A0A087YL45_POEFO Loading...

Mitochondrial import inner membrane translocase subunit

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

AlphaFold DB (A0A3B3TNM0), UniProt , Accession A0A087YL45, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 89 aa.

						>A0A087YL45_POEFO|A0A087YL45
MAVQVTESDQIKQFKEFLGTYNKVTENCFMDCVKDFTTRDVKPEESSCSESCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	41.5	Very low	74.9	Confident	242 Å²	242	115.9 Å²	115.9	100%	1.192	64%	0.635	S	S	*	*				0	118	0	-63.7	177.2	179.9	0	0	106.7	V3	M1-V3 PolarHBondContact O-N 3.28Å
2	A	48.5	Very low	76.5	Confident	99 Å²	99	116.1 Å²	116.1	82%	0.818	63%	0.625	S	S	*	*			trans	-71.6	115.3	175.5	0	0	0	0	0	107.9	Q4	A2-Q4 PolarHBondContact O-N 3.1Å; A2-Q4 VanDerWaalsContact O-N 3.11Å
3	V	61.9	Low	77.9	Confident	131 Å²	131	116.2 Å²	116.2	79%	0.794	62%	0.619	S	S	*	*			trans	-66.2	108.9	172.9	175.3	0	0	0	0	106.7	M1 V5	M1-V3 PolarHBondContact O-N 3.28Å; V3-V5 PolarHBondContact O-N 3.5Å
4	Q	62.7	Low	79.1	Confident	174 Å²	174	117.1 Å²	117.1	81%	0.813	62%	0.615	S	S	*	*			trans	-71.9	111.5	170.1	-73.3	-166.6	-18	0	0	107.9	A2 T6	A2-Q4 PolarHBondContact O-N 3.1Å; A2-Q4 VanDerWaalsContact O-N 3.11Å; Q4-T6 PolarHBondContact O-N 2.92Å
5	V	74	Confident	80.2	Confident	77 Å²	77	120.1 Å²	120.1	47%	0.467	62%	0.621	S	S	.	*			trans	-65.4	115.5	170.3	-174.5	0	0	0	0	106.8	V3 D9 Q10	V3-V5 PolarHBondContact O-N 3.5Å; V5-D9 HydrophobicContact CG1-CB 3.97Å; V5-Q10 HydrophobicContact CG1-CG 3.68Å
6	T	85.5	Confident	81.2	Confident	63 Å²	63	121 Å²	121	39%	0.387	62%	0.621	S	S	.	*			trans	-71.9	152.8	179.8	73.2	0	0	0	0	109.8	Q4 S8 D9 Q10	Q4-T6 PolarHBondContact O-N 2.92Å; T6-S8 PolarHBondContact O-N 3.13Å; T6-S8 VanDerWaalsContact O-N 3.13Å; T6-S8 PolarHBondContact OG1-OG 3.29Å; T6-D9 WeakPolarHBondContact CB-OD2 3.45Å; T6-D9 PolarHBondContact N-OD2 3.11Å; T6-D9 WeakPolarHBondContact O-CA 3.39Å; T6-D9 WeakPolarHBondContact O-CB 3.24Å; T6-D9 PolarHBondContact O-N 3.39Å; T6-D9 PolarHBondContact OG1-N 3.4Å; T6-D9 PolarHBondContact OG1-OD2 2.96Å; T6-Q10 PolarHBondContact O-N 3.34Å; T6-Q10 VanDerWaalsContact O-N 3.12Å
7	E	85.9	Confident	82	Confident	150 Å²	150	121 Å²	121	70%	0.701	62%	0.616	S	S	*	*	H	α-helix	trans	-52.6	-35.9	174.2	-171.3	179.8	94.8	0	0	111.3	D9 Q10 I11	E7-D9 VanDerWaalsContact C-N 3.33Å; E7-D9 PolarHBondContact O-N 3.36Å; E7-Q10 PolarHBondContact O-N 3.47Å; E7-I11 HydrophobicContact CG-CD1 4.39Å; E7-I11 WeakPolarHBondContact O-CG1 3.41Å; E7-I11 PolarHBondContact O-N 2.83Å
8	S	88.5	Confident	82.9	Confident	60 Å²	60	118.4 Å²	118.4	42%	0.42	60%	0.603	S	S	.	*	H	α-helix	trans	-64.4	-33.3	175.6	80.7	0	0	0	0	113.6	T6 K12	T6-S8 PolarHBondContact O-N 3.13Å; T6-S8 VanDerWaalsContact O-N 3.13Å; T6-S8 PolarHBondContact OG1-OG 3.29Å; S8-K12 VanDerWaalsContact O-CG 3.28Å; S8-K12 WeakPolarHBondContact O-CG 3.37Å; S8-K12 PolarHBondContact O-N 3.31Å
9	D	91.3	Very high	83.6	Confident	57 Å²	57	114.4 Å²	114.4	31%	0.305	59%	0.594	S	S	.	*	H	α-helix	trans	-76.4	-34.4	177.3	-61.7	-44.9	0	0	0	111.5	V5 T6 E7 K12 Q13	V5-D9 HydrophobicContact CG1-CB 3.97Å; T6-D9 WeakPolarHBondContact CB-OD2 3.45Å; T6-D9 PolarHBondContact N-OD2 3.11Å; T6-D9 WeakPolarHBondContact O-CA 3.39Å; T6-D9 WeakPolarHBondContact O-CB 3.24Å; T6-D9 PolarHBondContact O-N 3.39Å; T6-D9 PolarHBondContact OG1-N 3.4Å; T6-D9 PolarHBondContact OG1-OD2 2.96Å; E7-D9 VanDerWaalsContact C-N 3.33Å; E7-D9 PolarHBondContact O-N 3.36Å; D9-K12 PolarHBondContact O-N 3.29Å; D9-K12 IonicContact OD1-NZ 3.46Å; D9-K12 PolarHBondContact OD1-NZ 3.14Å; D9-Q13 WeakPolarHBondContact O-CG 3.42Å; D9-Q13 PolarHBondContact O-N 3.12Å
10	Q	90.8	Very high	84.3	Confident	114 Å²	114	111.9 Å²	111.9	53%	0.533	59%	0.585	S	S	.	*	H	α-helix	trans	-63	-43.9	172.6	-63.7	-179.8	-39.4	0	0	111.4	V5 T6 E7 K12 Q13 F14	V5-Q10 HydrophobicContact CG1-CG 3.68Å; T6-Q10 PolarHBondContact O-N 3.34Å; T6-Q10 VanDerWaalsContact O-N 3.12Å; E7-Q10 PolarHBondContact O-N 3.47Å; Q10-K12 VanDerWaalsContact C-N 3.33Å; Q10-K12 PolarHBondContact O-N 2.86Å; Q10-Q13 PolarHBondContact O-N 3.01Å; Q10-F14 PolarHBondContact O-N 3.26Å
11	I	93.2	Very high	84.9	Confident	108 Å²	108	112.7 Å²	112.7	55%	0.554	58%	0.581	S	S	*	*	H	α-helix	trans	-62.1	-42	176.9	-67.5	167.8	0	0	0	110.9	E7 F14 K15	E7-I11 HydrophobicContact CG-CD1 4.39Å; E7-I11 WeakPolarHBondContact O-CG1 3.41Å; E7-I11 PolarHBondContact O-N 2.83Å; I11-F14 PolarHBondContact O-N 3.43Å; I11-K15 WeakPolarHBondContact O-CB 2.88Å; I11-K15 PolarHBondContact O-N 3.18Å
12	K	94.1	Very high	87.6	Confident	118 Å²	118	106 Å²	106	51%	0.513	55%	0.55	S	S	.	.	H	α-helix	trans	-62	-49.3	176.3	-72.6	169.2	-166.6	163.8	0	111.6	S8 D9 Q10 F14 K15 E16	S8-K12 VanDerWaalsContact O-CG 3.28Å; S8-K12 WeakPolarHBondContact O-CG 3.37Å; S8-K12 PolarHBondContact O-N 3.31Å; D9-K12 PolarHBondContact O-N 3.29Å; D9-K12 IonicContact OD1-NZ 3.46Å; D9-K12 PolarHBondContact OD1-NZ 3.14Å; Q10-K12 VanDerWaalsContact C-N 3.33Å; Q10-K12 PolarHBondContact O-N 2.86Å; K12-F14 VanDerWaalsContact C-N 3.28Å; K12-F14 PolarHBondContact O-N 3.31Å; K12-K15 WeakPolarHBondContact O-CB 3.28Å; K12-K15 PolarHBondContact O-N 3.33Å; K12-K15 VanDerWaalsContact O-N 3.11Å; K12-E16 PolarHBondContact O-N 3.01Å
13	Q	94.3	Very high	89.9	Confident	118 Å²	118	105.8 Å²	105.8	55%	0.551	53%	0.53	S	S	*	.	H	α-helix	trans	-57.9	-42	178.2	-74.2	178.5	6.9	0	0	111.8	D9 Q10 E16 F17	D9-Q13 WeakPolarHBondContact O-CG 3.42Å; D9-Q13 PolarHBondContact O-N 3.12Å; Q10-Q13 PolarHBondContact O-N 3.01Å; Q13-E16 PolarHBondContact O-N 3.22Å; Q13-F17 WeakPolarHBondContact O-CB 3.35Å; Q13-F17 PolarHBondContact O-N 3.36Å
