A0A090N7S9_HUMAN Loading...

Uncharacterized protein

AlphaFold DB (Q75MW2), UniProt , Accession A0A090N7S9, Species HUMAN (Homo sapiens, Human), Gene FLJ12700, Length 155 aa.

						>A0A090N7S9_HUMAN|A0A090N7S9|FLJ12700
MEEAAAAPISPWTMAATIQAMERKIESQAAHLLSLEGQTGMAEKKLADCEKTAVEFGNQLEGKWAVLGTLLQEYGLLQRRLENVENLLHNRNFWILRLPPGSKGESPKTTPSPSPRSSPRLNKGRSPATGAALTPRFQMFLWTPVQMQKLRPSRD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.6	Low	64.8	Low	243 Å²	243	127 Å²	127	100%	1.197	77%	0.772	S	S	*	*				0	105.5	0	-81.5	172.1	169.4	0	0	105.7	E3	M1-E3 PolarHBondContact O-N 3.2Å
2	E	51.5	Low	67.1	Low	201 Å²	201	134.7 Å²	134.7	94%	0.939	78%	0.777	S	S	*	*			trans	-82.1	94	-169.6	-161.8	166.2	161.4	0	0	108.8	A4	E2-A4 PolarHBondContact O-N 2.83Å
3	E	46.1	Very low	69.2	Low	180 Å²	180	130 Å²	130	84%	0.841	75%	0.752	S	S	*	*			trans	-73	106.6	171.6	-171.9	174.7	145.6	0	0	107.6	M1 A5	M1-E3 PolarHBondContact O-N 3.2Å; E3-A5 VanDerWaalsContact C-N 3.26Å; E3-A5 PolarHBondContact O-N 3.31Å
4	A	52.3	Low	71.1	Confident	99 Å²	99	128.9 Å²	128.9	82%	0.818	74%	0.738	S	S	*	*			trans	-65.9	87.1	175	0	0	0	0	0	109.5	E2 A6	E2-A4 PolarHBondContact O-N 2.83Å; A4-A6 PolarHBondContact O-N 3.08Å; A4-A6 VanDerWaalsContact O-N 3.08Å
5	A	50.6	Low	72.7	Confident	90 Å²	90	123.7 Å²	123.7	74%	0.744	72%	0.718	S	S	*	*			trans	-63.5	107.5	172	0	0	0	0	0	109	E3 A7	E3-A5 VanDerWaalsContact C-N 3.26Å; E3-A5 PolarHBondContact O-N 3.31Å; A5-A7 PolarHBondContact O-N 3.05Å
6	A	59.6	Low	74.1	Confident	99 Å²	99	119.4 Å²	119.4	82%	0.818	70%	0.701	S	S	*	*			trans	-59.8	110.2	170.4	0	0	0	0	0	108.7	A4	A4-A6 PolarHBondContact O-N 3.08Å; A4-A6 VanDerWaalsContact O-N 3.08Å
7	A	68	Low	75.4	Confident	81 Å²	81	116.7 Å²	116.7	67%	0.669	69%	0.686	S	S	*	*	P	Polyproline II helix	trans	-57.6	139.4	177.6	0	0	0	0	0	110.3	A5 I9	A5-A7 PolarHBondContact O-N 3.05Å; A7-I9 PolarHBondContact O-N 3.22Å
8	P	73.4	Confident	76.6	Confident	128 Å²	128	114.9 Å²	114.9	83%	0.831	67%	0.672	S	S	*	*	P	Polyproline II helix	trans	-57.9	124.2	179	23.3	-32.3	0	0	0	109.8	S10	P8-S10 PolarHBondContact O-N 3.18Å
9	I	79	Confident	77.6	Confident	132 Å²	132	115.1 Å²	115.1	68%	0.677	67%	0.666	S	S	*	*	P	Polyproline II helix	trans	-61.2	122.1	-179	-60.4	164.9	0	0	0	108.1	A7 T13 M14	A7-I9 PolarHBondContact O-N 3.22Å; I9-T13 HydrophobicContact CG2-CG2 4.17Å; I9-M14 HydrophobicContact CG2-CB 4.43Å
