A0A087YNY6_POEFO Loading...

Eukaryotic translation initiation factor 1

AlphaFold DB (A0A3B4G678), UniProt , Accession A0A087YNY6, Species POEFO (Poecilia formosa, Amazon molly), Gene n/a, Length 113 aa.

						>A0A087YNY6_POEFO|A0A087YNY6
MSAIQNLQTFDPFADATKGDDRLPAGTEDYIHIRIQQRNGRKTLTTVQGISADYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLIEIDLAKEEQLKVHGF
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.7	Very low	60.8	Low	242 Å²	242	151.7 Å²	151.7	100%	1.192	81%	0.814	S	S	*	*				0	92.3	0	-71.2	-75.6	-91.9	0	0	107.1	A3	M1-A3 PolarHBondContact O-N 3.24Å
2	S	54.8	Low	61.5	Low	121 Å²	121	146.3 Å²	146.3	85%	0.846	79%	0.793	S	S	*	*			trans	-75.1	121.1	-176	-45.9	0	0	0	0	109.1	I4	S2-I4 PolarHBondContact O-N 2.94Å
3	A	61.6	Low	61.3	Low	93 Å²	93	147.2 Å²	147.2	77%	0.769	79%	0.785	S	S	*	*			trans	-66.4	125	-179.8	0	0	0	0	0	110.4	M1 Q5	M1-A3 PolarHBondContact O-N 3.24Å; A3-Q5 PolarHBondContact O-N 2.69Å
4	I	63.8	Low	61.4	Low	147 Å²	147	140.5 Å²	140.5	75%	0.754	76%	0.761	S	S	*	*			trans	-70.3	110.2	177.3	-66.5	164.6	0	0	0	107.9	S2 N6	S2-I4 PolarHBondContact O-N 2.94Å; I4-N6 HydrophobicContact CG2-CB 4.21Å; I4-N6 PolarHBondContact O-N 3.49Å
5	Q	63.3	Low	61.2	Low	171 Å²	171	139.3 Å²	139.3	80%	0.799	75%	0.754	S	S	*	*	G	3₁₀ helix	trans	-71.7	-9.1	-176.2	-67.6	176.6	-14.5	0	0	113.8	A3 L7	A3-Q5 PolarHBondContact O-N 2.69Å; Q5-L7 VanDerWaalsContact C-N 3.35Å; Q5-L7 PolarHBondContact O-N 3.37Å
6	N	61.2	Low	60.8	Low	155 Å²	155	134.3 Å²	134.3	83%	0.829	74%	0.738	S	S	*	*	G	3₁₀ helix	trans	-88.7	6.1	-170.8	-124.4	34.2	0	0	0	115.1	I4	I4-N6 HydrophobicContact CG2-CB 4.21Å; I4-N6 PolarHBondContact O-N 3.49Å
7	L	58.9	Low	60.4	Low	159 Å²	159	132.3 Å²	132.3	83%	0.832	73%	0.73	S	S	*	*	G	3₁₀ helix	trans	-110.4	31.5	173.2	-147.5	80.6	0	0	0	111.4	Q5 T9	Q5-L7 VanDerWaalsContact C-N 3.35Å; Q5-L7 PolarHBondContact O-N 3.37Å; L7-T9 PolarHBondContact O-N 3.43Å
8	Q	63.8	Low	60	Low	166 Å²	166	134.9 Å²	134.9	78%	0.776	73%	0.733	S	S	*	*			trans	-71.3	107.9	158.6	-69.1	-172.9	-19.6	0	0	106.2	F10	Q8-F10 PolarHBondContact O-N 3.25Å
9	T	63.7	Low	59	Low	143 Å²	143	131.4 Å²	131.4	88%	0.877	73%	0.732	S	S	*	*			trans	-58.8	89.1	166.2	14.7	0	0	0	0	107.4	L7 D11	L7-T9 PolarHBondContact O-N 3.43Å; T9-D11 PolarHBondContact O-N 2.77Å
10	F	63.8	Low	58.1	Low	177 Å²	177	130.5 Å²	130.5	78%	0.776	73%	0.725	S	S	*	*			trans	-66.9	102.8	172.9	-176	-99	0	0	0	106.6	Q8 P12	Q8-F10 PolarHBondContact O-N 3.25Å; F10-P12 HydrophobicContact CE1-CB 4.4Å; F10-P12 WeakPolarHBondContact O-CD 3.22Å
11	D	71.3	Confident	57.9	Low	95 Å²	95	132.4 Å²	132.4	51%	0.508	73%	0.734	S	S	.	*			trans	-82.9	104.6	173.9	-176.6	-2.9	0	0	0	108.5	T9 F13 A14	T9-D11 PolarHBondContact O-N 2.77Å; D11-F13 PolarHBondContact O-N 3.09Å; D11-F13 VanDerWaalsContact O-N 3.09Å; D11-F13 WeakPolarHBondContact OD1-CB 3.46Å; D11-F13 PolarHBondContact OD1-N 3.3Å; D11-A14 HydrophobicContact CB-CB 4.27Å; D11-A14 WeakPolarHBondContact O-CB 3.17Å; D11-A14 PolarHBondContact O-N 3.09Å; D11-A14 VanDerWaalsContact O-N 3.09Å
12	P	69.5	Low	58.1	Low	86 Å²	86	130.8 Å²	130.8	56%	0.558	72%	0.715	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.8	-8.6	-178.1	29.6	-35.3	0	0	0	113.2	F10	F10-P12 HydrophobicContact CE1-CB 4.4Å; F10-P12 WeakPolarHBondContact O-CD 3.22Å
13	F	58.4	Low	58.1	Low	158 Å²	158	131 Å²	131	69%	0.693	71%	0.706	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.5	-9.1	175.2	-64.1	-79.4	0	0	0	113.6	D11 D15 A16	D11-F13 PolarHBondContact O-N 3.09Å; D11-F13 VanDerWaalsContact O-N 3.09Å; D11-F13 WeakPolarHBondContact OD1-CB 3.46Å; D11-F13 PolarHBondContact OD1-N 3.3Å; F13-D15 VanDerWaalsContact C-N 3.27Å; F13-D15 PolarHBondContact O-N 3.24Å; F13-A16 PolarHBondContact O-N 3.26Å
14	A	63.3	Low	57.8	Low	54 Å²	54	132.3 Å²	132.3	45%	0.446	71%	0.706	S	S	.	*	T	Hydrogen-bonded Turn	trans	-69.3	-22.7	179.5	0	0	0	0	0	113.9	D11 T17	D11-A14 HydrophobicContact CB-CB 4.27Å; D11-A14 WeakPolarHBondContact O-CB 3.17Å; D11-A14 PolarHBondContact O-N 3.09Å; D11-A14 VanDerWaalsContact O-N 3.09Å; A14-T17 PolarHBondContact O-OG1 3.4Å
15	D	57.9	Low	56.7	Low	123 Å²	123	129.7 Å²	129.7	66%	0.658	71%	0.707	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.3	-27.5	176.1	-124.4	-52.7	0	0	0	112.1	F13 T17 K18	F13-D15 VanDerWaalsContact C-N 3.27Å; F13-D15 PolarHBondContact O-N 3.24Å; D15-T17 VanDerWaalsContact C-N 3.32Å; D15-T17 PolarHBondContact O-N 3.3Å; D15-K18 PolarHBondContact O-N 3.17Å
16	A	54.9	Low	55.8	Low	59 Å²	59	123.2 Å²	123.2	49%	0.488	69%	0.686	S	S	.	*	G	3₁₀ helix	trans	-70.6	-25.1	-178.4	0	0	0	0	0	113.3	F13 K18	F13-A16 PolarHBondContact O-N 3.26Å; A16-K18 PolarHBondContact O-N 3.34Å
17	T	53.6	Low	55.2	Low	100 Å²	100	121.6 Å²	121.6	61%	0.613	68%	0.682	S	S	*	*	G	3₁₀ helix	trans	-69.6	-15.8	174.7	36.6	0	0	0	0	113.8	A14 D15	A14-T17 PolarHBondContact O-OG1 3.4Å; D15-T17 VanDerWaalsContact C-N 3.32Å; D15-T17 PolarHBondContact O-N 3.3Å
18	K	54.1	Low	55	Low	180 Å²	180	122 Å²	122	78%	0.783	68%	0.679	S	S	*	*	G	3₁₀ helix	trans	-97.1	-11.7	-179.6	-65.5	-178.8	-177	173.2	0	114	D15 A16	D15-K18 PolarHBondContact O-N 3.17Å; A16-K18 PolarHBondContact O-N 3.34Å
19	G	40.4	Very low	55.3	Low	68 Å²	68	118.9 Å²	118.9	70%	0.701	67%	0.668	S	S	*	*	T	Hydrogen-bonded Turn	trans	-121.5	-2.8	-160.4	0	0	0	0	0	117.6
20	D	40	Very low	56.4	Low	113 Å²	113	115.6 Å²	115.6	60%	0.604	64%	0.64	S	S	*	*			trans	-117.8	117.5	-174.3	-161.1	75.4	0	0	0	113.1	R22	D20-R22 PolarHBondContact O-N 3.36Å; D20-R22 VanDerWaalsContact OD2-CA 3.3Å; D20-R22 WeakPolarHBondContact OD2-CA 3.39Å; D20-R22 WeakPolarHBondContact OD2-CB 3.45Å; D20-R22 PolarHBondContact OD2-N 3.31Å; D20-R22 VanDerWaalsContact OD2-O 3.06Å
21	D	54	Low	57.6	Low	171 Å²	171	107.8 Å²	107.8	91%	0.914	61%	0.606	S	S	*	*	S	Bend	trans	-68.5	15.7	173.6	-144.5	-99.4	0	0	0	112.2
22	R	47.5	Very low	58.5	Low	208 Å²	208	105.1 Å²	105.1	79%	0.785	59%	0.591	S	S	*	*	S	Bend	trans	-137.6	78.2	174.4	-56.7	-179.4	166.2	156.8	-2.4	110.6	D20 P24	D20-R22 PolarHBondContact O-N 3.36Å; D20-R22 VanDerWaalsContact OD2-CA 3.3Å; D20-R22 WeakPolarHBondContact OD2-CA 3.39Å; D20-R22 WeakPolarHBondContact OD2-CB 3.45Å; D20-R22 PolarHBondContact OD2-N 3.31Å; D20-R22 VanDerWaalsContact OD2-O 3.06Å; R22-P24 WeakPolarHBondContact O-CD 3.49Å
23	L	55.3	Low	59.5	Low	125 Å²	125	101 Å²	101	65%	0.654	56%	0.564	S	S	*	*			trans	-17.3	119.8	162.5	-66.1	162.1	0	0	0	113
24	P	55.1	Low	61.1	Low	120 Å²	120	97.6 Å²	97.6	78%	0.779	55%	0.547	S	S	*	.				-149.6	171.3	89.8	34	-14	0	0	0	115.6	R22	R22-P24 WeakPolarHBondContact O-CD 3.49Å
25	A	40.7	Very low	62.5	Low	93 Å²	93	96.2 Å²	96.2	77%	0.769	53%	0.531	S	S	*	.	S	Bend	trans	87	46.6	176.1	0	0	0	0	0	117.6
26	G	43.7	Very low	64.1	Low	35 Å²	35	94.9 Å²	94.9	36%	0.361	52%	0.521	S	S	.	.			trans	-139	112.3	151.2	0	0	0	0	0	108.7	E28	G26-E28 PolarHBondContact O-N 3.08Å