14	F	94.7	Very high	91.6	Very high	128 Å²	128	100.1 Å²	100.1	56%	0.561	50%	0.496	S	S	*	.	H	α-helix	trans	-65.5	-40.3	177.4	-167	-106.4	0	0	0	112.2	Q10 I11 K12 F17 L18	Q10-F14 PolarHBondContact O-N 3.26Å; I11-F14 PolarHBondContact O-N 3.43Å; K12-F14 VanDerWaalsContact C-N 3.28Å; K12-F14 PolarHBondContact O-N 3.31Å; F14-F17 WeakPolarHBondContact O-CB 3.31Å; F14-F17 PolarHBondContact O-N 3.15Å; F14-L18 HydrophobicContact CD1-CD1 3.91Å; F14-L18 HydrophobicContact CD1-CG 4.29Å; F14-L18 HydrophobicContact CE1-CD1 3.58Å; F14-L18 HydrophobicContact CE1-CD2 4.39Å; F14-L18 HydrophobicContact CE1-CG 4.03Å; F14-L18 HydrophobicContact CZ-CD1 4.32Å; F14-L18 HydrophobicContact CZ-CD2 4.33Å; F14-L18 HydrophobicContact CZ-CG 4.38Å; F14-L18 WeakPolarHBondContact O-CG 3.48Å; F14-L18 PolarHBondContact O-N 2.95Å
15	K	96.3	Very high	93.3	Very high	163 Å²	163	95 Å²	95	71%	0.709	48%	0.477	S	S	*	.	H	α-helix	trans	-63.3	-42.5	175.5	-172.4	176.6	179.9	-179.9	0	112	I11 K12 F17 L18 G19	I11-K15 WeakPolarHBondContact O-CB 2.88Å; I11-K15 PolarHBondContact O-N 3.18Å; K12-K15 WeakPolarHBondContact O-CB 3.28Å; K12-K15 PolarHBondContact O-N 3.33Å; K12-K15 VanDerWaalsContact O-N 3.11Å; K15-F17 VanDerWaalsContact C-N 3.35Å; K15-L18 PolarHBondContact O-N 3.44Å; K15-G19 PolarHBondContact O-N 3.46Å
16	E	95.3	Very high	94.4	Very high	134 Å²	134	95.9 Å²	95.9	63%	0.626	48%	0.476	S	S	*	.	H	α-helix	trans	-64.6	-39.6	175.2	-72.3	-178.5	110.2	0	0	112.1	K12 Q13 G19 T20	K12-E16 PolarHBondContact O-N 3.01Å; Q13-E16 PolarHBondContact O-N 3.22Å; E16-G19 PolarHBondContact O-N 3.17Å; E16-T20 WeakPolarHBondContact O-CB 3.38Å; E16-T20 PolarHBondContact O-N 3.06Å; E16-T20 PolarHBondContact O-OG1 3.32Å
17	F	96.1	Very high	95	Very high	121 Å²	121	95.4 Å²	95.4	53%	0.531	47%	0.471	S	S	.	.	H	α-helix	trans	-59.1	-50	173.8	170.7	-99.7	0	0	0	111.5	Q13 F14 K15 G19 T20 Y21	Q13-F17 WeakPolarHBondContact O-CB 3.35Å; Q13-F17 PolarHBondContact O-N 3.36Å; F14-F17 WeakPolarHBondContact O-CB 3.31Å; F14-F17 PolarHBondContact O-N 3.15Å; K15-F17 VanDerWaalsContact C-N 3.35Å; F17-G19 VanDerWaalsContact C-N 3.31Å; F17-G19 PolarHBondContact O-N 2.63Å; F17-T20 PolarHBondContact O-N 3.46Å; F17-Y21 WeakPolarHBondContact O-CB 3.43Å; F17-Y21 PolarHBondContact O-N 3.42Å
18	L	97.1	Very high	95.6	Very high	74 Å²	74	88.8 Å²	88.8	39%	0.387	44%	0.441	S	S	.	.	H	α-helix	trans	-62.3	-38.8	178	-69.2	178.8	0	0	0	112.2	F14 K15 T20 Y21 N22	F14-L18 HydrophobicContact CD1-CD1 3.91Å; F14-L18 HydrophobicContact CD1-CG 4.29Å; F14-L18 HydrophobicContact CE1-CD1 3.58Å; F14-L18 HydrophobicContact CE1-CD2 4.39Å; F14-L18 HydrophobicContact CE1-CG 4.03Å; F14-L18 HydrophobicContact CZ-CD1 4.32Å; F14-L18 HydrophobicContact CZ-CD2 4.33Å; F14-L18 HydrophobicContact CZ-CG 4.38Å; F14-L18 WeakPolarHBondContact O-CG 3.48Å; F14-L18 PolarHBondContact O-N 2.95Å; K15-L18 PolarHBondContact O-N 3.44Å; L18-T20 VanDerWaalsContact C-N 3.35Å; L18-Y21 PolarHBondContact O-N 2.87Å; L18-N22 PolarHBondContact O-N 2.95Å; L18-N22 PolarHBondContact O-ND2 3.37Å
19	G	97.5	Very high	96.1	Very high	42 Å²	42	90.8 Å²	90.8	43%	0.433	44%	0.442	S	S	.	.	H	α-helix	trans	-59.9	-45.8	173.8	0	0	0	0	0	112.1	K15 E16 F17 N22 K23	K15-G19 PolarHBondContact O-N 3.46Å; E16-G19 PolarHBondContact O-N 3.17Å; F17-G19 VanDerWaalsContact C-N 3.31Å; F17-G19 PolarHBondContact O-N 2.63Å; G19-N22 PolarHBondContact O-N 3.41Å; G19-K23 PolarHBondContact O-N 2.79Å
20	T	96.3	Very high	96.4	Very high	65 Å²	65	94.6 Å²	94.6	40%	0.399	46%	0.46	S	S	.	.	H	α-helix	trans	-66.5	-40.9	177.7	-55.1	0	0	0	0	111.8	E16 F17 L18 N22 K23 V24 Y56	E16-T20 WeakPolarHBondContact O-CB 3.38Å; E16-T20 PolarHBondContact O-N 3.06Å; E16-T20 PolarHBondContact O-OG1 3.32Å; F17-T20 PolarHBondContact O-N 3.46Å; L18-T20 VanDerWaalsContact C-N 3.35Å; T20-N22 PolarHBondContact O-N 3.3Å; T20-K23 PolarHBondContact O-N 3Å; T20-V24 WeakPolarHBondContact O-CG1 3.29Å; T20-V24 PolarHBondContact O-N 2.96Å; T20-Y56 HydrophobicContact CG2-CE1 4.14Å
21	Y	97.4	Very high	96.7	Very high	129 Å²	129	95.1 Å²	95.1	51%	0.506	47%	0.466	S	S	.	.	H	α-helix	trans	-57.8	-47.9	175.8	173.3	-94.5	0	0	0	111.4	F17 L18 K23 V24 T25	F17-Y21 WeakPolarHBondContact O-CB 3.43Å; F17-Y21 PolarHBondContact O-N 3.42Å; L18-Y21 PolarHBondContact O-N 2.87Å; Y21-K23 VanDerWaalsContact C-N 3.33Å; Y21-K23 PolarHBondContact O-N 3.06Å; Y21-V24 WeakPolarHBondContact O-CG1 3.33Å; Y21-T25 VanDerWaalsContact O-CB 3.31Å; Y21-T25 WeakPolarHBondContact O-CB 3.47Å; Y21-T25 PolarHBondContact O-N 2.7Å; Y21-T25 PolarHBondContact O-OG1 3.25Å
22	N	97.9	Very high	97	Very high	101 Å²	101	90.1 Å²	90.1	54%	0.54	44%	0.441	S	S	.	.	H	α-helix	trans	-64	-41.2	177.8	-70.5	-19.3	0	0	0	111.3	L18 G19 T20 T25 E26	L18-N22 PolarHBondContact O-N 2.95Å; L18-N22 PolarHBondContact O-ND2 3.37Å; G19-N22 PolarHBondContact O-N 3.41Å; T20-N22 PolarHBondContact O-N 3.3Å; N22-T25 PolarHBondContact O-N 3.13Å; N22-E26 WeakPolarHBondContact O-CB 3.37Å; N22-E26 PolarHBondContact O-N 3.11Å
23	K	97.5	Very high	97.1	Very high	94 Å²	94	86 Å²	86	41%	0.409	43%	0.426	S	S	.	.	H	α-helix	trans	-64.4	-45.1	-179.8	-171.2	70	-151.5	154	0	112.8	G19 T20 Y21 E26 N27	G19-K23 PolarHBondContact O-N 2.79Å; T20-K23 PolarHBondContact O-N 3Å; Y21-K23 VanDerWaalsContact C-N 3.33Å; Y21-K23 PolarHBondContact O-N 3.06Å; K23-E26 IonicContact NZ-OE2 2.79Å; K23-E26 PolarHBondContact NZ-OE2 3.07Å; K23-N27 WeakPolarHBondContact CE-OD1 3.28Å; K23-N27 PolarHBondContact NZ-OD1 3.48Å; K23-N27 VanDerWaalsContact O-CG 3.28Å; K23-N27 PolarHBondContact O-N 3.36Å; K23-N27 VanDerWaalsContact O-N 3.07Å; K23-N27 PolarHBondContact O-OD1 3.37Å