10	S	88.5	Confident	78.6	Confident	45 Å²	45	112.5 Å²	112.5	32%	0.315	66%	0.659	S	S	.	*	P	Polyproline II helix	trans	-67.3	145.2	178.9	85.2	0	0	0	0	110.6	P8 W12 T13 M14	P8-S10 PolarHBondContact O-N 3.18Å; S10-W12 PolarHBondContact O-N 2.99Å; S10-W12 VanDerWaalsContact O-N 3.15Å; S10-T13 WeakPolarHBondContact O-CB 3.39Å; S10-T13 PolarHBondContact O-N 3.15Å; S10-T13 PolarHBondContact OG-N 3.08Å; S10-T13 VanDerWaalsContact OG-N 3.08Å; S10-T13 PolarHBondContact OG-OG1 3.21Å; S10-M14 PolarHBondContact O-N 2.75Å; S10-M14 VanDerWaalsContact O-N 3.08Å
11	P	91.7	Very high	79.5	Confident	99 Å²	99	112.5 Å²	112.5	64%	0.643	65%	0.654	S	S	*	*	H	α-helix	trans	-53.9	-34.3	175.2	-27.6	34.9	0	0	0	113.3	M14 A15	P11-M14 PolarHBondContact O-N 3.08Å; P11-A15 PolarHBondContact O-N 2.93Å
12	W	93.1	Very high	81.7	Confident	219 Å²	219	105.9 Å²	105.9	83%	0.83	62%	0.62	S	S	*	*	H	α-helix	trans	-65.8	-40.7	175.3	-64.6	102.4	0	0	0	112.7	S10 M14 A15 A16	S10-W12 PolarHBondContact O-N 2.99Å; S10-W12 VanDerWaalsContact O-N 3.15Å; W12-M14 VanDerWaalsContact C-N 3.33Å; W12-A15 PolarHBondContact O-N 3.47Å; W12-A16 WeakPolarHBondContact O-CB 3.43Å; W12-A16 PolarHBondContact O-N 2.93Å
13	T	94.2	Very high	83.9	Confident	74 Å²	74	104.6 Å²	104.6	45%	0.454	61%	0.607	S	S	.	*	H	α-helix	trans	-63.5	-40.2	174.6	-53.2	0	0	0	0	111.3	I9 S10 A16 T17	I9-T13 HydrophobicContact CG2-CG2 4.17Å; S10-T13 WeakPolarHBondContact O-CB 3.39Å; S10-T13 PolarHBondContact O-N 3.15Å; S10-T13 PolarHBondContact OG-N 3.08Å; S10-T13 VanDerWaalsContact OG-N 3.08Å; S10-T13 PolarHBondContact OG-OG1 3.21Å; T13-A16 PolarHBondContact O-N 3.46Å; T13-T17 PolarHBondContact O-N 3.37Å; T13-T17 PolarHBondContact O-OG1 3.45Å
14	M	95.3	Very high	86.3	Confident	114 Å²	114	102.1 Å²	102.1	56%	0.562	59%	0.593	S	S	*	*	H	α-helix	trans	-65.6	-45.2	176.5	-167.2	169.3	63.8	0	0	111.3	I9 S10 P11 W12 A16 T17 I18	I9-M14 HydrophobicContact CG2-CB 4.43Å; S10-M14 PolarHBondContact O-N 2.75Å; S10-M14 VanDerWaalsContact O-N 3.08Å; P11-M14 PolarHBondContact O-N 3.08Å; W12-M14 VanDerWaalsContact C-N 3.33Å; M14-A16 PolarHBondContact O-N 3.39Å; M14-T17 PolarHBondContact O-N 2.94Å; M14-I18 HydrophobicContact CG-CD1 4.27Å; M14-I18 WeakPolarHBondContact O-CG1 3.36Å; M14-I18 PolarHBondContact O-N 2.99Å
