
80	Q	56.7	Low	62.9	Low	184 Å²	184	122.7 Å²	122.7	86%	0.86	65%	0.653	S	S	*	*				-71.7	84.6	128.5	-73.6	-171.1	62.5	0	0	103.9	N78	N78-Q80 PolarHBondContact O-N 2.84Å
81	L	48.5	Very low	61.4	Low	98 Å²	98	122.3 Å²	122.3	51%	0.513	65%	0.65	S	S	.	*			trans	-31.2	132.7	149.4	-115.7	66.7	0	0	0	106.5	K79 T83	K79-L81 HydrophobicContact CB-CD1 4.3Å; K79-L81 HydrophobicContact CD-CD1 4.07Å; K79-L81 HydrophobicContact CG-CD1 3.86Å; K79-L81 PolarHBondContact O-N 3.49Å; K79-L81 VanDerWaalsContact O-N 3.08Å; L81-T83 PolarHBondContact O-N 3.15Å
82	P	54.9	Low	59.8	Low	121 Å²	121	123.8 Å²	123.8	79%	0.786	66%	0.664	S	S	*	*			trans	-51.9	108.2	131.7	25.8	-27.2	0	0	0	103.2	A84	P82-A84 PolarHBondContact O-N 3.3Å
83	T	47.7	Very low	59.3	Low	109 Å²	109	125.8 Å²	125.8	67%	0.669	69%	0.689	S	S	*	*			trans	-52.2	97.8	164.2	-77	0	0	0	0	103.3	L81 A85	L81-T83 PolarHBondContact O-N 3.15Å; T83-A85 PolarHBondContact O-N 3.26Å
84	A	52.7	Low	58.6	Low	85 Å²	85	128.4 Å²	128.4	70%	0.702	71%	0.708	S	S	*	*			trans	-57.8	101.1	155.4	0	0	0	0	0	101.8	P82 P86	P82-A84 PolarHBondContact O-N 3.3Å; A84-P86 WeakPolarHBondContact O-CD 3.46Å; A84-P86 VanDerWaalsContact O-N 3.07Å
85	A	50.6	Low	58.8	Low	79 Å²	79	131.7 Å²	131.7	65%	0.653	72%	0.715	S	S	*	*			trans	-50	120.6	175.3	0	0	0	0	0	106.1	T83 E87	T83-A85 PolarHBondContact O-N 3.26Å; A85-E87 PolarHBondContact O-N 3.43Å
86	P	52.4	Low	59	Low	107 Å²	107	131.3 Å²	131.3	70%	0.695	72%	0.719	S	S	*	*			trans	-66.5	123.4	167.5	28.5	-28.7	0	0	0	105.7	A84	A84-P86 WeakPolarHBondContact O-CD 3.46Å; A84-P86 VanDerWaalsContact O-N 3.07Å
87	E	49	Very low	59.5	Low	173 Å²	173	130.4 Å²	130.4	81%	0.808	72%	0.72	S	S	*	*			trans	71.7	114.1	163.8	-50.6	-178	-173.7	0	0	115.3	A85	A85-E87 PolarHBondContact O-N 3.43Å
88	K	56.4	Low	60.1	Low	192 Å²	192	124.8 Å²	124.8	84%	0.835	70%	0.701	S	S	*	*				-151	131.9	92.9	-70	-137	179.4	-166.2	0	110.9
89	T	53	Low	60.7	Low	107 Å²	107	124.8 Å²	124.8	66%	0.656	71%	0.708	S	S	*	*			trans	65	106.8	161.5	60.8	0	0	0	0	116.5	I91	T89-I91 VanDerWaalsContact C-N 3.32Å; T89-I91 WeakPolarHBondContact O-CG1 3.13Å; T89-I91 PolarHBondContact O-N 2.82Å
90	E	59.3	Low	61.6	Low	192 Å²	192	125.7 Å²	125.7	90%	0.897	72%	0.715	S	S	*	*			trans	-38.8	100.1	141.8	-63.4	171.7	159.3	0	0	109.4	T92	E90-T92 PolarHBondContact O-N 3.45Å
91	I	58.9	Low	62.5	Low	109 Å²	109	121.6 Å²	121.6	56%	0.559	70%	0.699	S	S	*	*			trans	-99.3	59.5	168.5	-21.4	175.3	0	0	0	106.2	T89 G93 H95	T89-I91 VanDerWaalsContact C-N 3.32Å; T89-I91 WeakPolarHBondContact O-CG1 3.13Å; T89-I91 PolarHBondContact O-N 2.82Å; I91-G93 PolarHBondContact O-N 3.2Å; I91-H95 HydrophobicContact CG2-CB 3.65Å
92	T	53.2	Low	63.7	Low	125 Å²	125	121.7 Å²	121.7	77%	0.767	70%	0.699	S	S	*	*			trans	-66.9	92.6	171.2	-61.9	0	0	0	0	107.1	E90 D94	E90-T92 PolarHBondContact O-N 3.45Å; T92-D94 PolarHBondContact O-N 2.89Å