24	V	97.8	Very high	97.2	Very high	12 Å²	12	87.7 Å²	87.7	7%	0.073	43%	0.431	C	S	.	.	H	α-helix	trans	-69.6	-37.4	179	70.5	0	0	0	0	111.2	T20 Y21 N27 C28 L53 Y56	T20-V24 WeakPolarHBondContact O-CG1 3.29Å; T20-V24 PolarHBondContact O-N 2.96Å; Y21-V24 WeakPolarHBondContact O-CG1 3.33Å; V24-N27 PolarHBondContact O-N 2.98Å; V24-C28 WeakPolarHBondContact O-CB 3.49Å; V24-C28 PolarHBondContact O-N 3.31Å; V24-C28 PolarHBondContact O-SG 3.45Å; V24-C28 VanDerWaalsContact O-SG 3.36Å; V24-L53 HydrophobicContact CG1-CD1 4.18Å; V24-L53 HydrophobicContact CG2-CD1 3.83Å; V24-Y56 HydrophobicContact CB-CD1 3.97Å; V24-Y56 HydrophobicContact CB-CE1 4Å; V24-Y56 HydrophobicContact CB-CG 4.33Å; V24-Y56 HydrophobicContact CG2-CD1 3.55Å; V24-Y56 HydrophobicContact CG2-CD2 4.17Å; V24-Y56 HydrophobicContact CG2-CE1 4.11Å; V24-Y56 HydrophobicContact CG2-CG 3.59Å
25	T	97.8	Very high	97.2	Very high	66 Å²	66	84 Å²	84	41%	0.405	42%	0.417	S	S	.	.	H	α-helix	trans	-59.8	-48.7	175.4	-57.9	0	0	0	0	111.1	Y21 N22 F29	Y21-T25 VanDerWaalsContact O-CB 3.31Å; Y21-T25 WeakPolarHBondContact O-CB 3.47Å; Y21-T25 PolarHBondContact O-N 2.7Å; Y21-T25 PolarHBondContact O-OG1 3.25Å; N22-T25 PolarHBondContact O-N 3.13Å; T25-F29 VanDerWaalsContact O-CB 3.29Å; T25-F29 WeakPolarHBondContact O-CB 3.33Å; T25-F29 PolarHBondContact O-N 2.99Å
26	E	98.2	Very high	97.2	Very high	97 Å²	97	83.3 Å²	83.3	45%	0.453	42%	0.415	S	S	.	.	H	α-helix	trans	-58.8	-51	176.7	179.8	-174.1	-136.4	0	0	111.6	N22 K23 C28 F29 M30	N22-E26 WeakPolarHBondContact O-CB 3.37Å; N22-E26 PolarHBondContact O-N 3.11Å; K23-E26 IonicContact NZ-OE2 2.79Å; K23-E26 PolarHBondContact NZ-OE2 3.07Å; E26-C28 PolarHBondContact O-N 3.43Å; E26-F29 PolarHBondContact O-N 3.46Å; E26-M30 VanDerWaalsContact O-CG 3.32Å; E26-M30 WeakPolarHBondContact O-CG 3.39Å; E26-M30 PolarHBondContact O-N 3.36Å
27	N	97.8	Very high	97.3	Very high	53 Å²	53	82.1 Å²	82.1	28%	0.283	42%	0.417	S	S	.	.	H	α-helix	trans	-61.2	-47.9	-178.3	-72.1	-3.8	0	0	0	111.7	K23 V24 F29 M30 D31	K23-N27 WeakPolarHBondContact CE-OD1 3.28Å; K23-N27 PolarHBondContact NZ-OD1 3.48Å; K23-N27 VanDerWaalsContact O-CG 3.28Å; K23-N27 PolarHBondContact O-N 3.36Å; K23-N27 VanDerWaalsContact O-N 3.07Å; K23-N27 PolarHBondContact O-OD1 3.37Å; V24-N27 PolarHBondContact O-N 2.98Å; N27-F29 VanDerWaalsContact C-N 3.32Å; N27-F29 PolarHBondContact O-N 2.97Å; N27-M30 PolarHBondContact O-N 3.12Å; N27-D31 WeakPolarHBondContact O-CB 3.32Å; N27-D31 PolarHBondContact O-N 3.4Å
28	C	98.4	Very high	97.2	Very high	11 Å²	11	79.5 Å²	79.5	7%	0.074	41%	0.411	C	S	.	.	H	α-helix	trans	-68.5	-32.5	-179	-65.8	0	0	0	0	112.4	V24 E26 C32 C52	V24-C28 WeakPolarHBondContact O-CB 3.49Å; V24-C28 PolarHBondContact O-N 3.31Å; V24-C28 PolarHBondContact O-SG 3.45Å; V24-C28 VanDerWaalsContact O-SG 3.36Å; E26-C28 PolarHBondContact O-N 3.43Å; C28-C32 WeakPolarHBondContact O-CB 3.47Å; C28-C32 PolarHBondContact O-N 3.22Å; C28-C52 WeakPolarHBondContact CA-SG 3.31Å; C28-C52 HydrophobicContact CB-CB 3.81Å; C28-C52 WeakPolarHBondContact CB-SG 3.34Å; C28-C52 WeakPolarHBondContact SG-CB 3.37Å; C28-C52 CovalentContact SG-SG 2.05Å; C28-C52 PolarHBondContact SG-SG 2.97Å
29	F	98.1	Very high	97.2	Very high	101 Å²	101	88.1 Å²	88.1	44%	0.443	44%	0.438	S	S	.	.	H	α-helix	trans	-63	-49.9	172.1	-179.3	-92.2	0	0	0	111.1	T25 E26 N27 D31 C32 V33 F36	T25-F29 VanDerWaalsContact O-CB 3.29Å; T25-F29 WeakPolarHBondContact O-CB 3.33Å; T25-F29 PolarHBondContact O-N 2.99Å; E26-F29 PolarHBondContact O-N 3.46Å; N27-F29 VanDerWaalsContact C-N 3.32Å; N27-F29 PolarHBondContact O-N 2.97Å; F29-D31 VanDerWaalsContact C-N 3.31Å; F29-D31 PolarHBondContact O-N 2.88Å; F29-C32 PolarHBondContact O-N 3.24Å; F29-V33 HydrophobicContact CD2-CB 3.84Å; F29-V33 HydrophobicContact CD2-CG1 4.31Å; F29-V33 HydrophobicContact CD2-CG2 3.57Å; F29-V33 HydrophobicContact CE2-CB 3.76Å; F29-V33 HydrophobicContact CE2-CG1 3.73Å; F29-V33 HydrophobicContact CE2-CG2 3.83Å; F29-V33 HydrophobicContact CG-CB 4.35Å; F29-V33 HydrophobicContact CG-CG2 4.28Å; F29-V33 HydrophobicContact CZ-CB 4.2Å; F29-V33 HydrophobicContact CZ-CG1 4.06Å; F29-V33 WeakPolarHBondContact O-CB 3.49Å; F29-V33 PolarHBondContact O-N 3.06Å; F29-F36 HydrophobicContact CZ-CE1 4.17Å
30	M	97.7	Very high	97.1	Very high	137 Å²	137	92.2 Å²	92.2	68%	0.675	45%	0.45	S	S	*	.	H	α-helix	trans	-63.5	-34.4	-179.1	-68.6	-64.1	-175.3	0	0	113.2	E26 N27	E26-M30 VanDerWaalsContact O-CG 3.32Å; E26-M30 WeakPolarHBondContact O-CG 3.39Å; E26-M30 PolarHBondContact O-N 3.36Å; N27-M30 PolarHBondContact O-N 3.12Å
31	D	97.8	Very high	97	Very high	125 Å²	125	93.8 Å²	93.8	67%	0.668	46%	0.46	S	S	*	.	H	α-helix	trans	-82.7	-31.4	-178.7	-71.6	-20.5	0	0	0	113.2	N27 F29	N27-D31 WeakPolarHBondContact O-CB 3.32Å; N27-D31 PolarHBondContact O-N 3.4Å; F29-D31 VanDerWaalsContact C-N 3.31Å; F29-D31 PolarHBondContact O-N 2.88Å
32	C	98.3	Very high	97	Very high	4 Å²	4	90.9 Å²	90.9	3%	0.027	45%	0.45	C	S	.	.	H	α-helix	trans	-110.5	-35	-169.6	-67	0	0	0	0	115.1	C28 F29 K34 E45 C48 S49	C28-C32 WeakPolarHBondContact O-CB 3.47Å; C28-C32 PolarHBondContact O-N 3.22Å; F29-C32 PolarHBondContact O-N 3.24Å; C32-K34 PolarHBondContact O-N 3.33Å; C32-E45 WeakPolarHBondContact O-CG 3.33Å; C32-C48 VanDerWaalsContact CA-SG 3.52Å; C32-C48 HydrophobicContact CB-CB 3.6Å; C32-C48 WeakPolarHBondContact CB-SG 3.46Å; C32-C48 WeakPolarHBondContact SG-CB 3.49Å; C32-C48 PolarHBondContact SG-O 3.45Å; C32-C48 VanDerWaalsContact SG-O 3.37Å; C32-C48 CovalentContact SG-SG 2.05Å; C32-C48 PolarHBondContact SG-SG 3.2Å; C32-S49 PolarHBondContact SG-N 2.88Å; C32-S49 VanDerWaalsContact SG-N 3.42Å
33	V	97.4	Very high	96.9	Very high	31 Å²	31	91.4 Å²	91.4	19%	0.188	46%	0.458	C	S	.	.			trans	-88.1	103.1	-177.4	-175.7	0	0	0	0	108.7	F29 F36 E45	F29-V33 HydrophobicContact CD2-CB 3.84Å; F29-V33 HydrophobicContact CD2-CG1 4.31Å; F29-V33 HydrophobicContact CD2-CG2 3.57Å; F29-V33 HydrophobicContact CE2-CB 3.76Å; F29-V33 HydrophobicContact CE2-CG1 3.73Å; F29-V33 HydrophobicContact CE2-CG2 3.83Å; F29-V33 HydrophobicContact CG-CB 4.35Å; F29-V33 HydrophobicContact CG-CG2 4.28Å; F29-V33 HydrophobicContact CZ-CB 4.2Å; F29-V33 HydrophobicContact CZ-CG1 4.06Å; F29-V33 WeakPolarHBondContact O-CB 3.49Å; F29-V33 PolarHBondContact O-N 3.06Å; V33-F36 HydrophobicContact CG1-CE1 4.08Å; V33-F36 HydrophobicContact CG1-CZ 4.21Å; V33-E45 WeakPolarHBondContact CA-OE1 3.49Å