15	A	95.6	Very high	88.5	Confident	52 Å²	52	102.2 Å²	102.2	43%	0.43	58%	0.579	S	S	.	*	H	α-helix	trans	-60.5	-43.1	175.3	0	0	0	0	0	112.4	P11 W12 T17 I18 Q19	P11-A15 PolarHBondContact O-N 2.93Å; W12-A15 PolarHBondContact O-N 3.47Å; A15-T17 VanDerWaalsContact C-N 3.32Å; A15-T17 PolarHBondContact O-N 3.1Å; A15-I18 PolarHBondContact O-N 3.47Å; A15-Q19 WeakPolarHBondContact O-CB 3.3Å; A15-Q19 PolarHBondContact O-N 2.95Å
16	A	95.4	Very high	90.7	Very high	54 Å²	54	103.7 Å²	103.7	45%	0.446	57%	0.57	S	S	.	*	H	α-helix	trans	-63.6	-37.8	176.1	0	0	0	0	0	112.3	W12 T13 M14 Q19 A20	W12-A16 WeakPolarHBondContact O-CB 3.43Å; W12-A16 PolarHBondContact O-N 2.93Å; T13-A16 PolarHBondContact O-N 3.46Å; M14-A16 PolarHBondContact O-N 3.39Å; A16-Q19 PolarHBondContact O-N 2.96Å; A16-A20 WeakPolarHBondContact O-CB 3.33Å; A16-A20 PolarHBondContact O-N 2.8Å
17	T	96	Very high	92.5	Very high	74 Å²	74	102.3 Å²	102.3	45%	0.454	56%	0.555	S	S	.	*	H	α-helix	trans	-66.2	-44.2	175.8	-54.8	0	0	0	0	111.2	T13 M14 A15 A20 M21	T13-T17 PolarHBondContact O-N 3.37Å; T13-T17 PolarHBondContact O-OG1 3.45Å; M14-T17 PolarHBondContact O-N 2.94Å; A15-T17 VanDerWaalsContact C-N 3.32Å; A15-T17 PolarHBondContact O-N 3.1Å; T17-A20 PolarHBondContact O-N 3.06Å; T17-M21 HydrophobicContact CG2-SD 4.32Å; T17-M21 VanDerWaalsContact O-CG 3.3Å; T17-M21 WeakPolarHBondContact O-CG 3.49Å; T17-M21 PolarHBondContact O-N 2.84Å
18	I	96.2	Very high	93.9	Very high	85 Å²	85	103.4 Å²	103.4	44%	0.436	55%	0.546	S	S	.	.	H	α-helix	trans	-59.8	-48.4	175.4	-67.6	164.8	0	0	0	109.9	M14 A15 A20 M21 E22	M14-I18 HydrophobicContact CG-CD1 4.27Å; M14-I18 WeakPolarHBondContact O-CG1 3.36Å; M14-I18 PolarHBondContact O-N 2.99Å; A15-I18 PolarHBondContact O-N 3.47Å; I18-A20 VanDerWaalsContact C-N 3.32Å; I18-A20 PolarHBondContact O-N 3.4Å; I18-M21 CarbonylContact O-C 3.57Å; I18-M21 WeakPolarHBondContact O-CA 3.43Å; I18-M21 WeakPolarHBondContact O-CB 3.4Å; I18-M21 PolarHBondContact O-N 3.32Å; I18-E22 HydrophobicContact CG2-CG 4.39Å; I18-E22 WeakPolarHBondContact O-CG 3.47Å; I18-E22 PolarHBondContact O-N 3.05Å
19	Q	97	Very high	95.1	Very high	117 Å²	117	99.5 Å²	99.5	55%	0.547	52%	0.524	S	S	.	.	H	α-helix	trans	-61.7	-38.9	179.2	-172.3	175.9	46	0	0	112.5	A15 A16 M21 E22 R23	A15-Q19 WeakPolarHBondContact O-CB 3.3Å; A15-Q19 PolarHBondContact O-N 2.95Å; A16-Q19 PolarHBondContact O-N 2.96Å; Q19-M21 VanDerWaalsContact C-N 3.33Å; Q19-E22 PolarHBondContact O-N 3.36Å; Q19-R23 WeakPolarHBondContact O-CG 3.31Å; Q19-R23 PolarHBondContact O-N 3.31Å