27	T	50.3	Low	65.9	Low	121 Å²	121	98 Å²	98	74%	0.742	53%	0.525	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.7	7.7	168.6	43.5	0	0	0	0	112.6
28	E	54.3	Low	67.6	Low	167 Å²	167	100.3 Å²	100.3	78%	0.78	52%	0.523	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.8	-17.1	-167.4	-58.4	-169.1	151.7	0	0	113.5	G26	G26-E28 PolarHBondContact O-N 3.08Å
29	D	69.9	Low	69.4	Low	101 Å²	101	97.2 Å²	97.2	54%	0.54	52%	0.515	S	S	.	.	S	Bend	trans	-100.3	-4.6	-177.1	-69.3	-32.8	0	0	0	115
30	Y	85.9	Confident	71.6	Confident	74 Å²	74	96.6 Å²	96.6	29%	0.29	51%	0.509	S	S	.	.			trans	-85.9	127.7	178.7	-69.7	-74.6	0	0	0	111	H32 E106 Q107 K109	Y30-H32 PolarHBondContact O-CD2 2.93Å; Y30-H32 PolarHBondContact O-N 3.47Å; Y30-E106 WeakPolarHBondContact CE1-O 3.47Å; Y30-Q107 WeakPolarHBondContact CA-O 3.2Å; Y30-Q107 WeakPolarHBondContact CD1-O 3.38Å; Y30-K109 HydrophobicContact CD1-CD 4.41Å; Y30-K109 HydrophobicContact CD1-CG 3.89Å; Y30-K109 HydrophobicContact CG-CG 4.19Å
31	I	88.8	Confident	73.9	Confident	13 Å²	13	103.2 Å²	103.2	7%	0.067	53%	0.525	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.1	110.7	170.2	-59.4	-178.1	0	0	0	107.9	V47 Q48 L97 A103 Q107 L108 K109	I31-V47 HydrophobicContact CG2-CG1 3.53Å; I31-Q48 CarbonylContact C-O 3.6Å; I31-Q48 WeakPolarHBondContact CA-O 3.36Å; I31-L97 HydrophobicContact CD1-CD1 4.42Å; I31-L97 HydrophobicContact CG2-CD1 4.08Å; I31-A103 HydrophobicContact CD1-CB 3.66Å; I31-Q107 PolarHBondContact N-O 3.42Å; I31-L108 HydrophobicContact CB-CD2 3.94Å; I31-L108 HydrophobicContact CG2-CD2 4.06Å; I31-K109 PolarHBondContact O-N 3.21Å
32	H	90.1	Very high	75.7	Confident	39 Å²	39	102 Å²	102	18%	0.181	51%	0.512	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.7	118.3	178	-64.8	-65.6	0	0	0	110.5	Y30 V47 Q48 K109 H111	Y30-H32 PolarHBondContact O-CD2 2.93Å; Y30-H32 PolarHBondContact O-N 3.47Å; H32-V47 WeakPolarHBondContact O-CA 3.41Å; H32-Q48 HydrophobicContact CB-CB 4.23Å; H32-Q48 PolarHBondContact N-O 3.45Å; H32-Q48 PolarHBondContact O-N 3.15Å; H32-K109 WeakPolarHBondContact CA-O 3.24Å; H32-K109 WeakPolarHBondContact ND1-CB 3.39Å; H32-H111 AromaticContact CE1-NE2 3.78Å; H32-H111 AromaticContact CG-NE2 3.77Å; H32-H111 AromaticContact ND1-CD2 3.78Å; H32-H111 AromaticContact ND1-NE2 2.98Å; H32-H111 PolarHBondContact ND1-NE2 2.69Å
33	I	92.3	Very high	77.9	Confident	0 Å²	0	93.5 Å²	93.5	0%	0	48%	0.483	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102	109	172.2	-57.3	169.7	0	0	0	107	T45 V47 R90 I93 C94 L97 L108 K109 V110 H111	I33-T45 HydrophobicContact CG2-CG2 3.7Å; I33-V47 HydrophobicContact CG1-CG1 4.44Å; I33-R90 HydrophobicContact CG2-CB 4.17Å; I33-I93 HydrophobicContact CD1-CB 4.17Å; I33-I93 HydrophobicContact CD1-CG2 3.64Å; I33-I93 HydrophobicContact CG1-CG2 4.15Å; I33-I93 HydrophobicContact CG2-CD1 4.46Å; I33-C94 HydrophobicContact CD1-CB 4.4Å; I33-L97 HydrophobicContact CD1-CD1 4.36Å; I33-L108 HydrophobicContact CD1-CD2 4.16Å; I33-K109 PolarHBondContact N-O 3.13Å; I33-V110 HydrophobicContact CD1-CG2 4.3Å; I33-H111 PolarHBondContact O-N 2.82Å
34	R	91.5	Very high	79.7	Confident	86 Å²	86	89.3 Å²	89.3	33%	0.325	46%	0.461	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.9	147.6	179.3	-52.7	178.6	-178.4	-91.6	1.5	110.2	T45 T46 H111	R34-T45 CarbonylContact O-C 3.46Å; R34-T45 WeakPolarHBondContact O-CA 3.48Å; R34-T46 PolarHBondContact N-O 2.7Å; R34-T46 PolarHBondContact O-N 3.01Å; R34-T46 PolarHBondContact O-OG1 3.37Å; R34-H111 HydrophobicContact CB-CB 4.44Å; R34-H111 HydrophobicContact CG-CB 4.03Å
35	I	93.4	Very high	81.5	Confident	24 Å²	24	83.6 Å²	83.6	12%	0.123	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.5	139.6	171.3	-168.6	170.7	0	0	0	110.1	T43 L44 D88 H111 F113	I35-T43 HydrophobicContact CD1-CG2 3.98Å; I35-T43 HydrophobicContact CG1-CG2 4.26Å; I35-L44 CarbonylContact C-O 3.57Å; I35-L44 WeakPolarHBondContact CA-O 3.4Å; I35-D88 HydrophobicContact CD1-CB 3.65Å; I35-H111 PolarHBondContact N-O 2.83Å; I35-F113 HydrophobicContact CG2-CD2 3.7Å; I35-F113 HydrophobicContact CG2-CE2 4.1Å
36	Q	91.1	Very high	84	Confident	96 Å²	96	79.2 Å²	79.2	45%	0.449	39%	0.388	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	137.3	174.2	-61	-174.1	41.7	0	0	109.2	T43 L44	Q36-T43 CarbonylContact O-C 3.58Å; Q36-T43 VanDerWaalsContact O-CA 3.24Å; Q36-T43 WeakPolarHBondContact O-CA 3.2Å; Q36-L44 PolarHBondContact N-O 3.26Å; Q36-L44 PolarHBondContact O-N 3.04Å
37	Q	91.9	Very high	86.2	Confident	123 Å²	123	77.6 Å²	77.6	58%	0.575	37%	0.371	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-84.8	120.7	174.8	-164.6	173.9	28.3	0	0	109	G40 F113	Q37-G40 WeakPolarHBondContact CG-O 3.3Å; Q37-G40 PolarHBondContact NE2-O 2.95Å; Q37-F113 HydrophobicContact CB-CE2 4.38Å; Q37-F113 HydrophobicContact CB-CZ 4.34Å
38	R	90.1	Very high	88.1	Confident	149 Å²	149	72.5 Å²	72.5	56%	0.562	34%	0.339	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-84.2	-54.2	178.4	-175.7	179.8	177	-176.7	0.4	111.3	K42 L44	R38-K42 HydrophobicContact CB-CB 4.48Å; R38-K42 PolarHBondContact N-O 3.01Å; R38-L44 HydrophobicContact CB-CD1 4.19Å; R38-L44 HydrophobicContact CB-CG 4.16Å; R38-L44 HydrophobicContact CG-CD1 4.39Å
39	N	90.3	Very high	89.6	Confident	115 Å²	115	66.3 Å²	66.3	62%	0.615	32%	0.32	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-158.4	112.4	-176.8	-85.2	-26.4	0	0	0	110.3	R41 K42	N39-R41 PolarHBondContact O-N 3.31Å; N39-K42 PolarHBondContact N-O 3.15Å; N39-K42 WeakPolarHBondContact O-CB 3.47Å; N39-K42 PolarHBondContact O-N 3.34Å
40	G	88.4	Confident	90.3	Very high	55 Å²	55	62.2 Å²	62.2	57%	0.567	30%	0.298	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.8	-113.4	178.6	0	0	0	0	0	111.3	Q37 K42	Q37-G40 WeakPolarHBondContact CG-O 3.3Å; Q37-G40 PolarHBondContact NE2-O 2.95Å; G40-K42 VanDerWaalsContact C-N 3.32Å; G40-K42 PolarHBondContact O-N 2.98Å
41	R	87.8	Confident	90.1	Very high	253 Å²	253	61.2 Å²	61.2	96%	0.955	30%	0.301	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.4	-8.4	179.3	-59.4	-176.9	-175.9	-178.3	0.7	115	N39	N39-R41 PolarHBondContact O-N 3.31Å
42	K	91.9	Very high	89.6	Confident	145 Å²	145	64.3 Å²	64.3	63%	0.63	33%	0.329	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-84.7	124.7	-179.4	-62.1	-172.8	178.7	-177.5	0	110.1	R38 N39 G40	R38-K42 HydrophobicContact CB-CB 4.48Å; R38-K42 PolarHBondContact N-O 3.01Å; N39-K42 PolarHBondContact N-O 3.15Å; N39-K42 WeakPolarHBondContact O-CB 3.47Å; N39-K42 PolarHBondContact O-N 3.34Å; G40-K42 VanDerWaalsContact C-N 3.32Å; G40-K42 PolarHBondContact O-N 2.98Å