93	G	66.9	Low	64.9	Low	85 Å²	85	121.5 Å²	121.5	88%	0.876	70%	0.698	S	S	*	*	S	Bend	trans	63.4	-11.8	157.1	0	0	0	0	0	119.5	I91	I91-G93 PolarHBondContact O-N 3.2Å
94	D	66.1	Low	66.5	Low	160 Å²	160	125.4 Å²	125.4	86%	0.856	71%	0.709	S	S	*	*	S	Bend	trans	-106.2	-16.7	-165.9	-148.3	30.6	0	0	0	114.1	T92	T92-D94 PolarHBondContact O-N 2.89Å
95	H	80.3	Confident	67.7	Low	116 Å²	116	132.4 Å²	132.4	54%	0.537	72%	0.717	S	S	.	*	S	Bend	trans	-110.4	104.7	178.1	-171.9	-76.3	0	0	0	110.9	I91	I91-H95 HydrophobicContact CG2-CB 3.65Å
96	I	76.8	Confident	69.1	Low	146 Å²	146	138.1 Å²	138.1	75%	0.749	73%	0.727	S	S	*	*	P	Polyproline II helix	trans	-64.1	123.8	175.4	-58	-179.7	0	0	0	108.5	T98	I96-T98 PolarHBondContact O-N 3.23Å
97	P	75.8	Confident	70.3	Confident	86 Å²	86	139 Å²	139	56%	0.558	73%	0.733	S	S	*	*	P	Polyproline II helix	trans	-63	122.8	179.3	24.5	-32.4	0	0	0	109.9	L102	P97-L102 HydrophobicContact CB-CD1 4Å
98	T	80.5	Confident	71.6	Confident	66 Å²	66	135.3 Å²	135.3	41%	0.405	73%	0.726	S	S	.	*	P	Polyproline II helix	trans	-79.1	156.4	177.6	67.8	0	0	0	0	109.6	I96 Q100 D101	I96-T98 PolarHBondContact O-N 3.23Å; T98-Q100 PolarHBondContact O-N 2.91Å; T98-D101 PolarHBondContact N-OD2 3.21Å; T98-D101 VanDerWaalsContact N-OD2 3.09Å; T98-D101 WeakPolarHBondContact O-CB 3.47Å; T98-D101 PolarHBondContact O-N 2.97Å; T98-D101 PolarHBondContact OG1-OD2 3.08Å
99	P	75.4	Confident	72.3	Confident	126 Å²	126	134.3 Å²	134.3	82%	0.818	73%	0.729	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.6	-13.4	179.6	21.4	-32	0	0	0	114.1
100	Q	77.6	Confident	73.1	Confident	173 Å²	173	135.1 Å²	135.1	81%	0.808	73%	0.733	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.5	-25.8	173.9	-162.9	63.1	23.1	0	0	112.9	T98 L102	T98-Q100 PolarHBondContact O-N 2.91Å; Q100-L102 VanDerWaalsContact C-N 3.32Å
101	D	76.1	Confident	73.6	Confident	99 Å²	99	129.9 Å²	129.9	53%	0.529	72%	0.723	S	S	.	*	T	Hydrogen-bonded Turn	trans	-83	-12.9	179.2	-58.6	-44.4	0	0	0	112.3	T98	T98-D101 PolarHBondContact N-OD2 3.21Å; T98-D101 VanDerWaalsContact N-OD2 3.09Å; T98-D101 WeakPolarHBondContact O-CB 3.47Å; T98-D101 PolarHBondContact O-N 2.97Å; T98-D101 PolarHBondContact OG1-OD2 3.08Å
102	L	73.3	Confident	74.5	Confident	99 Å²	99	129.6 Å²	129.6	52%	0.518	73%	0.731	S	S	.	*	S	Bend	trans	-88.8	138.2	176.7	-98.5	69.3	0	0	0	110.8	P97 Q100 Q104	P97-L102 HydrophobicContact CB-CD1 4Å; Q100-L102 VanDerWaalsContact C-N 3.32Å; L102-Q104 PolarHBondContact O-N 2.87Å
103	P	81.6	Confident	75.4	Confident	118 Å²	118	133.4 Å²	133.4	77%	0.766	74%	0.737	S	S	*	*	P	Polyproline II helix	trans	-57.8	129.7	173.4	24.5	-33	0	0	0	109.9	R105	P103-R105 PolarHBondContact O-N 2.69Å; P103-R105 VanDerWaalsContact O-N 3.15Å
104	Q	79.7	Confident	75.4	Confident	191 Å²	191	136.8 Å²	136.8	89%	0.893	73%	0.734	S	S	*	*	P	Polyproline II helix	trans	-58.9	119.4	-175.7	-143.3	172.1	17.4	0	0	109.9	L102 K106	L102-Q104 PolarHBondContact O-N 2.87Å; Q104-K106 PolarHBondContact O-N 2.87Å