20	A	96.7	Very high	95.9	Very high	64 Å²	64	96.2 Å²	96.2	53%	0.529	52%	0.517	S	S	.	.	H	α-helix	trans	-65.1	-37.4	174.3	0	0	0	0	0	112	A16 T17 I18 K24	A16-A20 WeakPolarHBondContact O-CB 3.33Å; A16-A20 PolarHBondContact O-N 2.8Å; T17-A20 PolarHBondContact O-N 3.06Å; I18-A20 VanDerWaalsContact C-N 3.32Å; I18-A20 PolarHBondContact O-N 3.4Å; A20-K24 WeakPolarHBondContact O-CB 3.41Å; A20-K24 PolarHBondContact O-N 2.9Å; A20-K24 VanDerWaalsContact O-N 3.1Å
21	M	98	Very high	96.4	Very high	112 Å²	112	99.6 Å²	99.6	55%	0.552	53%	0.528	S	S	*	.	H	α-helix	trans	-67.4	-42.2	174.1	-70.4	176.3	68.8	0	0	111.9	T17 I18 Q19 K24 I25	T17-M21 HydrophobicContact CG2-SD 4.32Å; T17-M21 VanDerWaalsContact O-CG 3.3Å; T17-M21 WeakPolarHBondContact O-CG 3.49Å; T17-M21 PolarHBondContact O-N 2.84Å; I18-M21 CarbonylContact O-C 3.57Å; I18-M21 WeakPolarHBondContact O-CA 3.43Å; I18-M21 WeakPolarHBondContact O-CB 3.4Å; I18-M21 PolarHBondContact O-N 3.32Å; Q19-M21 VanDerWaalsContact C-N 3.33Å; M21-K24 WeakPolarHBondContact O-CB 3.47Å; M21-K24 PolarHBondContact O-N 3.14Å; M21-K24 VanDerWaalsContact O-N 3.17Å; M21-I25 VanDerWaalsContact O-CG1 3.29Å; M21-I25 WeakPolarHBondContact O-CG1 3.35Å; M21-I25 PolarHBondContact O-N 3.29Å
22	E	97.6	Very high	96.6	Very high	104 Å²	104	100.2 Å²	100.2	49%	0.486	53%	0.525	S	S	.	.	H	α-helix	trans	-57.7	-49.7	175.3	-72.6	172.8	163.6	0	0	111.2	I18 Q19 K24 I25 E26	I18-E22 HydrophobicContact CG2-CG 4.39Å; I18-E22 WeakPolarHBondContact O-CG 3.47Å; I18-E22 PolarHBondContact O-N 3.05Å; Q19-E22 PolarHBondContact O-N 3.36Å; E22-K24 VanDerWaalsContact C-N 3.27Å; E22-K24 PolarHBondContact O-N 3.28Å; E22-I25 PolarHBondContact O-N 3.06Å; E22-I25 VanDerWaalsContact O-N 3.14Å; E22-E26 WeakPolarHBondContact O-CG 3.49Å; E22-E26 PolarHBondContact O-N 2.7Å
23	R	97.2	Very high	96.9	Very high	174 Å²	174	95.4 Å²	95.4	66%	0.657	52%	0.515	S	S	*	.	H	α-helix	trans	-58.1	-39	175.6	-71.2	-74	-173.8	150.6	0.1	112.5	Q19 S27	Q19-R23 WeakPolarHBondContact O-CG 3.31Å; Q19-R23 PolarHBondContact O-N 3.31Å; R23-S27 PolarHBondContact O-N 2.87Å