34	K	95.8	Very high	96.9	Very high	154 Å²	154	93.8 Å²	93.8	67%	0.67	47%	0.471	S	S	*	.			trans	-125	-16	-170.8	63.2	-176.3	177.6	-177.1	0	112.7	C32 E45	C32-K34 PolarHBondContact O-N 3.33Å; K34-E45 PolarHBondContact N-OE1 2.99Å
35	D	94.9	Very high	96.9	Very high	49 Å²	49	93.5 Å²	93.5	26%	0.262	47%	0.469	S	S	.	.			trans	-108.5	111.2	-178.1	-164.3	-35.8	0	0	0	111.1	T37 K42 E45	D35-T37 VanDerWaalsContact OD1-CB 3.26Å; D35-T37 WeakPolarHBondContact OD1-CB 3.33Å; D35-T37 VanDerWaalsContact OD1-CG2 3.3Å; D35-T37 WeakPolarHBondContact OD1-CG2 3.34Å; D35-T37 PolarHBondContact OD1-N 2.92Å; D35-T37 PolarHBondContact OD1-OG1 3.41Å; D35-K42 HydrophobicContact CB-CD 4.2Å; D35-K42 IonicContact OD1-NZ 3.6Å; D35-K42 WeakPolarHBondContact OD2-CE 3.42Å; D35-K42 IonicContact OD2-NZ 2.6Å; D35-K42 PolarHBondContact OD2-NZ 2.91Å; D35-E45 PolarHBondContact N-OE1 3.4Å
36	F	96.4	Very high	96.8	Very high	150 Å²	150	92.6 Å²	92.6	66%	0.658	47%	0.465	S	S	*	.			trans	-104.6	21.3	-178.9	-58.6	-82.9	0	0	0	112.7	F29 V33	F29-F36 HydrophobicContact CZ-CE1 4.17Å; V33-F36 HydrophobicContact CG1-CE1 4.08Å; V33-F36 HydrophobicContact CG1-CZ 4.21Å
37	T	96.8	Very high	96.8	Very high	109 Å²	109	91.2 Å²	91.2	67%	0.669	47%	0.466	S	S	*	.	S	Bend	trans	-80	-21	177.3	60.7	0	0	0	0	113.3	D35 K42	D35-T37 VanDerWaalsContact OD1-CB 3.26Å; D35-T37 WeakPolarHBondContact OD1-CB 3.33Å; D35-T37 VanDerWaalsContact OD1-CG2 3.3Å; D35-T37 WeakPolarHBondContact OD1-CG2 3.34Å; D35-T37 PolarHBondContact OD1-N 2.92Å; D35-T37 PolarHBondContact OD1-OG1 3.41Å; T37-K42 PolarHBondContact OG1-NZ 2.91Å
38	T	95.1	Very high	96.9	Very high	66 Å²	66	91.2 Å²	91.2	41%	0.405	47%	0.469	S	S	.	.			trans	-128.2	156.1	180	55.4	0	0	0	0	111.1	D40	T38-D40 VanDerWaalsContact C-N 3.33Å; T38-D40 PolarHBondContact OG1-O 3.31Å
39	R	95.5	Very high	96.9	Very high	254 Å²	254	92.7 Å²	92.7	96%	0.958	48%	0.48	S	S	*	.	S	Bend	trans	-81.6	-17.5	172.2	-61.8	-179.7	82.3	173	5.3	112.5
40	D	95.9	Very high	96.9	Very high	128 Å²	128	93.7 Å²	93.7	68%	0.684	49%	0.486	S	S	*	.	S	Bend	trans	-84.8	142.4	177.9	-56.4	-55.2	0	0	0	110.8	T38 K42	T38-D40 VanDerWaalsContact C-N 3.33Å; T38-D40 PolarHBondContact OG1-O 3.31Å; D40-K42 PolarHBondContact O-N 3.38Å
41	V	95.4	Very high	96.9	Very high	99 Å²	99	90.6 Å²	90.6	60%	0.6	48%	0.478	S	S	*	.	P	Polyproline II helix	trans	-73.4	123.1	174.3	-178.1	0	0	0	0	108.8	E45	V41-E45 HydrophobicContact CG1-CB 3.9Å
42	K	96.1	Very high	96.9	Very high	68 Å²	68	85.7 Å²	85.7	30%	0.296	45%	0.454	S	S	.	.	P	Polyproline II helix	trans	-70.2	151	-179.6	-66	-171.2	-178.4	-169.7	0	110.6	D35 T37 D40 E44 E45 S46	D35-K42 HydrophobicContact CB-CD 4.2Å; D35-K42 IonicContact OD1-NZ 3.6Å; D35-K42 WeakPolarHBondContact OD2-CE 3.42Å; D35-K42 IonicContact OD2-NZ 2.6Å; D35-K42 PolarHBondContact OD2-NZ 2.91Å; T37-K42 PolarHBondContact OG1-NZ 2.91Å; D40-K42 PolarHBondContact O-N 3.38Å; K42-E44 PolarHBondContact O-N 2.92Å; K42-E44 VanDerWaalsContact O-N 3.16Å; K42-E45 HydrophobicContact CB-CG 4.16Å; K42-E45 PolarHBondContact N-OE2 3.44Å; K42-E45 VanDerWaalsContact N-OE2 3.09Å; K42-E45 WeakPolarHBondContact O-CB 3.41Å; K42-E45 PolarHBondContact O-N 3.28Å; K42-S46 PolarHBondContact O-N 3.45Å
43	P	97	Very high	96.9	Very high	111 Å²	111	88.9 Å²	88.9	72%	0.721	47%	0.47	S	S	*	.	H	α-helix	trans	-58.2	-32.8	-179.2	22.2	-33.7	0	0	0	113	S46 S47	P43-S46 PolarHBondContact O-N 3.24Å; P43-S47 WeakPolarHBondContact O-CB 3.48Å; P43-S47 PolarHBondContact O-N 3.33Å
44	E	96.5	Very high	96.9	Very high	144 Å²	144	92.2 Å²	92.2	67%	0.673	48%	0.483	S	S	*	.	H	α-helix	trans	-64.8	-41.1	174.1	-62.6	-178.4	-173.6	0	0	112.5	K42 C48	K42-E44 PolarHBondContact O-N 2.92Å; K42-E44 VanDerWaalsContact O-N 3.16Å; E44-C48 VanDerWaalsContact O-CB 3.29Å; E44-C48 WeakPolarHBondContact O-CB 3.45Å; E44-C48 PolarHBondContact O-N 3.11Å
45	E	97.7	Very high	97.1	Very high	7 Å²	7	92.6 Å²	92.6	3%	0.033	49%	0.485	C	S	.	.	H	α-helix	trans	-70.1	-38.9	178.1	-58.9	180	132.3	0	0	110.8	C32 V33 K34 D35 V41 K42 C48 S49	C32-E45 WeakPolarHBondContact O-CG 3.33Å; V33-E45 WeakPolarHBondContact CA-OE1 3.49Å; K34-E45 PolarHBondContact N-OE1 2.99Å; D35-E45 PolarHBondContact N-OE1 3.4Å; V41-E45 HydrophobicContact CG1-CB 3.9Å; K42-E45 HydrophobicContact CB-CG 4.16Å; K42-E45 PolarHBondContact N-OE2 3.44Å; K42-E45 VanDerWaalsContact N-OE2 3.09Å; K42-E45 WeakPolarHBondContact O-CB 3.41Å; K42-E45 PolarHBondContact O-N 3.28Å; E45-C48 PolarHBondContact O-N 2.79Å; E45-S49 WeakPolarHBondContact O-CB 3.45Å; E45-S49 PolarHBondContact O-N 3.36Å; E45-S49 PolarHBondContact O-OG 3.37Å
46	S	97.2	Very high	97.2	Very high	47 Å²	47	92.5 Å²	92.5	33%	0.329	48%	0.481	S	S	.	.	H	α-helix	trans	-59.8	-52.7	173.2	-165.8	0	0	0	0	110.9	K42 P43 C48 S49 E50	K42-S46 PolarHBondContact O-N 3.45Å; P43-S46 PolarHBondContact O-N 3.24Å; S46-C48 VanDerWaalsContact C-N 3.31Å; S46-C48 PolarHBondContact O-N 3.14Å; S46-S49 PolarHBondContact O-N 2.99Å; S46-S49 VanDerWaalsContact O-N 3.14Å; S46-S49 PolarHBondContact O-OG 3.42Å; S46-E50 PolarHBondContact O-N 3.42Å
47	S	98.2	Very high	97.2	Very high	68 Å²	68	89 Å²	89	48%	0.476	47%	0.469	S	S	.	.	H	α-helix	trans	-61.9	-38.3	178.8	-174.5	0	0	0	0	112.7	P43 S51	P43-S47 WeakPolarHBondContact O-CB 3.48Å; P43-S47 PolarHBondContact O-N 3.33Å; S47-S51 WeakPolarHBondContact O-CB 3.42Å; S47-S51 PolarHBondContact O-N 2.86Å; S47-S51 VanDerWaalsContact O-N 3.09Å; S47-S51 PolarHBondContact O-OG 3.3Å