43	T	93.4	Very high	89.2	Confident	29 Å²	29	69.6 Å²	69.6	18%	0.178	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119	161.1	176.8	52.3	0	0	0	0	111	I35 Q36 G87 D88	I35-T43 HydrophobicContact CD1-CG2 3.98Å; I35-T43 HydrophobicContact CG1-CG2 4.26Å; Q36-T43 CarbonylContact O-C 3.58Å; Q36-T43 VanDerWaalsContact O-CA 3.24Å; Q36-T43 WeakPolarHBondContact O-CA 3.2Å; T43-G87 WeakPolarHBondContact O-CA 3.23Å; T43-G87 PolarHBondContact O-N 3.1Å; T43-G87 WeakPolarHBondContact OG1-CA 3.38Å; T43-D88 PolarHBondContact OG1-N 3.34Å
44	L	92.6	Very high	88.7	Confident	37 Å²	37	75.5 Å²	75.5	19%	0.194	38%	0.382	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.7	132.5	171.9	-65.8	171.8	0	0	0	107.2	I35 Q36 R38 L85 Q86	I35-L44 CarbonylContact C-O 3.57Å; I35-L44 WeakPolarHBondContact CA-O 3.4Å; Q36-L44 PolarHBondContact N-O 3.26Å; Q36-L44 PolarHBondContact O-N 3.04Å; R38-L44 HydrophobicContact CB-CD1 4.19Å; R38-L44 HydrophobicContact CB-CG 4.16Å; R38-L44 HydrophobicContact CG-CD1 4.39Å; L44-L85 CarbonylContact C-O 3.58Å; L44-L85 WeakPolarHBondContact CA-O 3.48Å; L44-Q86 HydrophobicContact CD2-CG 4.29Å
45	T	93.5	Very high	88.5	Confident	0 Å²	0	76 Å²	76	0%	0	39%	0.391	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.9	125.1	172.6	-55.7	0	0	0	0	108.2	I33 R34 L85 G87 Q89 I93	I33-T45 HydrophobicContact CG2-CG2 3.7Å; R34-T45 CarbonylContact O-C 3.46Å; R34-T45 WeakPolarHBondContact O-CA 3.48Å; T45-L85 PolarHBondContact N-O 3.43Å; T45-L85 PolarHBondContact O-N 3.38Å; T45-G87 PolarHBondContact OG1-O 3.22Å; T45-Q89 PolarHBondContact OG1-N 3.05Å; T45-Q89 VanDerWaalsContact OG1-N 3.13Å; T45-I93 HydrophobicContact CG2-CD1 3.51Å
46	T	92	Very high	88.1	Confident	2 Å²	2	75.6 Å²	75.6	1%	0.012	39%	0.388	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.9	130.7	176.9	54.9	0	0	0	0	110	R34 I83 Q84	R34-T46 PolarHBondContact N-O 2.7Å; R34-T46 PolarHBondContact O-N 3.01Å; R34-T46 PolarHBondContact O-OG1 3.37Å; T46-I83 CarbonylContact C-O 3.56Å; T46-I83 WeakPolarHBondContact CA-O 3.46Å; T46-Q84 HydrophobicContact CG2-CG 3.81Å
47	V	91	Very high	88	Confident	1 Å²	1	79 Å²	79	1%	0.006	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	120.8	173.4	-169.7	0	0	0	0	108.2	I31 H32 I33 I50 I83 I93	I31-V47 HydrophobicContact CG2-CG1 3.53Å; H32-V47 WeakPolarHBondContact O-CA 3.41Å; I33-V47 HydrophobicContact CG1-CG1 4.44Å; V47-I50 HydrophobicContact CB-CD1 4.41Å; V47-I50 HydrophobicContact CG1-CD1 3.8Å; V47-I50 HydrophobicContact CG1-CG1 4.13Å; V47-I83 HydrophobicContact CB-CB 4.44Å; V47-I83 PolarHBondContact N-O 3.41Å; V47-I83 PolarHBondContact O-N 2.98Å; V47-I83 VanDerWaalsContact O-N 3.08Å; V47-I93 HydrophobicContact CG2-CD1 3.91Å; V47-I93 HydrophobicContact CG2-CG2 3.89Å
48	Q	89.9	Confident	87.9	Confident	14 Å²	14	79.6 Å²	79.6	7%	0.065	40%	0.402	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	155.8	-179.8	-50.3	175	-22.2	0	0	109.3	I31 H32 V82	I31-Q48 CarbonylContact C-O 3.6Å; I31-Q48 WeakPolarHBondContact CA-O 3.36Å; H32-Q48 HydrophobicContact CB-CB 4.23Å; H32-Q48 PolarHBondContact N-O 3.45Å; H32-Q48 PolarHBondContact O-N 3.15Å; Q48-V82 HydrophobicContact CB-CG1 4.41Å; Q48-V82 HydrophobicContact CG-CG1 3.88Å
49	G	85.7	Confident	87.8	Confident	37 Å²	37	73.6 Å²	73.6	38%	0.381	38%	0.381	S	S	.	.			trans	84.8	19.5	175.8	0	0	0	0	0	115
50	I	84.9	Confident	87.9	Confident	15 Å²	15	68.5 Å²	68.5	8%	0.077	35%	0.354	C	S	.	.			trans	-84	124.7	171.1	-61.3	174.8	0	0	0	108.4	V47 Y54 K56 L59 I83	V47-I50 HydrophobicContact CB-CD1 4.41Å; V47-I50 HydrophobicContact CG1-CD1 3.8Å; V47-I50 HydrophobicContact CG1-CG1 4.13Å; I50-Y54 HydrophobicContact CG2-CD2 4.47Å; I50-K56 HydrophobicContact CG2-CG 4.34Å; I50-K56 WeakPolarHBondContact O-CE 3.31Å; I50-L59 HydrophobicContact CD1-CD2 3.69Å; I50-I83 HydrophobicContact CD1-CD1 3.68Å; I50-I83 HydrophobicContact CD1-CG1 4.44Å
51	S	81.8	Confident	88.1	Confident	52 Å²	52	73.3 Å²	73.3	36%	0.364	36%	0.36	S	S	.	.			trans	-52.5	143.6	177.1	176.5	0	0	0	0	111.8	D53 Y54 K56	S51-D53 PolarHBondContact O-N 3.1Å; S51-D53 PolarHBondContact OG-N 3.38Å; S51-D53 PolarHBondContact OG-OD2 3.19Å; S51-Y54 PolarHBondContact O-N 3.43Å; S51-K56 WeakPolarHBondContact O-CE 3.48Å
52	A	77.9	Confident	88.3	Confident	79 Å²	79	63.1 Å²	63.1	65%	0.653	33%	0.329	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.9	-19.6	175.5	0	0	0	0	0	113.1	Y54	A52-Y54 PolarHBondContact O-N 2.9Å
53	D	81.3	Confident	88.2	Confident	150 Å²	150	56.2 Å²	56.2	80%	0.802	30%	0.299	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.4	-22.9	178	-54.8	-44.1	0	0	0	112.4	S51	S51-D53 PolarHBondContact O-N 3.1Å; S51-D53 PolarHBondContact OG-N 3.38Å; S51-D53 PolarHBondContact OG-OD2 3.19Å
54	Y	82.8	Confident	88.1	Confident	123 Å²	123	58.8 Å²	58.8	48%	0.482	31%	0.308	S	S	.	.	S	Bend	trans	-85.1	138.7	178.5	-69.1	-71.1	0	0	0	112.4	I50 S51 A52 K56 L102	I50-Y54 HydrophobicContact CG2-CD2 4.47Å; S51-Y54 PolarHBondContact O-N 3.43Å; A52-Y54 PolarHBondContact O-N 2.9Å; Y54-K56 VanDerWaalsContact C-N 3.33Å; Y54-K56 PolarHBondContact O-N 2.94Å; Y54-L102 HydrophobicContact CD1-CD1 3.66Å; Y54-L102 HydrophobicContact CD2-CD1 4.12Å; Y54-L102 HydrophobicContact CE1-CD1 3.26Å; Y54-L102 HydrophobicContact CE2-CD1 3.77Å; Y54-L102 HydrophobicContact CG-CD1 4.07Å
55	D	86.3	Confident	88.1	Confident	96 Å²	96	66.3 Å²	66.3	51%	0.513	34%	0.339	S	S	.	.			trans	-68.9	84	174	-91	-40.2	0	0	0	112	K57 K58 L59	D55-K57 PolarHBondContact O-N 3.46Å; D55-K57 VanDerWaalsContact O-N 3.13Å; D55-K58 HydrophobicContact CB-CB 4.01Å; D55-K58 HydrophobicContact CB-CD 3.77Å; D55-K58 HydrophobicContact CB-CG 3.93Å; D55-K58 WeakPolarHBondContact O-CB 3.26Å; D55-K58 PolarHBondContact O-N 2.86Å; D55-K58 WeakPolarHBondContact OD2-CD 3.35Å; D55-K58 VanDerWaalsContact OD2-CE 3.22Å; D55-K58 WeakPolarHBondContact OD2-CE 3.47Å; D55-K58 IonicContact OD2-NZ 2.69Å; D55-K58 PolarHBondContact OD2-NZ 3.37Å; D55-L59 PolarHBondContact O-N 3.18Å; D55-L59 VanDerWaalsContact O-N 3.08Å
56	K	86.3	Confident	87.9	Confident	17 Å²	17	70.9 Å²	70.9	7%	0.074	36%	0.359	C	S	.	.	H	α-helix	trans	-56.1	-33.1	179.2	-66.6	166.4	-163.2	171.9	0	112.5	I50 S51 Y54 K58 L59 V60 V73 E81 I83	I50-K56 HydrophobicContact CG2-CG 4.34Å; I50-K56 WeakPolarHBondContact O-CE 3.31Å; S51-K56 WeakPolarHBondContact O-CE 3.48Å; Y54-K56 VanDerWaalsContact C-N 3.33Å; Y54-K56 PolarHBondContact O-N 2.94Å; K56-K58 PolarHBondContact O-N 3.12Å; K56-L59 PolarHBondContact O-N 3.26Å; K56-V60 WeakPolarHBondContact O-CG2 3.29Å; K56-V60 PolarHBondContact O-N 3.44Å; K56-V73 HydrophobicContact CB-CG1 4.4Å; K56-V73 HydrophobicContact CB-CG2 4.02Å; K56-E81 HydrophobicContact CD-CB 4Å; K56-E81 VanDerWaalsContact CD-OE2 3.23Å; K56-E81 WeakPolarHBondContact CD-OE2 3.47Å; K56-E81 WeakPolarHBondContact CE-OE2 3.44Å; K56-E81 VanDerWaalsContact NZ-CB 3.27Å; K56-E81 IonicContact NZ-OE2 2.86Å; K56-E81 PolarHBondContact NZ-OE2 2.93Å; K56-I83 HydrophobicContact CB-CD1 4.31Å; K56-I83 HydrophobicContact CG-CD1 4.46Å