105	R	78	Confident	74.9	Confident	232 Å²	232	134.5 Å²	134.5	88%	0.875	74%	0.737	S	S	*	*	P	Polyproline II helix	trans	-64.7	130.2	176.6	-76.6	-178.8	168.4	152	-2	108.9	P103	P103-R105 PolarHBondContact O-N 2.69Å; P103-R105 VanDerWaalsContact O-N 3.15Å
106	K	80.8	Confident	73.4	Confident	199 Å²	199	136.3 Å²	136.3	87%	0.865	79%	0.787	S	S	*	*	P	Polyproline II helix	trans	-63.5	129.3	173.8	-63.1	-175.2	-179.7	-178.3	0	108.8	Q104 S108	Q104-K106 PolarHBondContact O-N 2.87Å; K106-S108 PolarHBondContact O-N 2.84Å
107	P	78.1	Confident	73.3	Confident	125 Å²	125	135.8 Å²	135.8	81%	0.812	79%	0.789	S	S	*	*	P	Polyproline II helix	trans	-61.5	135.2	175.3	25.3	-32.6	0	0	0	109.7	L109	P107-L109 PolarHBondContact O-N 2.76Å
108	S	75.8	Confident	73.1	Confident	95 Å²	95	138.4 Å²	138.4	66%	0.664	80%	0.801	S	S	*	*	P	Polyproline II helix	trans	-67.5	127.7	179.4	133.4	0	0	0	0	110	K106 V110	K106-S108 PolarHBondContact O-N 2.84Å; S108-V110 PolarHBondContact O-N 3.2Å; S108-V110 VanDerWaalsContact O-N 3.14Å; S108-V110 WeakPolarHBondContact OG-CG2 3.36Å; S108-V110 PolarHBondContact OG-N 3.22Å
109	L	70.8	Confident	72.7	Confident	171 Å²	171	142.4 Å²	142.4	90%	0.895	82%	0.823	S	S	*	*			trans	-84.6	34.9	178.2	-141.9	168	0	0	0	111.8	P107 A111	P107-L109 PolarHBondContact O-N 2.76Å; L109-A111 PolarHBondContact O-N 3.09Å
110	V	70.8	Confident	72.6	Confident	124 Å²	124	143.4 Å²	143.4	75%	0.752	82%	0.823	S	S	*	*			trans	-84.8	96.6	174.9	-178.8	0	0	0	0	107.7	S108 S112	S108-V110 PolarHBondContact O-N 3.2Å; S108-V110 VanDerWaalsContact O-N 3.14Å; S108-V110 WeakPolarHBondContact OG-CG2 3.36Å; S108-V110 PolarHBondContact OG-N 3.22Å; V110-S112 PolarHBondContact O-N 3.47Å
111	A	70	Confident	72.3	Confident	82 Å²	82	141.6 Å²	141.6	68%	0.678	82%	0.824	S	S	*	*			trans	-72.1	121.6	165.3	0	0	0	0	0	108.7	L109 K113	L109-A111 PolarHBondContact O-N 3.09Å; A111-K113 PolarHBondContact O-N 2.75Å
112	S	75.9	Confident	72	Confident	103 Å²	103	144.4 Å²	144.4	72%	0.72	84%	0.844	S	S	*	*			trans	-61.2	116.4	172.7	-176.5	0	0	0	0	109.3	V110 L114	V110-S112 PolarHBondContact O-N 3.47Å; S112-L114 VanDerWaalsContact C-N 3.3Å; S112-L114 PolarHBondContact O-N 2.91Å
113	K	72.1	Confident	71.9	Confident	206 Å²	206	147.6 Å²	147.6	90%	0.896	87%	0.867	S	S	*	*			trans	-89.6	70.4	167.1	-73.7	-178.5	167.9	-179.4	0	108.8	A111	A111-K113 PolarHBondContact O-N 2.75Å
114	L	66.9	Low	71.2	Confident	155 Å²	155	149.9 Å²	149.9	81%	0.812	88%	0.875	S	S	*	*			trans	-129	125.3	161.3	-120	95.6	0	0	0	107.7	S112	S112-L114 VanDerWaalsContact C-N 3.3Å; S112-L114 PolarHBondContact O-N 2.91Å
115	A	55.8	Low	70.5	Confident	112 Å²	112	146.5 Å²	146.5	93%	0.926	87%	0.873	S	S	*	*			trans	78.4	107.9	-171.2	0	0	0	0	0	115.3
116	G	50.6	Low	69.8	Low	154 Å²	154	138.7 Å²	138.7	100%	1.588	87%	0.873	S	S	*	*			trans	177.8	0	172.6	0	0	0	0	0	107.7

Retrieved 116 of 116 residues in 43.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).