48	C	98.4	Very high	97.3	Very high	52 Å²	52	90.2 Å²	90.2	35%	0.351	47%	0.465	S	S	.	.	H	α-helix	trans	-61.3	-48.1	172.8	-179.2	0	0	0	0	111.4	C32 E44 E45 S46 E50 S51 C52	C32-C48 VanDerWaalsContact CA-SG 3.52Å; C32-C48 HydrophobicContact CB-CB 3.6Å; C32-C48 WeakPolarHBondContact CB-SG 3.46Å; C32-C48 WeakPolarHBondContact SG-CB 3.49Å; C32-C48 PolarHBondContact SG-O 3.45Å; C32-C48 VanDerWaalsContact SG-O 3.37Å; C32-C48 CovalentContact SG-SG 2.05Å; C32-C48 PolarHBondContact SG-SG 3.2Å; E44-C48 VanDerWaalsContact O-CB 3.29Å; E44-C48 WeakPolarHBondContact O-CB 3.45Å; E44-C48 PolarHBondContact O-N 3.11Å; E45-C48 PolarHBondContact O-N 2.79Å; S46-C48 VanDerWaalsContact C-N 3.31Å; S46-C48 PolarHBondContact O-N 3.14Å; C48-E50 PolarHBondContact O-N 3.4Å; C48-S51 CarbonylContact O-C 3.6Å; C48-S51 WeakPolarHBondContact O-CB 3.4Å; C48-S51 PolarHBondContact O-N 2.92Å; C48-C52 WeakPolarHBondContact O-CB 3.29Å; C48-C52 PolarHBondContact O-N 3.47Å
49	S	97.9	Very high	97.4	Very high	43 Å²	43	91.4 Å²	91.4	30%	0.301	47%	0.467	S	S	.	.	H	α-helix	trans	-64.1	-39.5	-177.1	70.4	0	0	0	0	112.7	C32 E45 S46 C52 L53	C32-S49 PolarHBondContact SG-N 2.88Å; C32-S49 VanDerWaalsContact SG-N 3.42Å; E45-S49 WeakPolarHBondContact O-CB 3.45Å; E45-S49 PolarHBondContact O-N 3.36Å; E45-S49 PolarHBondContact O-OG 3.37Å; S46-S49 PolarHBondContact O-N 2.99Å; S46-S49 VanDerWaalsContact O-N 3.14Å; S46-S49 PolarHBondContact O-OG 3.42Å; S49-C52 WeakPolarHBondContact O-CB 3.32Å; S49-C52 PolarHBondContact O-N 3.47Å; S49-L53 PolarHBondContact O-N 2.81Å
50	E	98	Very high	97.5	Very high	121 Å²	121	82.1 Å²	82.1	57%	0.565	44%	0.439	S	S	*	.	H	α-helix	trans	-62.8	-46.2	173.2	-72.3	174.8	-161.2	0	0	111.4	S46 C48 C52 L53 Q54	S46-E50 PolarHBondContact O-N 3.42Å; C48-E50 PolarHBondContact O-N 3.4Å; E50-C52 VanDerWaalsContact C-N 3.32Å; E50-C52 PolarHBondContact O-N 3.5Å; E50-L53 PolarHBondContact O-N 3.18Å; E50-Q54 WeakPolarHBondContact O-CG 3.46Å; E50-Q54 PolarHBondContact O-N 3.48Å
51	S	98.4	Very high	97.5	Very high	72 Å²	72	82 Å²	82	50%	0.503	43%	0.434	S	S	.	.	H	α-helix	trans	-63.4	-39.1	177	-61.7	0	0	0	0	111.9	S47 C48 Q54 K55	S47-S51 WeakPolarHBondContact O-CB 3.42Å; S47-S51 PolarHBondContact O-N 2.86Å; S47-S51 VanDerWaalsContact O-N 3.09Å; S47-S51 PolarHBondContact O-OG 3.3Å; C48-S51 CarbonylContact O-C 3.6Å; C48-S51 WeakPolarHBondContact O-CB 3.4Å; C48-S51 PolarHBondContact O-N 2.92Å; S51-Q54 PolarHBondContact O-N 3.21Å; S51-K55 WeakPolarHBondContact O-CB 3.47Å; S51-K55 PolarHBondContact O-N 2.98Å
52	C	98.5	Very high	97.6	Very high	23 Å²	23	85.4 Å²	85.4	16%	0.155	44%	0.436	C	S	.	.	H	α-helix	trans	-60.5	-50.7	175.7	173.6	0	0	0	0	111.1	C28 C48 S49 E50 Q54 K55 Y56	C28-C52 WeakPolarHBondContact CA-SG 3.31Å; C28-C52 HydrophobicContact CB-CB 3.81Å; C28-C52 WeakPolarHBondContact CB-SG 3.34Å; C28-C52 WeakPolarHBondContact SG-CB 3.37Å; C28-C52 CovalentContact SG-SG 2.05Å; C28-C52 PolarHBondContact SG-SG 2.97Å; C48-C52 WeakPolarHBondContact O-CB 3.29Å; C48-C52 PolarHBondContact O-N 3.47Å; S49-C52 WeakPolarHBondContact O-CB 3.32Å; S49-C52 PolarHBondContact O-N 3.47Å; E50-C52 VanDerWaalsContact C-N 3.32Å; E50-C52 PolarHBondContact O-N 3.5Å; C52-Q54 PolarHBondContact O-N 2.99Å; C52-K55 PolarHBondContact O-N 3.38Å; C52-Y56 WeakPolarHBondContact O-CB 3.46Å; C52-Y56 PolarHBondContact O-N 3Å
53	L	97.9	Very high	97.7	Very high	71 Å²	71	87 Å²	87	37%	0.372	45%	0.447	S	S	.	.	H	α-helix	trans	-59.3	-48.4	177.6	177.2	61	0	0	0	111.4	V24 S49 E50 K55 Y56 L57	V24-L53 HydrophobicContact CG1-CD1 4.18Å; V24-L53 HydrophobicContact CG2-CD1 3.83Å; S49-L53 PolarHBondContact O-N 2.81Å; E50-L53 PolarHBondContact O-N 3.18Å; L53-K55 VanDerWaalsContact C-N 3.32Å; L53-K55 PolarHBondContact O-N 3.41Å; L53-Y56 PolarHBondContact O-N 3.07Å; L53-L57 HydrophobicContact CD1-CD1 4.09Å; L53-L57 HydrophobicContact CD1-CG 4.14Å; L53-L57 HydrophobicContact CG-CD1 4.17Å; L53-L57 WeakPolarHBondContact O-CG 3.35Å; L53-L57 PolarHBondContact O-N 3.33Å
54	Q	98	Very high	97.7	Very high	101 Å²	101	84.3 Å²	84.3	47%	0.472	43%	0.431	S	S	.	.	H	α-helix	trans	-59.9	-42.7	178.2	-72.2	-62.5	-41.8	0	0	112.1	E50 S51 C52 K58	E50-Q54 WeakPolarHBondContact O-CG 3.46Å; E50-Q54 PolarHBondContact O-N 3.48Å; S51-Q54 PolarHBondContact O-N 3.21Å; C52-Q54 PolarHBondContact O-N 2.99Å; Q54-K58 WeakPolarHBondContact O-CB 3.39Å; Q54-K58 VanDerWaalsContact O-CG 3.29Å; Q54-K58 WeakPolarHBondContact O-CG 3.2Å; Q54-K58 PolarHBondContact O-N 2.97Å; Q54-K58 VanDerWaalsContact O-N 3.08Å
55	K	98.3	Very high	97.7	Very high	161 Å²	161	82 Å²	82	70%	0.7	42%	0.421	S	S	*	.	H	α-helix	trans	-65.2	-44.1	177.1	-173.7	179.1	179	-174.7	0	111.3	S51 C52 L53 K58 M59	S51-K55 WeakPolarHBondContact O-CB 3.47Å; S51-K55 PolarHBondContact O-N 2.98Å; C52-K55 PolarHBondContact O-N 3.38Å; L53-K55 VanDerWaalsContact C-N 3.32Å; L53-K55 PolarHBondContact O-N 3.41Å; K55-K58 PolarHBondContact O-N 2.95Å; K55-M59 WeakPolarHBondContact O-CB 3.38Å; K55-M59 PolarHBondContact O-N 3.42Å
56	Y	98.1	Very high	97.7	Very high	48 Å²	48	88.3 Å²	88.3	19%	0.188	45%	0.445	C	S	.	.	H	α-helix	trans	-60.7	-45.8	178.6	-177.8	-90.9	0	0	0	111.9	T20 V24 C52 L53 M59 T60	T20-Y56 HydrophobicContact CG2-CE1 4.14Å; V24-Y56 HydrophobicContact CB-CD1 3.97Å; V24-Y56 HydrophobicContact CB-CE1 4Å; V24-Y56 HydrophobicContact CB-CG 4.33Å; V24-Y56 HydrophobicContact CG2-CD1 3.55Å; V24-Y56 HydrophobicContact CG2-CD2 4.17Å; V24-Y56 HydrophobicContact CG2-CE1 4.11Å; V24-Y56 HydrophobicContact CG2-CG 3.59Å; C52-Y56 WeakPolarHBondContact O-CB 3.46Å; C52-Y56 PolarHBondContact O-N 3Å; L53-Y56 PolarHBondContact O-N 3.07Å; Y56-M59 HydrophobicContact CD2-CE 3.89Å; Y56-M59 HydrophobicContact CE2-CE 4.08Å; Y56-M59 PolarHBondContact O-N 3.01Å; Y56-T60 WeakPolarHBondContact O-CB 3.41Å; Y56-T60 PolarHBondContact O-N 2.99Å; Y56-T60 PolarHBondContact O-OG1 3.36Å