57	K	88.1	Confident	87.7	Confident	166 Å²	166	71.9 Å²	71.9	72%	0.722	36%	0.363	S	S	*	.	H	α-helix	trans	-63.7	-38.1	174.9	-70.6	178.1	-178	169.6	0	112.7	D55 K61	D55-K57 PolarHBondContact O-N 3.46Å; D55-K57 VanDerWaalsContact O-N 3.13Å; K57-K61 WeakPolarHBondContact O-CG 3.5Å; K57-K61 PolarHBondContact O-N 3.46Å
58	K	90	Very high	87.7	Confident	137 Å²	137	76.4 Å²	76.4	60%	0.596	40%	0.401	S	S	*	.	H	α-helix	trans	-71.6	-40.9	175.5	-69.7	178.5	-175.8	155.1	0	110.3	D55 K56 V60 K61 A62	D55-K58 HydrophobicContact CB-CB 4.01Å; D55-K58 HydrophobicContact CB-CD 3.77Å; D55-K58 HydrophobicContact CB-CG 3.93Å; D55-K58 WeakPolarHBondContact O-CB 3.26Å; D55-K58 PolarHBondContact O-N 2.86Å; D55-K58 WeakPolarHBondContact OD2-CD 3.35Å; D55-K58 VanDerWaalsContact OD2-CE 3.22Å; D55-K58 WeakPolarHBondContact OD2-CE 3.47Å; D55-K58 IonicContact OD2-NZ 2.69Å; D55-K58 PolarHBondContact OD2-NZ 3.37Å; K56-K58 PolarHBondContact O-N 3.12Å; K58-V60 PolarHBondContact O-N 3.37Å; K58-K61 WeakPolarHBondContact O-CB 3.49Å; K58-K61 PolarHBondContact O-N 2.94Å; K58-K61 VanDerWaalsContact O-N 3.15Å; K58-A62 PolarHBondContact O-N 2.91Å
59	L	89.2	Confident	87.7	Confident	23 Å²	23	77.1 Å²	77.1	12%	0.12	41%	0.407	C	S	.	.	H	α-helix	trans	-58.6	-46.8	176	-152.7	85.2	0	0	0	111.4	I50 D55 K56 K61 A62 F63 I83 F96 L102	I50-L59 HydrophobicContact CD1-CD2 3.69Å; D55-L59 PolarHBondContact O-N 3.18Å; D55-L59 VanDerWaalsContact O-N 3.08Å; K56-L59 PolarHBondContact O-N 3.26Å; L59-K61 VanDerWaalsContact C-N 3.33Å; L59-K61 PolarHBondContact O-N 3Å; L59-A62 WeakPolarHBondContact O-CB 3.4Å; L59-A62 PolarHBondContact O-N 2.58Å; L59-A62 VanDerWaalsContact O-N 3.12Å; L59-F63 HydrophobicContact CB-CE2 4.44Å; L59-F63 HydrophobicContact CD2-CD2 4.37Å; L59-F63 HydrophobicContact CD2-CE2 3.38Å; L59-F63 HydrophobicContact CD2-CZ 3.54Å; L59-F63 HydrophobicContact CG-CD2 4.26Å; L59-F63 HydrophobicContact CG-CE1 4.5Å; L59-F63 HydrophobicContact CG-CE2 3.65Å; L59-F63 HydrophobicContact CG-CZ 3.79Å; L59-F63 WeakPolarHBondContact O-CD2 3.49Å; L59-F63 VanDerWaalsContact O-CG 3.31Å; L59-F63 WeakPolarHBondContact O-CG 3.3Å; L59-F63 PolarHBondContact O-N 2.86Å; L59-I83 HydrophobicContact CB-CD1 4.31Å; L59-I83 HydrophobicContact CD2-CD1 3.59Å; L59-I83 HydrophobicContact CG-CD1 4.5Å; L59-F96 HydrophobicContact CD1-CE1 4.41Å; L59-L102 HydrophobicContact CD1-CD2 4.13Å
60	V	91.4	Very high	88.1	Confident	8 Å²	8	79.5 Å²	79.5	5%	0.048	41%	0.411	C	S	.	.	H	α-helix	trans	-61.2	-38.7	175.9	171.2	0	0	0	0	112.2	K56 K58 F63 K64 V73 I83	K56-V60 WeakPolarHBondContact O-CG2 3.29Å; K56-V60 PolarHBondContact O-N 3.44Å; K58-V60 PolarHBondContact O-N 3.37Å; V60-F63 PolarHBondContact O-N 2.98Å; V60-K64 HydrophobicContact CG1-CD 4.17Å; V60-K64 HydrophobicContact CG1-CG 4.47Å; V60-K64 WeakPolarHBondContact O-CB 3.37Å; V60-K64 VanDerWaalsContact O-CG 3.26Å; V60-K64 WeakPolarHBondContact O-CG 3.24Å; V60-K64 PolarHBondContact O-N 3.28Å; V60-V73 HydrophobicContact CG2-CG2 3.66Å; V60-I83 HydrophobicContact CG2-CB 4.45Å; V60-I83 HydrophobicContact CG2-CD1 4.03Å; V60-I83 HydrophobicContact CG2-CG1 4.04Å; V60-I83 HydrophobicContact CG2-CG2 3.66Å
61	K	92	Very high	88.4	Confident	156 Å²	156	79 Å²	79	68%	0.678	41%	0.41	S	S	*	.	H	α-helix	trans	-63.8	-41.3	174.4	-75.5	179.6	-179.1	-178.6	0	111.7	K57 K58 L59 K64 K65	K57-K61 WeakPolarHBondContact O-CG 3.5Å; K57-K61 PolarHBondContact O-N 3.46Å; K58-K61 WeakPolarHBondContact O-CB 3.49Å; K58-K61 PolarHBondContact O-N 2.94Å; K58-K61 VanDerWaalsContact O-N 3.15Å; L59-K61 VanDerWaalsContact C-N 3.33Å; L59-K61 PolarHBondContact O-N 3Å; K61-K64 PolarHBondContact O-N 3.15Å; K61-K65 PolarHBondContact O-N 2.87Å; K61-K65 VanDerWaalsContact O-N 3.1Å
62	A	91.5	Very high	88.9	Confident	38 Å²	38	80 Å²	80	31%	0.314	41%	0.414	S	S	.	.	H	α-helix	trans	-65.6	-43.7	177.1	0	0	0	0	0	111.5	K58 L59 K64 K65 K66 F96	K58-A62 PolarHBondContact O-N 2.91Å; L59-A62 WeakPolarHBondContact O-CB 3.4Å; L59-A62 PolarHBondContact O-N 2.58Å; L59-A62 VanDerWaalsContact O-N 3.12Å; A62-K64 PolarHBondContact O-N 2.91Å; A62-K65 PolarHBondContact O-N 2.77Å; A62-K66 WeakPolarHBondContact O-CB 2.86Å; A62-K66 PolarHBondContact O-N 3.41Å; A62-F96 HydrophobicContact CB-CZ 3.74Å
63	F	90.6	Very high	89.6	Confident	0 Å²	0	78.3 Å²	78.3	0%	0	40%	0.395	C	S	.	.	H	α-helix	trans	-59.3	-44.5	173.9	-68	-36.4	0	0	0	112.7	L59 V60 K65 K66 F67 I83 L85 F96	L59-F63 HydrophobicContact CB-CE2 4.44Å; L59-F63 HydrophobicContact CD2-CD2 4.37Å; L59-F63 HydrophobicContact CD2-CE2 3.38Å; L59-F63 HydrophobicContact CD2-CZ 3.54Å; L59-F63 HydrophobicContact CG-CD2 4.26Å; L59-F63 HydrophobicContact CG-CE1 4.5Å; L59-F63 HydrophobicContact CG-CE2 3.65Å; L59-F63 HydrophobicContact CG-CZ 3.79Å; L59-F63 WeakPolarHBondContact O-CD2 3.49Å; L59-F63 VanDerWaalsContact O-CG 3.31Å; L59-F63 WeakPolarHBondContact O-CG 3.3Å; L59-F63 PolarHBondContact O-N 2.86Å; V60-F63 PolarHBondContact O-N 2.98Å; F63-K65 VanDerWaalsContact C-N 3.3Å; F63-K65 PolarHBondContact O-N 2.81Å; F63-K66 PolarHBondContact O-N 2.77Å; F63-F67 HydrophobicContact CB-CD2 3.96Å; F63-F67 HydrophobicContact CB-CE2 4.06Å; F63-F67 HydrophobicContact CD1-CD2 4.01Å; F63-F67 AromaticContact CD1-CE2 3.22Å; F63-F67 HydrophobicContact CD1-CE2 3.22Å; F63-F67 AromaticContact CD1-CZ 3.82Å; F63-F67 HydrophobicContact CD1-CZ 3.82Å; F63-F67 AromaticContact CE1-CE2 3.78Å; F63-F67 HydrophobicContact CE1-CE2 3.78Å; F63-F67 HydrophobicContact CE1-CZ 4.17Å; F63-F67 HydrophobicContact CG-CD2 4.31Å; F63-F67 AromaticContact CG-CE2 3.91Å; F63-F67 HydrophobicContact CG-CE2 3.91Å; F63-F67 WeakPolarHBondContact O-CB 3.26Å; F63-F67 PolarHBondContact O-N 3.23Å; F63-I83 HydrophobicContact CD2-CG2 4.24Å; F63-I83 HydrophobicContact CE2-CD1 4.11Å; F63-I83 HydrophobicContact CE2-CG2 4.24Å; F63-L85 HydrophobicContact CB-CD1 4.43Å; F63-L85 HydrophobicContact CB-CD2 3.93Å; F63-L85 HydrophobicContact CD2-CD1 4.06Å; F63-L85 HydrophobicContact CD2-CD2 4.39Å; F63-L85 HydrophobicContact CE2-CD1 4.46Å; F63-L85 HydrophobicContact CG-CD1 4.27Å; F63-L85 HydrophobicContact CG-CD2 4.5Å; F63-F96 AromaticContact CD1-CD1 3.76Å; F63-F96 HydrophobicContact CD1-CD1 3.76Å; F63-F96 AromaticContact CD1-CE1 3.61Å; F63-F96 HydrophobicContact CD1-CE1 3.61Å; F63-F96 HydrophobicContact CD1-CG 4.38Å; F63-F96 HydrophobicContact CD1-CZ 4.21Å; F63-F96 AromaticContact CE1-CD1 3.16Å; F63-F96 HydrophobicContact CE1-CD1 3.16Å; F63-F96 AromaticContact CE1-CE1 3.32Å; F63-F96 HydrophobicContact CE1-CE1 3.32Å; F63-F96 HydrophobicContact CE1-CG 4.02Å; F63-F96 HydrophobicContact CE1-CZ 4.33Å; F63-F96 HydrophobicContact CZ-CD1 4.1Å; F63-F96 HydrophobicContact CZ-CE1 4.17Å