24	K	97.7	Very high	97	Very high	128 Å²	128	95.1 Å²	95.1	56%	0.557	52%	0.516	S	S	*	.	H	α-helix	trans	-67.3	-44.2	176.9	-171.5	176.1	179.1	-179.9	0	111.1	A20 M21 E22 S27 Q28	A20-K24 WeakPolarHBondContact O-CB 3.41Å; A20-K24 PolarHBondContact O-N 2.9Å; A20-K24 VanDerWaalsContact O-N 3.1Å; M21-K24 WeakPolarHBondContact O-CB 3.47Å; M21-K24 PolarHBondContact O-N 3.14Å; M21-K24 VanDerWaalsContact O-N 3.17Å; E22-K24 VanDerWaalsContact C-N 3.27Å; E22-K24 PolarHBondContact O-N 3.28Å; K24-S27 PolarHBondContact O-N 2.92Å; K24-S27 PolarHBondContact O-OG 3.15Å; K24-Q28 WeakPolarHBondContact O-CB 3.29Å; K24-Q28 VanDerWaalsContact O-CG 3.31Å; K24-Q28 WeakPolarHBondContact O-CG 3.42Å; K24-Q28 PolarHBondContact O-N 3.17Å
25	I	97.8	Very high	97.1	Very high	102 Å²	102	92.9 Å²	92.9	52%	0.523	51%	0.506	S	S	.	.	H	α-helix	trans	-61.7	-45.1	177.2	-69	164	0	0	0	110.5	M21 E22 S27 Q28 A29	M21-I25 VanDerWaalsContact O-CG1 3.29Å; M21-I25 WeakPolarHBondContact O-CG1 3.35Å; M21-I25 PolarHBondContact O-N 3.29Å; E22-I25 PolarHBondContact O-N 3.06Å; E22-I25 VanDerWaalsContact O-N 3.14Å; I25-S27 VanDerWaalsContact C-N 3.34Å; I25-S27 PolarHBondContact O-N 2.9Å; I25-Q28 PolarHBondContact O-N 3.41Å; I25-A29 WeakPolarHBondContact O-CB 3.3Å; I25-A29 PolarHBondContact O-N 3.47Å
26	E	97.4	Very high	97.2	Very high	120 Å²	120	96.8 Å²	96.8	56%	0.561	52%	0.515	S	S	*	.	H	α-helix	trans	-58.8	-44.4	175.6	-72.1	172	179.4	0	0	111.8	E22 Q28 A29 A30	E22-E26 WeakPolarHBondContact O-CG 3.49Å; E22-E26 PolarHBondContact O-N 2.7Å; E26-Q28 VanDerWaalsContact C-N 3.34Å; E26-Q28 PolarHBondContact O-N 3.36Å; E26-A29 PolarHBondContact O-N 2.99Å; E26-A30 PolarHBondContact O-N 3.34Å
27	S	96.4	Very high	97.2	Very high	71 Å²	71	96.6 Å²	96.6	50%	0.497	52%	0.518	S	S	.	.	H	α-helix	trans	-64.3	-38.1	176.5	76.1	0	0	0	0	112.6	R23 K24 I25 H31	R23-S27 PolarHBondContact O-N 2.87Å; K24-S27 PolarHBondContact O-N 2.92Å; K24-S27 PolarHBondContact O-OG 3.15Å; I25-S27 VanDerWaalsContact C-N 3.34Å; I25-S27 PolarHBondContact O-N 2.9Å; S27-H31 WeakPolarHBondContact O-CB 3.42Å; S27-H31 PolarHBondContact O-N 2.82Å
28	Q	98.1	Very high	97.3	Very high	103 Å²	103	98.2 Å²	98.2	48%	0.481	52%	0.521	S	S	.	.	H	α-helix	trans	-69.8	-39.1	176.9	-73.8	-179.4	-47.6	0	0	111.4	K24 I25 E26 H31 L32	K24-Q28 WeakPolarHBondContact O-CB 3.29Å; K24-Q28 VanDerWaalsContact O-CG 3.31Å; K24-Q28 WeakPolarHBondContact O-CG 3.42Å; K24-Q28 PolarHBondContact O-N 3.17Å; I25-Q28 PolarHBondContact O-N 3.41Å; E26-Q28 VanDerWaalsContact C-N 3.34Å; E26-Q28 PolarHBondContact O-N 3.36Å; Q28-H31 PolarHBondContact O-N 2.86Å; Q28-L32 WeakPolarHBondContact O-CB 3.33Å; Q28-L32 VanDerWaalsContact O-CG 3.3Å; Q28-L32 WeakPolarHBondContact O-CG 3.41Å; Q28-L32 PolarHBondContact O-N 3.02Å