57	L	96.9	Very high	97.7	Very high	75 Å²	75	91.9 Å²	91.9	39%	0.393	45%	0.454	S	S	.	.	H	α-helix	trans	-64.3	-47.2	178.3	-67.4	175.4	0	0	0	111.7	L53 M59 T60 Q61	L53-L57 HydrophobicContact CD1-CD1 4.09Å; L53-L57 HydrophobicContact CD1-CG 4.14Å; L53-L57 HydrophobicContact CG-CD1 4.17Å; L53-L57 WeakPolarHBondContact O-CG 3.35Å; L53-L57 PolarHBondContact O-N 3.33Å; L57-M59 VanDerWaalsContact C-N 3.33Å; L57-M59 PolarHBondContact O-N 2.92Å; L57-T60 PolarHBondContact O-N 3.3Å; L57-Q61 WeakPolarHBondContact O-CG 3.46Å; L57-Q61 PolarHBondContact O-N 2.8Å
58	K	98.2	Very high	97.6	Very high	135 Å²	135	93.9 Å²	93.9	59%	0.587	46%	0.456	S	S	*	.	H	α-helix	trans	-61.7	-41.2	176.8	-72.8	174.7	-177.2	177.4	0	112	Q54 K55 R62	Q54-K58 WeakPolarHBondContact O-CB 3.39Å; Q54-K58 VanDerWaalsContact O-CG 3.29Å; Q54-K58 WeakPolarHBondContact O-CG 3.2Å; Q54-K58 PolarHBondContact O-N 2.97Å; Q54-K58 VanDerWaalsContact O-N 3.08Å; K55-K58 PolarHBondContact O-N 2.95Å; K58-R62 WeakPolarHBondContact O-CB 3.39Å; K58-R62 PolarHBondContact O-N 2.88Å
59	M	97.7	Very high	97.5	Very high	92 Å²	92	95.1 Å²	95.1	45%	0.453	46%	0.457	S	S	.	.	H	α-helix	trans	-61.1	-50.1	175.2	178.1	-165.9	73.3	0	0	110.8	K55 Y56 L57 Q61 R62 I63	K55-M59 WeakPolarHBondContact O-CB 3.38Å; K55-M59 PolarHBondContact O-N 3.42Å; Y56-M59 HydrophobicContact CD2-CE 3.89Å; Y56-M59 HydrophobicContact CE2-CE 4.08Å; Y56-M59 PolarHBondContact O-N 3.01Å; L57-M59 VanDerWaalsContact C-N 3.33Å; L57-M59 PolarHBondContact O-N 2.92Å; M59-Q61 VanDerWaalsContact C-N 3.35Å; M59-Q61 PolarHBondContact O-N 3.49Å; M59-R62 PolarHBondContact O-N 2.7Å; M59-R62 VanDerWaalsContact O-N 3.14Å; M59-I63 HydrophobicContact CE-CD1 4.38Å; M59-I63 HydrophobicContact CG-CD1 3.74Å; M59-I63 HydrophobicContact CG-CG1 4.4Å; M59-I63 WeakPolarHBondContact O-CG1 3.02Å; M59-I63 PolarHBondContact O-N 3.37Å; M59-I63 HydrophobicContact SD-CD1 4.32Å
60	T	96.4	Very high	97.4	Very high	59 Å²	59	99.8 Å²	99.8	36%	0.362	47%	0.469	S	S	.	.	H	α-helix	trans	-59.9	-44.3	-179.2	-57.6	0	0	0	0	111.4	Y56 L57 R62 I63 S64	Y56-T60 WeakPolarHBondContact O-CB 3.41Å; Y56-T60 PolarHBondContact O-N 2.99Å; Y56-T60 PolarHBondContact O-OG1 3.36Å; L57-T60 PolarHBondContact O-N 3.3Å; T60-R62 PolarHBondContact O-N 2.91Å; T60-I63 PolarHBondContact O-N 3.44Å; T60-S64 WeakPolarHBondContact O-CB 3.42Å; T60-S64 PolarHBondContact O-N 3.43Å
61	Q	96.9	Very high	97.2	Very high	126 Å²	126	97.3 Å²	97.3	59%	0.589	46%	0.457	S	S	*	.	H	α-helix	trans	-60.5	-44.6	174.5	-71.8	175	26.3	0	0	111.9	L57 M59 S64 M65	L57-Q61 WeakPolarHBondContact O-CG 3.46Å; L57-Q61 PolarHBondContact O-N 2.8Å; M59-Q61 VanDerWaalsContact C-N 3.35Å; M59-Q61 PolarHBondContact O-N 3.49Å; Q61-S64 PolarHBondContact O-N 3.08Å; Q61-M65 WeakPolarHBondContact O-CG 3.41Å; Q61-M65 PolarHBondContact O-N 2.82Å
62	R	97.9	Very high	97	Very high	169 Å²	169	98.5 Å²	98.5	64%	0.638	46%	0.457	S	S	*	.	H	α-helix	trans	-64.2	-42.1	178.7	-172.4	174.2	-178.4	172.7	1.2	112.3	K58 M59 T60 M65 R66	K58-R62 WeakPolarHBondContact O-CB 3.39Å; K58-R62 PolarHBondContact O-N 2.88Å; M59-R62 PolarHBondContact O-N 2.7Å; M59-R62 VanDerWaalsContact O-N 3.14Å; T60-R62 PolarHBondContact O-N 2.91Å; R62-M65 HydrophobicContact CB-CE 4.39Å; R62-M65 PolarHBondContact O-N 2.97Å; R62-R66 WeakPolarHBondContact O-CG 3.19Å; R62-R66 PolarHBondContact O-N 3.29Å
63	I	97.6	Very high	96.7	Very high	102 Å²	102	103 Å²	103	52%	0.523	48%	0.476	S	S	.	.	H	α-helix	trans	-61.3	-47.3	175.1	-69	168.5	0	0	0	109.7	M59 T60 M65 R66 F67	M59-I63 HydrophobicContact CE-CD1 4.38Å; M59-I63 HydrophobicContact CG-CD1 3.74Å; M59-I63 HydrophobicContact CG-CG1 4.4Å; M59-I63 WeakPolarHBondContact O-CG1 3.02Å; M59-I63 PolarHBondContact O-N 3.37Å; M59-I63 HydrophobicContact SD-CD1 4.32Å; T60-I63 PolarHBondContact O-N 3.44Å; I63-M65 VanDerWaalsContact C-N 3.33Å; I63-M65 PolarHBondContact O-N 3.41Å; I63-R66 PolarHBondContact O-N 2.85Å; I63-F67 WeakPolarHBondContact O-CB 3.06Å; I63-F67 PolarHBondContact O-N 3.44Å
64	S	96.4	Very high	96.5	Very high	55 Å²	55	103.9 Å²	103.9	39%	0.385	48%	0.478	S	S	.	.	H	α-helix	trans	-57.3	-44.1	178.3	-172.9	0	0	0	0	112.3	T60 Q61 F67 Q68	T60-S64 WeakPolarHBondContact O-CB 3.42Å; T60-S64 PolarHBondContact O-N 3.43Å; Q61-S64 PolarHBondContact O-N 3.08Å; S64-F67 PolarHBondContact O-N 3.01Å; S64-Q68 WeakPolarHBondContact O-CB 3.46Å; S64-Q68 VanDerWaalsContact O-CG 3.29Å; S64-Q68 WeakPolarHBondContact O-CG 3.06Å; S64-Q68 PolarHBondContact O-N 2.91Å
65	M	97.3	Very high	96.1	Very high	96 Å²	96	103.6 Å²	103.6	47%	0.473	48%	0.479	S	S	.	.	H	α-helix	trans	-59.5	-48.4	177	-73.7	-173.2	-71.6	0	0	111.8	Q61 R62 I63 F67 Q68 E69	Q61-M65 WeakPolarHBondContact O-CG 3.41Å; Q61-M65 PolarHBondContact O-N 2.82Å; R62-M65 HydrophobicContact CB-CE 4.39Å; R62-M65 PolarHBondContact O-N 2.97Å; I63-M65 VanDerWaalsContact C-N 3.33Å; I63-M65 PolarHBondContact O-N 3.41Å; M65-F67 VanDerWaalsContact C-N 3.33Å; M65-F67 PolarHBondContact O-N 3Å; M65-Q68 PolarHBondContact O-N 3.44Å; M65-E69 WeakPolarHBondContact O-CG 3.35Å; M65-E69 PolarHBondContact O-N 3.02Å
66	R	98	Very high	95.7	Very high	139 Å²	139	101.4 Å²	101.4	53%	0.525	47%	0.472	S	S	.	.	H	α-helix	trans	-67.6	-35.8	-179.1	-60.2	-62.5	155.5	-170.5	-3.4	112.5	R62 I63 E69 Y70	R62-R66 WeakPolarHBondContact O-CG 3.19Å; R62-R66 PolarHBondContact O-N 3.29Å; I63-R66 PolarHBondContact O-N 2.85Å; R66-E69 VanDerWaalsContact CD-OE2 3.32Å; R66-E69 WeakPolarHBondContact CD-OE2 3.08Å; R66-E69 IonicContact CZ-OE1 3.4Å; R66-E69 IonicContact CZ-OE2 3.53Å; R66-E69 IonicContact NE-OE1 3.94Å; R66-E69 IonicContact NE-OE2 3.79Å; R66-E69 VanDerWaalsContact NH1-CD 3.25Å; R66-E69 IonicContact NH1-OE1 2.98Å; R66-E69 PolarHBondContact NH1-OE1 2.99Å; R66-E69 IonicContact NH1-OE2 2.7Å; R66-E69 PolarHBondContact NH1-OE2 3.38Å; R66-E69 IonicContact NH2-OE1 3.94Å; R66-E69 PolarHBondContact O-N 2.05Å; R66-Y70 PolarHBondContact O-N 3.35Å