64	K	91.5	Very high	90	Very high	84 Å²	84	73.9 Å²	73.9	37%	0.365	37%	0.371	S	S	.	.	H	α-helix	trans	-58.1	-42.9	175.4	-76	173.9	176.5	-176.6	0	112	V60 K61 A62 A68 C69 N70 G71	V60-K64 HydrophobicContact CG1-CD 4.17Å; V60-K64 HydrophobicContact CG1-CG 4.47Å; V60-K64 WeakPolarHBondContact O-CB 3.37Å; V60-K64 VanDerWaalsContact O-CG 3.26Å; V60-K64 WeakPolarHBondContact O-CG 3.24Å; V60-K64 PolarHBondContact O-N 3.28Å; K61-K64 PolarHBondContact O-N 3.15Å; A62-K64 PolarHBondContact O-N 2.91Å; K64-A68 WeakPolarHBondContact O-CA 3.44Å; K64-A68 PolarHBondContact O-N 2.85Å; K64-C69 WeakPolarHBondContact CA-O 3.1Å; K64-C69 WeakPolarHBondContact CG-O 3.32Å; K64-N70 VanDerWaalsContact CE-OD1 3.31Å; K64-N70 WeakPolarHBondContact CE-OD1 3.47Å; K64-N70 PolarHBondContact NZ-OD1 3.49Å; K64-G71 VanDerWaalsContact CE-N 3.3Å; K64-G71 WeakPolarHBondContact CE-O 3.37Å; K64-G71 PolarHBondContact NZ-O 3.31Å
65	K	91.6	Very high	90.2	Very high	194 Å²	194	75.3 Å²	75.3	84%	0.843	38%	0.382	S	S	*	.	H	α-helix	trans	-70.8	-40.7	-179	-168	177	-178.7	-176.8	0	112.3	K61 A62 F63	K61-K65 PolarHBondContact O-N 2.87Å; K61-K65 VanDerWaalsContact O-N 3.1Å; A62-K65 PolarHBondContact O-N 2.77Å; F63-K65 VanDerWaalsContact C-N 3.3Å; F63-K65 PolarHBondContact O-N 2.81Å
66	K	90.1	Very high	90	Very high	96 Å²	96	73.7 Å²	73.7	42%	0.417	37%	0.371	S	S	.	.	H	α-helix	trans	-82	-39.5	-175.3	-161.7	170.2	-170.8	166.1	0	113.1	A62 F63 F96 E99	A62-K66 WeakPolarHBondContact O-CB 2.86Å; A62-K66 PolarHBondContact O-N 3.41Å; F63-K66 PolarHBondContact O-N 2.77Å; K66-F96 HydrophobicContact CD-CD2 3.35Å; K66-F96 HydrophobicContact CD-CE2 3.58Å; K66-F96 HydrophobicContact CD-CG 4.49Å; K66-E99 IonicContact NZ-OE1 2.58Å; K66-E99 PolarHBondContact NZ-OE1 2.88Å; K66-E99 IonicContact NZ-OE2 2.7Å; K66-E99 PolarHBondContact NZ-OE2 2.86Å
67	F	88.5	Confident	89.7	Confident	24 Å²	24	79.4 Å²	79.4	11%	0.105	41%	0.41	C	S	.	.	H	α-helix	trans	-98.5	-3.6	-173.8	-50.2	-33.4	0	0	0	113.5	F63 C69 N92 I93 F96	F63-F67 HydrophobicContact CB-CD2 3.96Å; F63-F67 HydrophobicContact CB-CE2 4.06Å; F63-F67 HydrophobicContact CD1-CD2 4.01Å; F63-F67 AromaticContact CD1-CE2 3.22Å; F63-F67 HydrophobicContact CD1-CE2 3.22Å; F63-F67 AromaticContact CD1-CZ 3.82Å; F63-F67 HydrophobicContact CD1-CZ 3.82Å; F63-F67 AromaticContact CE1-CE2 3.78Å; F63-F67 HydrophobicContact CE1-CE2 3.78Å; F63-F67 HydrophobicContact CE1-CZ 4.17Å; F63-F67 HydrophobicContact CG-CD2 4.31Å; F63-F67 AromaticContact CG-CE2 3.91Å; F63-F67 HydrophobicContact CG-CE2 3.91Å; F63-F67 WeakPolarHBondContact O-CB 3.26Å; F63-F67 PolarHBondContact O-N 3.23Å; F67-C69 HydrophobicContact CB-CB 4.33Å; F67-C69 PolarHBondContact O-N 3.08Å; F67-C69 PolarHBondContact O-SG 2.87Å; F67-N92 HydrophobicContact CD1-CB 3.84Å; F67-N92 HydrophobicContact CE1-CB 3.6Å; F67-N92 HydrophobicContact CG-CB 4.48Å; F67-N92 HydrophobicContact CZ-CB 3.99Å; F67-N92 WeakPolarHBondContact CZ-O 3.31Å; F67-I93 HydrophobicContact CE2-CG1 3.84Å; F67-I93 HydrophobicContact CZ-CG1 4.41Å; F67-F96 HydrophobicContact CE1-CB 4.38Å; F67-F96 HydrophobicContact CZ-CB 3.79Å; F67-F96 HydrophobicContact CZ-CD2 4.46Å; F67-F96 HydrophobicContact CZ-CG 4.1Å
68	A	90.1	Very high	89.3	Confident	96 Å²	96	78.5 Å²	78.5	79%	0.793	41%	0.409	S	S	*	.			trans	50.9	30	-174.6	0	0	0	0	0	113.4	K64	K64-A68 WeakPolarHBondContact O-CA 3.44Å; K64-A68 PolarHBondContact O-N 2.85Å
69	C	90.7	Very high	88.4	Confident	29 Å²	29	77.2 Å²	77.2	20%	0.196	40%	0.401	C	S	.	.			trans	-114.6	153.3	-177.6	-71.5	0	0	0	0	110.4	K64 F67 Q89	K64-C69 WeakPolarHBondContact CA-O 3.1Å; K64-C69 WeakPolarHBondContact CG-O 3.32Å; F67-C69 HydrophobicContact CB-CB 4.33Å; F67-C69 PolarHBondContact O-N 3.08Å; F67-C69 PolarHBondContact O-SG 2.87Å; C69-Q89 PolarHBondContact SG-NE2 2.97Å
70	N	92.7	Very high	88.1	Confident	86 Å²	86	77.7 Å²	77.7	46%	0.46	41%	0.411	S	S	.	.			trans	-79.8	150	171.1	-161.8	8.9	0	0	0	110.6	K64 Q86	K64-N70 VanDerWaalsContact CE-OD1 3.31Å; K64-N70 WeakPolarHBondContact CE-OD1 3.47Å; K64-N70 PolarHBondContact NZ-OD1 3.49Å; N70-Q86 HydrophobicContact CB-CG 4.26Å; N70-Q86 PolarHBondContact O-N 3.23Å
71	G	92.8	Very high	87.8	Confident	6 Å²	6	81.5 Å²	81.5	6%	0.062	43%	0.428	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-153.3	152.5	-178	0	0	0	0	0	112.8	K64 Q84	K64-G71 VanDerWaalsContact CE-N 3.3Å; K64-G71 WeakPolarHBondContact CE-O 3.37Å; K64-G71 PolarHBondContact NZ-O 3.31Å; G71-Q84 CarbonylContact C-O 3.48Å; G71-Q84 WeakPolarHBondContact CA-O 3.45Å
72	T	92.3	Very high	87.7	Confident	73 Å²	73	74.1 Å²	74.1	45%	0.448	40%	0.396	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.6	151.1	177.4	-173.8	0	0	0	0	110.2	I74 Q84	T72-I74 HydrophobicContact CG2-CD1 3.75Å; T72-I74 HydrophobicContact CG2-CG1 3.65Å; T72-Q84 HydrophobicContact CG2-CB 4.22Å; T72-Q84 PolarHBondContact N-O 3.12Å; T72-Q84 PolarHBondContact O-N 3.03Å
73	V	91.5	Very high	87.7	Confident	42 Å²	42	72.4 Å²	72.4	26%	0.255	38%	0.382	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.5	131.5	165.6	-172.9	0	0	0	0	106.3	K56 V60 E81 V82 I83	K56-V73 HydrophobicContact CB-CG1 4.4Å; K56-V73 HydrophobicContact CB-CG2 4.02Å; V60-V73 HydrophobicContact CG2-CG2 3.66Å; V73-E81 HydrophobicContact CG1-CB 4.46Å; V73-V82 WeakPolarHBondContact CA-O 3.4Å; V73-I83 HydrophobicContact CG2-CG1 4.44Å
74	I	89.9	Confident	87.8	Confident	57 Å²	57	74 Å²	74	29%	0.292	39%	0.39	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.5	137	176.5	-54.9	-162.7	0	0	0	107.6	T72 V82 Q84	T72-I74 HydrophobicContact CG2-CD1 3.75Å; T72-I74 HydrophobicContact CG2-CG1 3.65Å; I74-V82 HydrophobicContact CB-CG2 4.23Å; I74-V82 PolarHBondContact N-O 2.88Å; I74-V82 VanDerWaalsContact O-CG2 3.3Å; I74-V82 WeakPolarHBondContact O-CG2 3.36Å; I74-V82 PolarHBondContact O-N 3.06Å; I74-V82 VanDerWaalsContact O-O 3.11Å; I74-Q84 HydrophobicContact CD1-CB 4.5Å; I74-Q84 HydrophobicContact CD1-CG 4.01Å; I74-Q84 HydrophobicContact CG1-CG 4.13Å
75	E	87	Confident	87.9	Confident	154 Å²	154	70.1 Å²	70.1	72%	0.72	37%	0.372	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.8	118.9	170.9	-165.8	174.2	-174	0	0	109.2	E81	E75-E81 HydrophobicContact CG-CG 4.4Å
76	H	81.1	Confident	88	Confident	61 Å²	61	65.2 Å²	65.2	28%	0.282	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.6	139.3	170.2	-90.7	-61.3	0	0	0	110.1	E78 Y79 G80 V82	H76-E78 VanDerWaalsContact C-N 3.26Å; H76-E78 PolarHBondContact O-N 3.2Å; H76-Y79 HydrophobicContact CB-CD2 4.45Å; H76-G80 PolarHBondContact N-O 3.39Å; H76-G80 VanDerWaalsContact O-CA 3.26Å; H76-G80 WeakPolarHBondContact O-CA 3.36Å; H76-G80 PolarHBondContact O-N 2.89Å; H76-V82 WeakPolarHBondContact CD2-CG2 3.26Å
77	P	80.9	Confident	88	Confident	138 Å²	138	61.9 Å²	61.9	90%	0.896	35%	0.345	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66	-25.9	-178.4	25.2	-33.7	0	0	0	113.7
78	E	78.9	Confident	88.2	Confident	147 Å²	147	63.9 Å²	63.9	69%	0.687	36%	0.357	S	S	*	.	T	Hydrogen-bonded Turn	trans	-97.3	-33.3	-178.6	-167.2	-176.7	152.8	0	0	113	H76	H76-E78 VanDerWaalsContact C-N 3.26Å; H76-E78 PolarHBondContact O-N 3.2Å