29	A	97.7	Very high	97.3	Very high	46 Å²	46	97.7 Å²	97.7	38%	0.38	52%	0.522	S	S	.	.	H	α-helix	trans	-63.4	-44.4	175.1	0	0	0	0	0	111.5	I25 E26 H31 L32 L33	I25-A29 WeakPolarHBondContact O-CB 3.3Å; I25-A29 PolarHBondContact O-N 3.47Å; E26-A29 PolarHBondContact O-N 2.99Å; A29-H31 VanDerWaalsContact C-N 3.35Å; A29-H31 PolarHBondContact O-N 3.47Å; A29-L32 PolarHBondContact O-N 3.19Å; A29-L33 WeakPolarHBondContact O-CG 3.5Å; A29-L33 PolarHBondContact O-N 3.21Å
30	A	97.1	Very high	97.3	Very high	63 Å²	63	93.8 Å²	93.8	52%	0.521	51%	0.513	S	S	.	.	H	α-helix	trans	-62.3	-41.4	175.3	0	0	0	0	0	112.3	E26 L33 S34	E26-A30 PolarHBondContact O-N 3.34Å; A30-L33 PolarHBondContact O-N 2.95Å; A30-S34 PolarHBondContact O-N 2.96Å; A30-S34 VanDerWaalsContact O-N 3.09Å
31	H	97.3	Very high	97.3	Very high	117 Å²	117	96.3 Å²	96.3	54%	0.542	52%	0.515	S	S	.	.	H	α-helix	trans	-65.1	-42.4	175.7	-178.5	-98.9	0	0	0	112.2	S27 Q28 A29 S34 L35	S27-H31 WeakPolarHBondContact O-CB 3.42Å; S27-H31 PolarHBondContact O-N 2.82Å; Q28-H31 PolarHBondContact O-N 2.86Å; A29-H31 VanDerWaalsContact C-N 3.35Å; A29-H31 PolarHBondContact O-N 3.47Å; H31-S34 PolarHBondContact O-N 3.39Å; H31-L35 WeakPolarHBondContact CE1-CD1 3.42Å; H31-L35 WeakPolarHBondContact O-CG 3.39Å; H31-L35 PolarHBondContact O-N 2.83Å
32	L	97.9	Very high	97.2	Very high	111 Å²	111	93.8 Å²	93.8	58%	0.581	51%	0.512	S	S	*	.	H	α-helix	trans	-61.7	-44.3	175.6	-76.6	172.9	0	0	0	111.8	Q28 A29 S34 L35 E36	Q28-L32 WeakPolarHBondContact O-CB 3.33Å; Q28-L32 VanDerWaalsContact O-CG 3.3Å; Q28-L32 WeakPolarHBondContact O-CG 3.41Å; Q28-L32 PolarHBondContact O-N 3.02Å; A29-L32 PolarHBondContact O-N 3.19Å; L32-S34 VanDerWaalsContact C-N 3.32Å; L32-S34 PolarHBondContact O-N 3.41Å; L32-L35 PolarHBondContact O-N 3.47Å; L32-E36 WeakPolarHBondContact O-CB 3.34Å; L32-E36 PolarHBondContact O-N 3.43Å
33	L	97.5	Very high	97.2	Very high	119 Å²	119	94.9 Å²	94.9	62%	0.623	52%	0.517	S	S	*	.	H	α-helix	trans	-60.4	-40.6	175.8	-74.6	170.3	0	0	0	112.2	A29 A30 E36 G37	A29-L33 WeakPolarHBondContact O-CG 3.5Å; A29-L33 PolarHBondContact O-N 3.21Å; A30-L33 PolarHBondContact O-N 2.95Å; L33-E36 PolarHBondContact O-N 3.32Å; L33-G37 PolarHBondContact O-N 3.3Å