67	F	96.9	Very high	95.3	Very high	121 Å²	121	101.7 Å²	101.7	53%	0.531	48%	0.484	S	S	.	.	H	α-helix	trans	-64.3	-43.7	174.9	-175.1	-107.9	0	0	0	111.7	I63 S64 M65 Y70 H71	I63-F67 WeakPolarHBondContact O-CB 3.06Å; I63-F67 PolarHBondContact O-N 3.44Å; S64-F67 PolarHBondContact O-N 3.01Å; M65-F67 VanDerWaalsContact C-N 3.33Å; M65-F67 PolarHBondContact O-N 3Å; F67-Y70 PolarHBondContact O-N 2.91Å; F67-H71 AromaticContact CD1-CD2 3.64Å; F67-H71 AromaticContact CE1-CD2 3.31Å; F67-H71 WeakPolarHBondContact CE1-CD2 3.29Å; F67-H71 AromaticContact CE1-NE2 3.28Å; F67-H71 VanDerWaalsContact CE1-NE2 3.28Å; F67-H71 WeakPolarHBondContact CE1-NE2 3.26Å; F67-H71 AromaticContact CE2-CD2 3.73Å; F67-H71 AromaticContact CE2-NE2 3.35Å; F67-H71 WeakPolarHBondContact CE2-NE2 3.33Å; F67-H71 AromaticContact CZ-CD2 3.38Å; F67-H71 WeakPolarHBondContact CZ-CD2 3.44Å; F67-H71 AromaticContact CZ-NE2 2.88Å; F67-H71 WeakPolarHBondContact CZ-NE2 3.3Å; F67-H71 PolarHBondContact O-CD2 3.37Å; F67-H71 PolarHBondContact O-N 3.34Å
68	Q	96.3	Very high	94.9	Very high	110 Å²	110	102.9 Å²	102.9	51%	0.514	49%	0.49	S	S	.	.	H	α-helix	trans	-63.8	-44.8	175.3	-73.5	172.9	-2.1	0	0	112.1	S64 M65 Y70 H71 I72	S64-Q68 WeakPolarHBondContact O-CB 3.46Å; S64-Q68 VanDerWaalsContact O-CG 3.29Å; S64-Q68 WeakPolarHBondContact O-CG 3.06Å; S64-Q68 PolarHBondContact O-N 2.91Å; M65-Q68 PolarHBondContact O-N 3.44Å; Q68-Y70 VanDerWaalsContact C-N 3.29Å; Q68-Y70 PolarHBondContact O-N 3.39Å; Q68-H71 PolarHBondContact O-N 2.97Å; Q68-I72 WeakPolarHBondContact O-CG1 3.35Å; Q68-I72 PolarHBondContact O-N 3.26Å
69	E	95.4	Very high	94.4	Very high	78 Å²	78	97.8 Å²	97.8	36%	0.364	47%	0.474	S	S	.	.	H	α-helix	trans	-54.4	-46.4	174.7	-74.1	170.9	-169.8	0	0	111.4	M65 R66 I72 Q73	M65-E69 WeakPolarHBondContact O-CG 3.35Å; M65-E69 PolarHBondContact O-N 3.02Å; R66-E69 VanDerWaalsContact CD-OE2 3.32Å; R66-E69 WeakPolarHBondContact CD-OE2 3.08Å; R66-E69 IonicContact CZ-OE1 3.4Å; R66-E69 IonicContact CZ-OE2 3.53Å; R66-E69 IonicContact NE-OE1 3.94Å; R66-E69 IonicContact NE-OE2 3.79Å; R66-E69 VanDerWaalsContact NH1-CD 3.25Å; R66-E69 IonicContact NH1-OE1 2.98Å; R66-E69 PolarHBondContact NH1-OE1 2.99Å; R66-E69 IonicContact NH1-OE2 2.7Å; R66-E69 PolarHBondContact NH1-OE2 3.38Å; R66-E69 IonicContact NH2-OE1 3.94Å; R66-E69 PolarHBondContact O-N 2.05Å; E69-I72 PolarHBondContact O-N 3.46Å; E69-Q73 WeakPolarHBondContact O-CG 3.34Å; E69-Q73 PolarHBondContact O-N 2.77Å; E69-Q73 VanDerWaalsContact O-N 3.15Å
70	Y	96.2	Very high	93.9	Very high	141 Å²	141	96 Å²	96	55%	0.553	47%	0.474	S	S	*	.	H	α-helix	trans	-63.8	-43.9	178.2	-179.8	-100.6	0	0	0	112.5	R66 F67 Q68 I72 Q73 Q74	R66-Y70 PolarHBondContact O-N 3.35Å; F67-Y70 PolarHBondContact O-N 2.91Å; Q68-Y70 VanDerWaalsContact C-N 3.29Å; Q68-Y70 PolarHBondContact O-N 3.39Å; Y70-I72 VanDerWaalsContact C-N 3.34Å; Y70-I72 PolarHBondContact O-N 3.46Å; Y70-Q73 PolarHBondContact O-N 2.88Å; Y70-Q74 PolarHBondContact O-N 2.92Å
71	H	94	Very high	93.4	Very high	70 Å²	70	102.1 Å²	102.1	32%	0.324	50%	0.495	S	S	.	.	H	α-helix	trans	-62.6	-39.1	177.2	-91.6	-67.2	0	0	0	113.1	F67 Q68 Q74 N75	F67-H71 AromaticContact CD1-CD2 3.64Å; F67-H71 AromaticContact CE1-CD2 3.31Å; F67-H71 WeakPolarHBondContact CE1-CD2 3.29Å; F67-H71 AromaticContact CE1-NE2 3.28Å; F67-H71 VanDerWaalsContact CE1-NE2 3.28Å; F67-H71 WeakPolarHBondContact CE1-NE2 3.26Å; F67-H71 AromaticContact CE2-CD2 3.73Å; F67-H71 AromaticContact CE2-NE2 3.35Å; F67-H71 WeakPolarHBondContact CE2-NE2 3.33Å; F67-H71 AromaticContact CZ-CD2 3.38Å; F67-H71 WeakPolarHBondContact CZ-CD2 3.44Å; F67-H71 AromaticContact CZ-NE2 2.88Å; F67-H71 WeakPolarHBondContact CZ-NE2 3.3Å; F67-H71 PolarHBondContact O-CD2 3.37Å; F67-H71 PolarHBondContact O-N 3.34Å; Q68-H71 PolarHBondContact O-N 2.97Å; H71-Q74 PolarHBondContact O-N 3.25Å; H71-N75 WeakPolarHBondContact O-CB 3.21Å; H71-N75 VanDerWaalsContact O-CG 3.31Å; H71-N75 PolarHBondContact O-N 2.05Å
72	I	94.4	Very high	92.9	Very high	96 Å²	96	99.2 Å²	99.2	49%	0.492	49%	0.492	S	S	.	.	H	α-helix	trans	-63.1	-48.6	176.5	-68.6	165.3	0	0	0	110.2	Q68 E69 Y70 Q74 N75 E76	Q68-I72 WeakPolarHBondContact O-CG1 3.35Å; Q68-I72 PolarHBondContact O-N 3.26Å; E69-I72 PolarHBondContact O-N 3.46Å; Y70-I72 VanDerWaalsContact C-N 3.34Å; Y70-I72 PolarHBondContact O-N 3.46Å; I72-Q74 VanDerWaalsContact C-N 3.29Å; I72-Q74 PolarHBondContact O-N 2.55Å; I72-N75 PolarHBondContact O-N 3.09Å; I72-N75 VanDerWaalsContact O-N 3.11Å; I72-E76 HydrophobicContact CG2-CG 4.33Å; I72-E76 WeakPolarHBondContact O-CG 3.5Å; I72-E76 PolarHBondContact O-N 3.49Å
73	Q	92.6	Very high	91.8	Very high	119 Å²	119	94 Å²	94	56%	0.556	49%	0.491	S	S	*	.	H	α-helix	trans	-58.8	-41	178.6	-70.7	173.4	30.3	0	0	112.3	E69 Y70 E76 A77	E69-Q73 WeakPolarHBondContact O-CG 3.34Å; E69-Q73 PolarHBondContact O-N 2.77Å; E69-Q73 VanDerWaalsContact O-N 3.15Å; Y70-Q73 PolarHBondContact O-N 2.88Å; Q73-E76 PolarHBondContact O-N 3.48Å; Q73-A77 WeakPolarHBondContact O-CB 3.49Å; Q73-A77 PolarHBondContact O-N 3.01Å
74	Q	92.6	Very high	90.5	Very high	88 Å²	88	95.9 Å²	95.9	41%	0.411	50%	0.502	S	S	.	.	H	α-helix	trans	-63.7	-44.4	176.1	-174.1	179.3	63.9	0	0	111.4	Y70 H71 I72 A77 L78	Y70-Q74 PolarHBondContact O-N 2.92Å; H71-Q74 PolarHBondContact O-N 3.25Å; I72-Q74 VanDerWaalsContact C-N 3.29Å; I72-Q74 PolarHBondContact O-N 2.55Å; Q74-A77 PolarHBondContact O-N 3.5Å; Q74-L78 HydrophobicContact CG-CD1 4.15Å; Q74-L78 VanDerWaalsContact O-CG 3.24Å; Q74-L78 WeakPolarHBondContact O-CG 3.39Å; Q74-L78 PolarHBondContact O-N 2.6Å