79	Y	72	Confident	88.1	Confident	109 Å²	109	60.5 Å²	60.5	43%	0.427	33%	0.325	S	S	.	.	T	Hydrogen-bonded Turn	trans	-113.4	3.5	-171.2	-52.5	-56.4	0	0	0	113.7	H76	H76-Y79 HydrophobicContact CB-CD2 4.45Å
80	G	83.6	Confident	88.1	Confident	33 Å²	33	63.2 Å²	63.2	34%	0.34	33%	0.331	S	S	.	.	E	Extended strand (participates in β ladder)	trans	65.9	-151.2	-174.8	0	0	0	0	0	112.9	H76 V82	H76-G80 PolarHBondContact N-O 3.39Å; H76-G80 VanDerWaalsContact O-CA 3.26Å; H76-G80 WeakPolarHBondContact O-CA 3.36Å; H76-G80 PolarHBondContact O-N 2.89Å; G80-V82 PolarHBondContact O-N 2.96Å
81	E	85.1	Confident	88	Confident	89 Å²	89	66.7 Å²	66.7	42%	0.416	34%	0.342	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.4	112.8	178.9	-75.3	-173.7	150.1	0	0	112.3	K56 V73 E75	K56-E81 HydrophobicContact CD-CB 4Å; K56-E81 VanDerWaalsContact CD-OE2 3.23Å; K56-E81 WeakPolarHBondContact CD-OE2 3.47Å; K56-E81 WeakPolarHBondContact CE-OE2 3.44Å; K56-E81 VanDerWaalsContact NZ-CB 3.27Å; K56-E81 IonicContact NZ-OE2 2.86Å; K56-E81 PolarHBondContact NZ-OE2 2.93Å; V73-E81 HydrophobicContact CG1-CB 4.46Å; E75-E81 HydrophobicContact CG-CG 4.4Å
82	V	89.6	Confident	87.9	Confident	1 Å²	1	69.7 Å²	69.7	1%	0.006	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.5	156.7	175.5	-55.5	0	0	0	0	111.4	Q48 V73 I74 H76 G80 Q84	Q48-V82 HydrophobicContact CB-CG1 4.41Å; Q48-V82 HydrophobicContact CG-CG1 3.88Å; V73-V82 WeakPolarHBondContact CA-O 3.4Å; I74-V82 HydrophobicContact CB-CG2 4.23Å; I74-V82 PolarHBondContact N-O 2.88Å; I74-V82 VanDerWaalsContact O-CG2 3.3Å; I74-V82 WeakPolarHBondContact O-CG2 3.36Å; I74-V82 PolarHBondContact O-N 3.06Å; I74-V82 VanDerWaalsContact O-O 3.11Å; H76-V82 WeakPolarHBondContact CD2-CG2 3.26Å; G80-V82 PolarHBondContact O-N 2.96Å; V82-Q84 HydrophobicContact CG2-CG 4.22Å
83	I	92	Very high	87.8	Confident	1 Å²	1	66.2 Å²	66.2	1%	0.005	34%	0.335	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	125.5	170.3	-63.8	175.5	0	0	0	108.8	T46 V47 I50 K56 L59 V60 F63 V73 L85	T46-I83 CarbonylContact C-O 3.56Å; T46-I83 WeakPolarHBondContact CA-O 3.46Å; V47-I83 HydrophobicContact CB-CB 4.44Å; V47-I83 PolarHBondContact N-O 3.41Å; V47-I83 PolarHBondContact O-N 2.98Å; V47-I83 VanDerWaalsContact O-N 3.08Å; I50-I83 HydrophobicContact CD1-CD1 3.68Å; I50-I83 HydrophobicContact CD1-CG1 4.44Å; K56-I83 HydrophobicContact CB-CD1 4.31Å; K56-I83 HydrophobicContact CG-CD1 4.46Å; L59-I83 HydrophobicContact CB-CD1 4.31Å; L59-I83 HydrophobicContact CD2-CD1 3.59Å; L59-I83 HydrophobicContact CG-CD1 4.5Å; V60-I83 HydrophobicContact CG2-CB 4.45Å; V60-I83 HydrophobicContact CG2-CD1 4.03Å; V60-I83 HydrophobicContact CG2-CG1 4.04Å; V60-I83 HydrophobicContact CG2-CG2 3.66Å; F63-I83 HydrophobicContact CD2-CG2 4.24Å; F63-I83 HydrophobicContact CE2-CD1 4.11Å; F63-I83 HydrophobicContact CE2-CG2 4.24Å; V73-I83 HydrophobicContact CG2-CG1 4.44Å; I83-L85 HydrophobicContact CG2-CG 4.24Å
84	Q	92.1	Very high	87.7	Confident	35 Å²	35	65.5 Å²	65.5	16%	0.164	33%	0.332	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.7	131.3	173.3	-61.2	-163.6	-8.8	0	0	110.6	T46 G71 T72 I74 V82	T46-Q84 HydrophobicContact CG2-CG 3.81Å; G71-Q84 CarbonylContact C-O 3.48Å; G71-Q84 WeakPolarHBondContact CA-O 3.45Å; T72-Q84 HydrophobicContact CG2-CB 4.22Å; T72-Q84 PolarHBondContact N-O 3.12Å; T72-Q84 PolarHBondContact O-N 3.03Å; I74-Q84 HydrophobicContact CD1-CB 4.5Å; I74-Q84 HydrophobicContact CD1-CG 4.01Å; I74-Q84 HydrophobicContact CG1-CG 4.13Å; V82-Q84 HydrophobicContact CG2-CG 4.22Å
85	L	94.2	Very high	87.7	Confident	1 Å²	1	69 Å²	69	1%	0.005	35%	0.347	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.7	148	177.2	-67.9	165.1	0	0	0	110.1	L44 T45 F63 I83 I93	L44-L85 CarbonylContact C-O 3.58Å; L44-L85 WeakPolarHBondContact CA-O 3.48Å; T45-L85 PolarHBondContact N-O 3.43Å; T45-L85 PolarHBondContact O-N 3.38Å; F63-L85 HydrophobicContact CB-CD1 4.43Å; F63-L85 HydrophobicContact CB-CD2 3.93Å; F63-L85 HydrophobicContact CD2-CD1 4.06Å; F63-L85 HydrophobicContact CD2-CD2 4.39Å; F63-L85 HydrophobicContact CE2-CD1 4.46Å; F63-L85 HydrophobicContact CG-CD1 4.27Å; F63-L85 HydrophobicContact CG-CD2 4.5Å; I83-L85 HydrophobicContact CG2-CG 4.24Å; L85-I93 HydrophobicContact CD1-CD1 3.52Å; L85-I93 HydrophobicContact CD1-CG1 3.91Å
86	Q	92.1	Very high	87.9	Confident	92 Å²	92	62.2 Å²	62.2	43%	0.43	32%	0.315	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.5	138.4	175.1	-64.2	-175.4	0.9	0	0	111.3	L44 N70	L44-Q86 HydrophobicContact CD2-CG 4.29Å; N70-Q86 HydrophobicContact CB-CG 4.26Å; N70-Q86 PolarHBondContact O-N 3.23Å
87	G	91.8	Very high	88.2	Confident	25 Å²	25	59.3 Å²	59.3	26%	0.258	30%	0.302	S	S	.	.	S	Bend	trans	86.6	175.6	-178.3	0	0	0	0	0	113.9	T43 T45 Q89	T43-G87 WeakPolarHBondContact O-CA 3.23Å; T43-G87 PolarHBondContact O-N 3.1Å; T43-G87 WeakPolarHBondContact OG1-CA 3.38Å; T45-G87 PolarHBondContact OG1-O 3.22Å; G87-Q89 PolarHBondContact O-N 3.22Å
88	D	90.9	Very high	88.6	Confident	67 Å²	67	55.9 Å²	55.9	36%	0.358	28%	0.275	S	S	.	.			trans	-82.6	107.9	169.3	-177.6	2.3	0	0	0	108.2	I35 T43 R90	I35-D88 HydrophobicContact CD1-CB 3.65Å; T43-D88 PolarHBondContact OG1-N 3.34Å; D88-R90 WeakPolarHBondContact OD1-CD 3.41Å; D88-R90 WeakPolarHBondContact OD1-CG 3.48Å; D88-R90 PolarHBondContact OD1-N 2.87Å; D88-R90 VanDerWaalsContact OD1-N 3.13Å; D88-R90 IonicContact OD1-NE 3.46Å; D88-R90 PolarHBondContact OD1-NE 3.01Å; D88-R90 IonicContact OD2-CZ 3.59Å; D88-R90 IonicContact OD2-NE 2.98Å; D88-R90 PolarHBondContact OD2-NE 2.95Å; D88-R90 IonicContact OD2-NH2 3.5Å
89	Q	88.4	Confident	89.1	Confident	24 Å²	24	54.5 Å²	54.5	11%	0.112	27%	0.269	C	S	.	.			trans	-119.8	16.7	-180	-62.7	-61.1	-28	0	0	111.8	T45 C69 G87 K91 N92 I93	T45-Q89 PolarHBondContact OG1-N 3.05Å; T45-Q89 VanDerWaalsContact OG1-N 3.13Å; C69-Q89 PolarHBondContact SG-NE2 2.97Å; G87-Q89 PolarHBondContact O-N 3.22Å; Q89-K91 VanDerWaalsContact C-N 3.32Å; Q89-K91 PolarHBondContact O-N 2.82Å; Q89-N92 PolarHBondContact O-N 2.82Å; Q89-N92 VanDerWaalsContact O-N 3.16Å; Q89-N92 PolarHBondContact OE1-ND2 2.88Å; Q89-I93 HydrophobicContact CB-CD1 3.78Å; Q89-I93 HydrophobicContact CB-CG1 4.06Å; Q89-I93 WeakPolarHBondContact O-CB 3.34Å; Q89-I93 WeakPolarHBondContact O-CD1 3.46Å; Q89-I93 VanDerWaalsContact O-CG1 3.26Å; Q89-I93 WeakPolarHBondContact O-CG1 3.35Å; Q89-I93 PolarHBondContact O-N 3.17Å
90	R	91	Very high	89.7	Confident	87 Å²	87	53.4 Å²	53.4	33%	0.328	27%	0.269	S	S	.	.	H	α-helix	trans	-56.6	-42.9	-171.1	68.3	-166.7	155.9	152.6	-2	113.7	I33 D88 C94 V110	I33-R90 HydrophobicContact CG2-CB 4.17Å; D88-R90 WeakPolarHBondContact OD1-CD 3.41Å; D88-R90 WeakPolarHBondContact OD1-CG 3.48Å; D88-R90 PolarHBondContact OD1-N 2.87Å; D88-R90 VanDerWaalsContact OD1-N 3.13Å; D88-R90 IonicContact OD1-NE 3.46Å; D88-R90 PolarHBondContact OD1-NE 3.01Å; D88-R90 IonicContact OD2-CZ 3.59Å; D88-R90 IonicContact OD2-NE 2.98Å; D88-R90 PolarHBondContact OD2-NE 2.95Å; D88-R90 IonicContact OD2-NH2 3.5Å; R90-C94 WeakPolarHBondContact O-CB 3.41Å; R90-C94 PolarHBondContact O-N 2.69Å; R90-C94 VanDerWaalsContact O-N 3.12Å; R90-V110 HydrophobicContact CB-CG1 3.95Å; R90-V110 HydrophobicContact CG-CG1 4.33Å