34	S	97.1	Very high	97.2	Very high	68 Å²	68	93.5 Å²	93.5	48%	0.476	52%	0.516	S	S	.	.	H	α-helix	trans	-64.3	-44.5	174.9	-178.2	0	0	0	0	111.9	A30 H31 L32 E36 G37 Q38	A30-S34 PolarHBondContact O-N 2.96Å; A30-S34 VanDerWaalsContact O-N 3.09Å; H31-S34 PolarHBondContact O-N 3.39Å; L32-S34 VanDerWaalsContact C-N 3.32Å; L32-S34 PolarHBondContact O-N 3.41Å; S34-E36 VanDerWaalsContact C-N 3.34Å; S34-G37 PolarHBondContact O-N 3.3Å; S34-Q38 WeakPolarHBondContact O-CG 3.4Å; S34-Q38 PolarHBondContact O-N 3.09Å
35	L	97.8	Very high	97.2	Very high	67 Å²	67	93.6 Å²	93.6	35%	0.351	52%	0.516	S	S	.	.	H	α-helix	trans	-64.6	-38.5	177.3	-78	179.9	0	0	0	112.1	H31 L32 Q38 T39	H31-L35 WeakPolarHBondContact CE1-CD1 3.42Å; H31-L35 WeakPolarHBondContact O-CG 3.39Å; H31-L35 PolarHBondContact O-N 2.83Å; L32-L35 PolarHBondContact O-N 3.47Å; L35-Q38 PolarHBondContact O-N 2.79Å; L35-T39 VanDerWaalsContact O-CB 3.3Å; L35-T39 WeakPolarHBondContact O-CB 3.37Å; L35-T39 PolarHBondContact O-N 3.48Å; L35-T39 PolarHBondContact O-OG1 2.95Å
36	E	97.3	Very high	97.2	Very high	134 Å²	134	93.5 Å²	93.5	63%	0.626	52%	0.516	S	S	*	.	H	α-helix	trans	-63	-44.6	176.3	-173.4	173.8	-169	0	0	110.8	L32 L33 S34 Q38 T39 G40	L32-E36 WeakPolarHBondContact O-CB 3.34Å; L32-E36 PolarHBondContact O-N 3.43Å; L33-E36 PolarHBondContact O-N 3.32Å; S34-E36 VanDerWaalsContact C-N 3.34Å; E36-Q38 PolarHBondContact O-N 2.92Å; E36-T39 PolarHBondContact O-N 3.33Å; E36-G40 PolarHBondContact O-N 3.4Å
37	G	96.2	Very high	97.2	Very high	49 Å²	49	90.2 Å²	90.2	51%	0.505	51%	0.51	S	S	.	.	H	α-helix	trans	-62	-42.2	173.4	0	0	0	0	0	113.3	L33 S34 T39 M41	L33-G37 PolarHBondContact O-N 3.3Å; S34-G37 PolarHBondContact O-N 3.3Å; G37-T39 VanDerWaalsContact C-N 3.35Å; G37-M41 PolarHBondContact O-N 3.25Å
38	Q	96.7	Very high	97.2	Very high	109 Å²	109	90.5 Å²	90.5	51%	0.509	51%	0.505	S	S	.	.	H	α-helix	trans	-64.6	-39.2	174.7	-75.3	-177.3	-32.4	0	0	112.2	S34 L35 E36 M41 A42	S34-Q38 WeakPolarHBondContact O-CG 3.4Å; S34-Q38 PolarHBondContact O-N 3.09Å; L35-Q38 PolarHBondContact O-N 2.79Å; E36-Q38 PolarHBondContact O-N 2.92Å; Q38-M41 PolarHBondContact O-N 3.38Å; Q38-A42 WeakPolarHBondContact O-CB 3.45Å; Q38-A42 PolarHBondContact O-N 3.07Å