75	N	90.5	Very high	88.9	Confident	95 Å²	95	98.5 Å²	98.5	51%	0.508	51%	0.511	S	S	.	.	H	α-helix	trans	-65.1	-39.8	178.2	-74.6	-8.3	0	0	0	112.4	H71 I72 L78 A79	H71-N75 WeakPolarHBondContact O-CB 3.21Å; H71-N75 VanDerWaalsContact O-CG 3.31Å; H71-N75 PolarHBondContact O-N 2.05Å; I72-N75 PolarHBondContact O-N 3.09Å; I72-N75 VanDerWaalsContact O-N 3.11Å; N75-L78 PolarHBondContact O-N 2.97Å; N75-A79 WeakPolarHBondContact O-CB 3.36Å; N75-A79 PolarHBondContact O-N 2.86Å
76	E	89.8	Confident	86.8	Confident	116 Å²	116	97 Å²	97	54%	0.542	52%	0.521	S	S	.	.	H	α-helix	trans	-62.1	-44.1	174.3	-73.2	177	169.5	0	0	111.5	I72 Q73 L78 A79 A80	I72-E76 HydrophobicContact CG2-CG 4.33Å; I72-E76 WeakPolarHBondContact O-CG 3.5Å; I72-E76 PolarHBondContact O-N 3.49Å; Q73-E76 PolarHBondContact O-N 3.48Å; E76-L78 VanDerWaalsContact C-N 3.31Å; E76-L78 PolarHBondContact O-N 2.74Å; E76-A79 PolarHBondContact O-N 3.42Å; E76-A80 WeakPolarHBondContact O-CB 3.29Å; E76-A80 PolarHBondContact O-N 2.96Å
77	A	88.4	Confident	84.4	Confident	54 Å²	54	99 Å²	99	45%	0.446	54%	0.536	S	S	.	.	H	α-helix	trans	-63.1	-37.7	175.9	0	0	0	0	0	112.2	Q73 Q74 K81	Q73-A77 WeakPolarHBondContact O-CB 3.49Å; Q73-A77 PolarHBondContact O-N 3.01Å; Q74-A77 PolarHBondContact O-N 3.5Å; A77-K81 WeakPolarHBondContact O-CG 3.33Å; A77-K81 PolarHBondContact O-N 3.03Å; A77-K81 VanDerWaalsContact O-N 3.1Å
78	L	88.8	Confident	82.5	Confident	99 Å²	99	98.9 Å²	98.9	52%	0.518	55%	0.547	S	S	.	.	H	α-helix	trans	-67.7	-42.6	174.3	-70.7	167.9	0	0	0	111.6	Q74 N75 E76 A80 K81 A82	Q74-L78 HydrophobicContact CG-CD1 4.15Å; Q74-L78 VanDerWaalsContact O-CG 3.24Å; Q74-L78 WeakPolarHBondContact O-CG 3.39Å; Q74-L78 PolarHBondContact O-N 2.6Å; N75-L78 PolarHBondContact O-N 2.97Å; E76-L78 VanDerWaalsContact C-N 3.31Å; E76-L78 PolarHBondContact O-N 2.74Å; L78-A80 VanDerWaalsContact C-N 3.35Å; L78-A80 PolarHBondContact O-N 3.33Å; L78-K81 PolarHBondContact O-N 3.4Å; L78-A82 WeakPolarHBondContact O-CB 3.47Å; L78-A82 PolarHBondContact O-N 3.14Å
79	A	88.3	Confident	80.2	Confident	29 Å²	29	108.9 Å²	108.9	24%	0.24	58%	0.58	C	S	.	*	H	α-helix	trans	-64.7	-37.8	176.7	0	0	0	0	0	112.4	N75 E76 A82 G83 L84 L85	N75-A79 WeakPolarHBondContact O-CB 3.36Å; N75-A79 PolarHBondContact O-N 2.86Å; E76-A79 PolarHBondContact O-N 3.42Å; A79-A82 PolarHBondContact O-N 3.45Å; A79-G83 PolarHBondContact O-N 2.89Å; A79-L84 PolarHBondContact O-N 3.37Å; A79-L84 VanDerWaalsContact O-N 3.12Å; A79-L85 HydrophobicContact CB-CG 4.42Å
80	A	87.4	Confident	79.4	Confident	55 Å²	55	110.4 Å²	110.4	46%	0.455	59%	0.591	S	S	.	*	H	α-helix	trans	-61.3	-48	172.5	0	0	0	0	0	111.3	E76 L78 A82 G83 L85	E76-A80 WeakPolarHBondContact O-CB 3.29Å; E76-A80 PolarHBondContact O-N 2.96Å; L78-A80 VanDerWaalsContact C-N 3.35Å; L78-A80 PolarHBondContact O-N 3.33Å; A80-A82 VanDerWaalsContact C-N 3.28Å; A80-A82 PolarHBondContact O-N 2.94Å; A80-G83 PolarHBondContact O-N 3.09Å; A80-G83 VanDerWaalsContact O-N 3.13Å; A80-L85 HydrophobicContact CB-CD1 3.7Å
81	K	85	Confident	78.6	Confident	187 Å²	187	108.8 Å²	108.8	81%	0.813	59%	0.593	S	S	*	*	H	α-helix	trans	-64.4	-31.8	177	-76.4	-177	177.6	-175.7	0	113.1	A77 L78 G83	A77-K81 WeakPolarHBondContact O-CG 3.33Å; A77-K81 PolarHBondContact O-N 3.03Å; A77-K81 VanDerWaalsContact O-N 3.1Å; L78-K81 PolarHBondContact O-N 3.4Å; K81-G83 PolarHBondContact O-N 3.14Å
82	A	86.5	Confident	77.7	Confident	64 Å²	64	110.9 Å²	110.9	53%	0.529	61%	0.608	S	S	.	*	T	Hydrogen-bonded Turn	trans	-78.1	-1.7	176.6	0	0	0	0	0	113.6	L78 A79 A80 L84	L78-A82 WeakPolarHBondContact O-CB 3.47Å; L78-A82 PolarHBondContact O-N 3.14Å; A79-A82 PolarHBondContact O-N 3.45Å; A80-A82 VanDerWaalsContact C-N 3.28Å; A80-A82 PolarHBondContact O-N 2.94Å; A82-L84 HydrophobicContact CB-CD1 3.91Å; A82-L84 HydrophobicContact CB-CG 4.06Å; A82-L84 PolarHBondContact O-N 3.21Å
83	G	75.6	Confident	76.7	Confident	60 Å²	60	111.8 Å²	111.8	62%	0.619	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	69	15.6	-179.1	0	0	0	0	0	114.3	A79 A80 K81	A79-G83 PolarHBondContact O-N 2.89Å; A80-G83 PolarHBondContact O-N 3.09Å; A80-G83 VanDerWaalsContact O-N 3.13Å; K81-G83 PolarHBondContact O-N 3.14Å
84	L	70.4	Confident	75.7	Confident	141 Å²	141	111.4 Å²	111.4	74%	0.738	62%	0.618	S	S	*	*			trans	-83.7	-18.5	-179	-66.8	168.4	0	0	0	112.5	A79 A82 G86	A79-L84 PolarHBondContact O-N 3.37Å; A79-L84 VanDerWaalsContact O-N 3.12Å; A82-L84 HydrophobicContact CB-CD1 3.91Å; A82-L84 HydrophobicContact CB-CG 4.06Å; A82-L84 PolarHBondContact O-N 3.21Å; L84-G86 PolarHBondContact O-N 3.49Å; L84-G86 VanDerWaalsContact O-N 3.14Å
85	L	62.1	Low	74.6	Confident	110 Å²	110	112.9 Å²	112.9	58%	0.576	63%	0.632	S	S	*	*	S	Bend	trans	-78.8	91.7	166	-67.4	176.4	0	0	0	108	A79 A80 Q87	A79-L85 HydrophobicContact CB-CG 4.42Å; A80-L85 HydrophobicContact CB-CD1 3.7Å; L85-Q87 PolarHBondContact O-N 2.99Å
86	G	54.2	Low	73.5	Confident	66 Å²	66	114.2 Å²	114.2	68%	0.68	64%	0.641	S	S	*	*	P	Polyproline II helix	trans	-51.6	127.5	178.5	0	0	0	0	0	111.5	L84	L84-G86 PolarHBondContact O-N 3.49Å; L84-G86 VanDerWaalsContact O-N 3.14Å
87	Q	47.3	Very low	72.2	Confident	181 Å²	181	114.1 Å²	114.1	85%	0.846	65%	0.648	S	S	*	*	P	Polyproline II helix	trans	-47.4	125.6	171.6	-169.1	160.5	47.6	0	0	110	L85 R89	L85-Q87 PolarHBondContact O-N 2.99Å; Q87-R89 PolarHBondContact O-N 3.16Å
88	P	57.3	Low	70.8	Confident	118 Å²	118	119.1 Å²	119.1	77%	0.766	67%	0.665	S	S	*	*	P	Polyproline II helix	trans	-63.5	122.5	168.3	26.3	-29	0	0	0	106.7
89	R	47.3	Very low	69.2	Low	319 Å²	319	120.9 Å²	120.9	100%	1.204	68%	0.679	S	S	*	*			trans	-72	0	157.9	-93.2	-160.9	160.1	118.4	1.1	109.2	Q87	Q87-R89 PolarHBondContact O-N 3.16Å

Retrieved 89 of 89 residues in 249 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).