91	K	90.3	Very high	89.6	Confident	158 Å²	158	58.9 Å²	58.9	69%	0.687	29%	0.291	S	S	*	.	H	α-helix	trans	-69.2	-44.4	179.5	-64.4	-175.5	178.4	-176.4	0	111.5	Q89 C94 Q95	Q89-K91 VanDerWaalsContact C-N 3.32Å; Q89-K91 PolarHBondContact O-N 2.82Å; K91-C94 PolarHBondContact O-N 2.78Å; K91-Q95 PolarHBondContact O-N 2.98Å
92	N	91	Very high	89.4	Confident	69 Å²	69	56.1 Å²	56.1	37%	0.369	28%	0.279	S	S	.	.	H	α-helix	trans	-67.9	-38.9	-177.3	-66.5	-16	0	0	0	111.8	F67 Q89 F96	F67-N92 HydrophobicContact CD1-CB 3.84Å; F67-N92 HydrophobicContact CE1-CB 3.6Å; F67-N92 HydrophobicContact CG-CB 4.48Å; F67-N92 HydrophobicContact CZ-CB 3.99Å; F67-N92 WeakPolarHBondContact CZ-O 3.31Å; Q89-N92 PolarHBondContact O-N 2.82Å; Q89-N92 VanDerWaalsContact O-N 3.16Å; Q89-N92 PolarHBondContact OE1-ND2 2.88Å; N92-F96 VanDerWaalsContact O-CB 3.24Å; N92-F96 WeakPolarHBondContact O-CB 3.41Å; N92-F96 PolarHBondContact O-N 3.4Å
93	I	90.6	Very high	88.9	Confident	0 Å²	0	56.4 Å²	56.4	0%	0	28%	0.281	C	S	.	.	H	α-helix	trans	-67.4	-45.7	175.5	-65.2	161.8	0	0	0	110.3	I33 T45 V47 F67 L85 Q89 Q95 F96 L97	I33-I93 HydrophobicContact CD1-CB 4.17Å; I33-I93 HydrophobicContact CD1-CG2 3.64Å; I33-I93 HydrophobicContact CG1-CG2 4.15Å; I33-I93 HydrophobicContact CG2-CD1 4.46Å; T45-I93 HydrophobicContact CG2-CD1 3.51Å; V47-I93 HydrophobicContact CG2-CD1 3.91Å; V47-I93 HydrophobicContact CG2-CG2 3.89Å; F67-I93 HydrophobicContact CE2-CG1 3.84Å; F67-I93 HydrophobicContact CZ-CG1 4.41Å; L85-I93 HydrophobicContact CD1-CD1 3.52Å; L85-I93 HydrophobicContact CD1-CG1 3.91Å; Q89-I93 HydrophobicContact CB-CD1 3.78Å; Q89-I93 HydrophobicContact CB-CG1 4.06Å; Q89-I93 WeakPolarHBondContact O-CB 3.34Å; Q89-I93 WeakPolarHBondContact O-CD1 3.46Å; Q89-I93 VanDerWaalsContact O-CG1 3.26Å; Q89-I93 WeakPolarHBondContact O-CG1 3.35Å; Q89-I93 PolarHBondContact O-N 3.17Å; I93-Q95 VanDerWaalsContact C-N 3.34Å; I93-Q95 PolarHBondContact O-N 3.15Å; I93-F96 PolarHBondContact O-N 3.13Å; I93-L97 HydrophobicContact CG2-CD1 3.69Å; I93-L97 HydrophobicContact CG2-CG 4.19Å; I93-L97 WeakPolarHBondContact O-CB 3.45Å; I93-L97 VanDerWaalsContact O-CG 3.29Å; I93-L97 WeakPolarHBondContact O-CG 3.47Å; I93-L97 PolarHBondContact O-N 3.24Å
94	C	89.5	Confident	88.5	Confident	27 Å²	27	63.6 Å²	63.6	18%	0.182	31%	0.312	C	S	.	.	H	α-helix	trans	-55.3	-50.8	177.2	-172.9	0	0	0	0	110.9	I33 R90 K91 F96 L97 I98	I33-C94 HydrophobicContact CD1-CB 4.4Å; R90-C94 WeakPolarHBondContact O-CB 3.41Å; R90-C94 PolarHBondContact O-N 2.69Å; R90-C94 VanDerWaalsContact O-N 3.12Å; K91-C94 PolarHBondContact O-N 2.78Å; C94-F96 PolarHBondContact O-N 2.9Å; C94-L97 PolarHBondContact O-N 3.13Å; C94-I98 WeakPolarHBondContact O-CG1 3.45Å; C94-I98 PolarHBondContact O-N 2.74Å
95	Q	90.6	Very high	87.9	Confident	130 Å²	130	69 Å²	69	61%	0.607	34%	0.338	S	S	*	.	H	α-helix	trans	-62.3	-41.3	178.6	-172.3	172.8	13.2	0	0	112.6	K91 I93 I98 E99	K91-Q95 PolarHBondContact O-N 2.98Å; I93-Q95 VanDerWaalsContact C-N 3.34Å; I93-Q95 PolarHBondContact O-N 3.15Å; Q95-I98 PolarHBondContact O-N 2.84Å; Q95-E99 WeakPolarHBondContact O-CB 3.46Å; Q95-E99 PolarHBondContact O-N 2.79Å
96	F	90.7	Very high	87.3	Confident	13 Å²	13	76.6 Å²	76.6	6%	0.057	37%	0.373	C	S	.	.	H	α-helix	trans	-67.9	-36.7	-179.4	-178	-97.6	0	0	0	113.4	L59 A62 F63 K66 F67 N92 I93 C94 I98 E99 I100	L59-F96 HydrophobicContact CD1-CE1 4.41Å; A62-F96 HydrophobicContact CB-CZ 3.74Å; F63-F96 AromaticContact CD1-CD1 3.76Å; F63-F96 HydrophobicContact CD1-CD1 3.76Å; F63-F96 AromaticContact CD1-CE1 3.61Å; F63-F96 HydrophobicContact CD1-CE1 3.61Å; F63-F96 HydrophobicContact CD1-CG 4.38Å; F63-F96 HydrophobicContact CD1-CZ 4.21Å; F63-F96 AromaticContact CE1-CD1 3.16Å; F63-F96 HydrophobicContact CE1-CD1 3.16Å; F63-F96 AromaticContact CE1-CE1 3.32Å; F63-F96 HydrophobicContact CE1-CE1 3.32Å; F63-F96 HydrophobicContact CE1-CG 4.02Å; F63-F96 HydrophobicContact CE1-CZ 4.33Å; F63-F96 HydrophobicContact CZ-CD1 4.1Å; F63-F96 HydrophobicContact CZ-CE1 4.17Å; K66-F96 HydrophobicContact CD-CD2 3.35Å; K66-F96 HydrophobicContact CD-CE2 3.58Å; K66-F96 HydrophobicContact CD-CG 4.49Å; F67-F96 HydrophobicContact CE1-CB 4.38Å; F67-F96 HydrophobicContact CZ-CB 3.79Å; F67-F96 HydrophobicContact CZ-CD2 4.46Å; F67-F96 HydrophobicContact CZ-CG 4.1Å; N92-F96 VanDerWaalsContact O-CB 3.24Å; N92-F96 WeakPolarHBondContact O-CB 3.41Å; N92-F96 PolarHBondContact O-N 3.4Å; I93-F96 PolarHBondContact O-N 3.13Å; C94-F96 PolarHBondContact O-N 2.9Å; F96-I98 VanDerWaalsContact C-N 3.32Å; F96-E99 PolarHBondContact O-N 2.76Å; F96-I100 HydrophobicContact CD1-CD1 3.6Å; F96-I100 HydrophobicContact CD2-CD1 3.91Å; F96-I100 HydrophobicContact CE1-CD1 3.12Å; F96-I100 HydrophobicContact CE2-CD1 3.45Å; F96-I100 VanDerWaalsContact CE2-CD1 3.45Å; F96-I100 HydrophobicContact CG-CD1 4.04Å; F96-I100 HydrophobicContact CZ-CD1 3.05Å; F96-I100 HydrophobicContact CZ-CG1 4.46Å; F96-I100 PolarHBondContact O-N 3.16Å
97	L	88.1	Confident	87	Confident	0 Å²	0	75.4 Å²	75.4	0%	0	37%	0.368	C	S	.	.	H	α-helix	trans	-67.8	-36.1	178.5	-71.5	172.7	0	0	0	111.6	I31 I33 I93 C94 L102 L108	I31-L97 HydrophobicContact CD1-CD1 4.42Å; I31-L97 HydrophobicContact CG2-CD1 4.08Å; I33-L97 HydrophobicContact CD1-CD1 4.36Å; I93-L97 HydrophobicContact CG2-CD1 3.69Å; I93-L97 HydrophobicContact CG2-CG 4.19Å; I93-L97 WeakPolarHBondContact O-CB 3.45Å; I93-L97 VanDerWaalsContact O-CG 3.29Å; I93-L97 WeakPolarHBondContact O-CG 3.47Å; I93-L97 PolarHBondContact O-N 3.24Å; C94-L97 PolarHBondContact O-N 3.13Å; L97-L102 HydrophobicContact CD2-CB 4.3Å; L97-L102 HydrophobicContact CD2-CD2 3.67Å; L97-L102 HydrophobicContact CD2-CG 4.5Å; L97-L102 PolarHBondContact O-N 3.4Å; L97-L102 VanDerWaalsContact O-N 3.1Å; L97-L108 HydrophobicContact CB-CD1 4.29Å; L97-L108 HydrophobicContact CB-CD2 4.24Å; L97-L108 HydrophobicContact CD1-CD2 3.48Å; L97-L108 VanDerWaalsContact CD1-CD2 3.48Å
98	I	88.2	Confident	86.8	Confident	65 Å²	65	75 Å²	75	33%	0.333	36%	0.359	S	S	.	.	H	α-helix	trans	-68.5	-43.4	172.8	-63.7	166.8	0	0	0	110.5	C94 Q95 F96 I100 D101 E105 L108	C94-I98 WeakPolarHBondContact O-CG1 3.45Å; C94-I98 PolarHBondContact O-N 2.74Å; Q95-I98 PolarHBondContact O-N 2.84Å; F96-I98 VanDerWaalsContact C-N 3.32Å; I98-I100 VanDerWaalsContact C-N 3.26Å; I98-I100 PolarHBondContact O-N 2.99Å; I98-D101 PolarHBondContact O-N 3.46Å; I98-E105 HydrophobicContact CD1-CB 4.24Å; I98-E105 HydrophobicContact CD1-CG 4.29Å; I98-L108 HydrophobicContact CD1-CD1 4.16Å; I98-L108 HydrophobicContact CG1-CD1 3.83Å
99	E	88.7	Confident	86.8	Confident	119 Å²	119	76 Å²	76	56%	0.556	36%	0.361	S	S	*	.	H	α-helix	trans	-64.5	-26.9	-177.9	-172.3	-177.2	151.6	0	0	114	K66 Q95 F96 D101	K66-E99 IonicContact NZ-OE1 2.58Å; K66-E99 PolarHBondContact NZ-OE1 2.88Å; K66-E99 IonicContact NZ-OE2 2.7Å; K66-E99 PolarHBondContact NZ-OE2 2.86Å; Q95-E99 WeakPolarHBondContact O-CB 3.46Å; Q95-E99 PolarHBondContact O-N 2.79Å; F96-E99 PolarHBondContact O-N 2.76Å; E99-D101 VanDerWaalsContact C-N 3.33Å
100	I	84.9	Confident	86.9	Confident	85 Å²	85	78.1 Å²	78.1	44%	0.436	38%	0.375	S	S	.	.	T	Hydrogen-bonded Turn	trans	-92.1	0.4	177.6	-71.4	162.8	0	0	0	111.8	F96 I98 L102	F96-I100 HydrophobicContact CD1-CD1 3.6Å; F96-I100 HydrophobicContact CD2-CD1 3.91Å; F96-I100 HydrophobicContact CE1-CD1 3.12Å; F96-I100 HydrophobicContact CE2-CD1 3.45Å; F96-I100 VanDerWaalsContact CE2-CD1 3.45Å; F96-I100 HydrophobicContact CG-CD1 4.04Å; F96-I100 HydrophobicContact CZ-CD1 3.05Å; F96-I100 HydrophobicContact CZ-CG1 4.46Å; F96-I100 PolarHBondContact O-N 3.16Å; I98-I100 VanDerWaalsContact C-N 3.26Å; I98-I100 PolarHBondContact O-N 2.99Å; I100-L102 HydrophobicContact CG2-CB 4.23Å; I100-L102 PolarHBondContact O-N 2.98Å; I100-L102 VanDerWaalsContact O-N 3.15Å
101	D	81.5	Confident	86.7	Confident	148 Å²	148	77.4 Å²	77.4	79%	0.791	38%	0.375	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.2	29.2	-172.1	-76.5	-57.3	0	0	0	112.3	I98 E99	I98-D101 PolarHBondContact O-N 3.46Å; E99-D101 VanDerWaalsContact C-N 3.33Å
102	L	80.3	Confident	86.3	Confident	32 Å²	32	71.9 Å²	71.9	17%	0.168	36%	0.363	C	S	.	.	S	Bend	trans	-77.2	-30.5	179	-164.2	68.9	0	0	0	111.3	Y54 L59 L97 I100	Y54-L102 HydrophobicContact CD1-CD1 3.66Å; Y54-L102 HydrophobicContact CD2-CD1 4.12Å; Y54-L102 HydrophobicContact CE1-CD1 3.26Å; Y54-L102 HydrophobicContact CE2-CD1 3.77Å; Y54-L102 HydrophobicContact CG-CD1 4.07Å; L59-L102 HydrophobicContact CD1-CD2 4.13Å; L97-L102 HydrophobicContact CD2-CB 4.3Å; L97-L102 HydrophobicContact CD2-CD2 3.67Å; L97-L102 HydrophobicContact CD2-CG 4.5Å; L97-L102 PolarHBondContact O-N 3.4Å; L97-L102 VanDerWaalsContact O-N 3.1Å; I100-L102 HydrophobicContact CG2-CB 4.23Å; I100-L102 PolarHBondContact O-N 2.98Å; I100-L102 VanDerWaalsContact O-N 3.15Å
103	A	79.6	Confident	85.2	Confident	7 Å²	7	78.6 Å²	78.6	6%	0.058	39%	0.389	C	S	.	.	S	Bend	trans	-147.8	145.8	178.8	0	0	0	0	0	110.6	I31 L108	I31-A103 HydrophobicContact CD1-CB 3.66Å; A103-L108 HydrophobicContact CB-CD2 4.33Å; A103-L108 HydrophobicContact CB-CG 4.29Å
104	K	83.3	Confident	85	Confident	151 Å²	151	82.5 Å²	82.5	66%	0.657	41%	0.409	S	S	*	.			trans	-76.7	154	168.9	-62.5	-179.7	-177.1	174.9	0	109.7	E106 Q107	K104-E106 PolarHBondContact O-N 3.46Å; K104-E106 VanDerWaalsContact O-N 3.15Å; K104-Q107 VanDerWaalsContact N-OE1 3.09Å; K104-Q107 WeakPolarHBondContact O-CB 3.42Å; K104-Q107 PolarHBondContact O-N 3.19Å
105	E	79.6	Confident	84.7	Confident	150 Å²	150	85.4 Å²	85.4	70%	0.701	42%	0.421	S	S	*	.	G	3₁₀ helix	trans	-55.7	-34.2	178.8	-170.1	172.3	-175.7	0	0	112.4	I98 Q107 L108	I98-E105 HydrophobicContact CD1-CB 4.24Å; I98-E105 HydrophobicContact CD1-CG 4.29Å; E105-Q107 VanDerWaalsContact C-N 3.28Å; E105-Q107 PolarHBondContact O-N 2.79Å; E105-L108 PolarHBondContact O-N 3.01Å
106	E	83.1	Confident	84.4	Confident	159 Å²	159	82.9 Å²	82.9	74%	0.743	41%	0.41	S	S	*	.	G	3₁₀ helix	trans	-65.3	-29	178.7	-60.9	177.3	177.5	0	0	113.5	Y30 K104 L108	Y30-E106 WeakPolarHBondContact CE1-O 3.47Å; K104-E106 PolarHBondContact O-N 3.46Å; K104-E106 VanDerWaalsContact O-N 3.15Å; E106-L108 VanDerWaalsContact C-N 3.35Å
107	Q	84.5	Confident	84	Confident	68 Å²	68	87.1 Å²	87.1	32%	0.318	43%	0.431	S	S	.	.	G	3₁₀ helix	trans	-83.4	-12.7	-179.7	-65.2	175.3	-58	0	0	112.5	Y30 I31 K104 E105	Y30-Q107 WeakPolarHBondContact CA-O 3.2Å; Y30-Q107 WeakPolarHBondContact CD1-O 3.38Å; I31-Q107 PolarHBondContact N-O 3.42Å; K104-Q107 VanDerWaalsContact N-OE1 3.09Å; K104-Q107 WeakPolarHBondContact O-CB 3.42Å; K104-Q107 PolarHBondContact O-N 3.19Å; E105-Q107 VanDerWaalsContact C-N 3.28Å; E105-Q107 PolarHBondContact O-N 2.79Å
108	L	88.1	Confident	83.8	Confident	16 Å²	16	92.5 Å²	92.5	8%	0.084	46%	0.458	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.9	115.8	-178.2	-69.9	165.6	0	0	0	110.6	I31 I33 L97 I98 A103 E105 E106	I31-L108 HydrophobicContact CB-CD2 3.94Å; I31-L108 HydrophobicContact CG2-CD2 4.06Å; I33-L108 HydrophobicContact CD1-CD2 4.16Å; L97-L108 HydrophobicContact CB-CD1 4.29Å; L97-L108 HydrophobicContact CB-CD2 4.24Å; L97-L108 HydrophobicContact CD1-CD2 3.48Å; L97-L108 VanDerWaalsContact CD1-CD2 3.48Å; I98-L108 HydrophobicContact CD1-CD1 4.16Å; I98-L108 HydrophobicContact CG1-CD1 3.83Å; A103-L108 HydrophobicContact CB-CD2 4.33Å; A103-L108 HydrophobicContact CB-CG 4.29Å; E105-L108 PolarHBondContact O-N 3.01Å; E106-L108 VanDerWaalsContact C-N 3.35Å
109	K	89.9	Confident	83.5	Confident	89 Å²	89	94.3 Å²	94.3	39%	0.387	47%	0.466	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.1	104.5	175.1	-63.5	-61.2	-178.6	-168.2	0	109.7	Y30 I31 H32 I33	Y30-K109 HydrophobicContact CD1-CD 4.41Å; Y30-K109 HydrophobicContact CD1-CG 3.89Å; Y30-K109 HydrophobicContact CG-CG 4.19Å; I31-K109 PolarHBondContact O-N 3.21Å; H32-K109 WeakPolarHBondContact CA-O 3.24Å; H32-K109 WeakPolarHBondContact ND1-CB 3.39Å; I33-K109 PolarHBondContact N-O 3.13Å
110	V	90.8	Very high	83.1	Confident	68 Å²	68	92.6 Å²	92.6	41%	0.412	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89	113.6	177	-175.3	0	0	0	0	109.6	I33 R90	I33-V110 HydrophobicContact CD1-CG2 4.3Å; R90-V110 HydrophobicContact CB-CG1 3.95Å; R90-V110 HydrophobicContact CG-CG1 4.33Å
111	H	88.2	Confident	83	Confident	71 Å²	71	93.2 Å²	93.2	33%	0.329	46%	0.462	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.1	108.8	173.8	-58	-79.1	0	0	0	108.9	H32 I33 R34 I35	H32-H111 AromaticContact CE1-NE2 3.78Å; H32-H111 AromaticContact CG-NE2 3.77Å; H32-H111 AromaticContact ND1-CD2 3.78Å; H32-H111 AromaticContact ND1-NE2 2.98Å; H32-H111 PolarHBondContact ND1-NE2 2.69Å; I33-H111 PolarHBondContact O-N 2.82Å; R34-H111 HydrophobicContact CB-CB 4.44Å; R34-H111 HydrophobicContact CG-CB 4.03Å; I35-H111 PolarHBondContact N-O 2.83Å
112	G	81.1	Confident	83.1	Confident	42 Å²	42	88.6 Å²	88.6	43%	0.433	43%	0.434	S	S	.	.			trans	-102.7	166.8	173.4	0	0	0	0	0	112.1
113	F	68.9	Low	83.4	Confident	210 Å²	210	93.7 Å²	93.7	92%	0.921	46%	0.458	S	S	*	.			trans	-66.8	0	155.3	-76.5	-86.8	0	0	0	110.2	I35 Q37	I35-F113 HydrophobicContact CG2-CD2 3.7Å; I35-F113 HydrophobicContact CG2-CE2 4.1Å; Q37-F113 HydrophobicContact CB-CE2 4.38Å; Q37-F113 HydrophobicContact CB-CZ 4.34Å

Retrieved 113 of 113 residues in 362.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).