39	T	97.2	Very high	97.2	Very high	74 Å²	74	89.5 Å²	89.5	45%	0.454	51%	0.509	S	S	.	.	H	α-helix	trans	-65.9	-48.1	178.5	-57.6	0	0	0	0	110.4	L35 E36 G37 M41 A42 E43	L35-T39 VanDerWaalsContact O-CB 3.3Å; L35-T39 WeakPolarHBondContact O-CB 3.37Å; L35-T39 PolarHBondContact O-N 3.48Å; L35-T39 PolarHBondContact O-OG1 2.95Å; E36-T39 PolarHBondContact O-N 3.33Å; G37-T39 VanDerWaalsContact C-N 3.35Å; T39-M41 VanDerWaalsContact C-N 3.28Å; T39-M41 PolarHBondContact O-N 2.89Å; T39-A42 WeakPolarHBondContact O-CB 3.3Å; T39-A42 PolarHBondContact O-N 2.7Å; T39-E43 WeakPolarHBondContact O-CG 3.47Å; T39-E43 PolarHBondContact O-N 2.96Å
40	G	95.8	Very high	97.1	Very high	35 Å²	35	93.1 Å²	93.1	36%	0.361	52%	0.518	S	S	.	.	H	α-helix	trans	-60.9	-35.2	175.7	0	0	0	0	0	113.2	E36 K44	E36-G40 PolarHBondContact O-N 3.4Å; G40-K44 PolarHBondContact O-N 3.06Å; G40-K44 VanDerWaalsContact O-N 3.09Å
41	M	96.8	Very high	97.2	Very high	117 Å²	117	96.3 Å²	96.3	58%	0.576	52%	0.52	S	S	*	.	H	α-helix	trans	-66.4	-43.7	172	-178.5	179	62.4	0	0	112	G37 Q38 T39 E43 K44 K45	G37-M41 PolarHBondContact O-N 3.25Å; Q38-M41 PolarHBondContact O-N 3.38Å; T39-M41 VanDerWaalsContact C-N 3.28Å; T39-M41 PolarHBondContact O-N 2.89Å; M41-E43 VanDerWaalsContact C-N 3.34Å; M41-K44 PolarHBondContact O-N 3.46Å; M41-K45 WeakPolarHBondContact O-CG 3.5Å; M41-K45 PolarHBondContact O-N 3.23Å
42	A	97.1	Very high	97.2	Very high	59 Å²	59	93.8 Å²	93.8	49%	0.488	51%	0.513	S	S	.	.	H	α-helix	trans	-63.7	-39.6	177.5	0	0	0	0	0	111.8	Q38 T39 K45 L46	Q38-A42 WeakPolarHBondContact O-CB 3.45Å; Q38-A42 PolarHBondContact O-N 3.07Å; T39-A42 WeakPolarHBondContact O-CB 3.3Å; T39-A42 PolarHBondContact O-N 2.7Å; A42-K45 WeakPolarHBondContact O-CB 3.41Å; A42-K45 PolarHBondContact O-N 3.31Å; A42-L46 PolarHBondContact O-N 3.09Å
43	E	97.3	Very high	97.1	Very high	127 Å²	127	91.3 Å²	91.3	59%	0.593	51%	0.509	S	S	*	.	H	α-helix	trans	-60.8	-43.6	173.5	-73.5	175.8	171.8	0	0	111.8	T39 M41 K45 L46 A47	T39-E43 WeakPolarHBondContact O-CG 3.47Å; T39-E43 PolarHBondContact O-N 2.96Å; M41-E43 VanDerWaalsContact C-N 3.34Å; E43-K45 VanDerWaalsContact C-N 3.33Å; E43-K45 PolarHBondContact O-N 3.06Å; E43-L46 WeakPolarHBondContact O-CB 3.45Å; E43-L46 PolarHBondContact O-N 3.2Å; E43-A47 PolarHBondContact O-N 3.31Å
44	K	97.1	Very high	97.1	Very high	144 Å²	144	90 Å²	90	63%	0.626	51%	0.505	S	S	*	.	H	α-helix	trans	-61.2	-42	174.4	-176	174.7	179.8	173.5	0	112	G40 M41 L46 A47 D48	G40-K44 PolarHBondContact O-N 3.06Å; G40-K44 VanDerWaalsContact O-N 3.09Å; M41-K44 PolarHBondContact O-N 3.46Å; K44-L46 VanDerWaalsContact C-N 3.33Å; K44-A47 PolarHBondContact O-N 3.04Å; K44-D48 PolarHBondContact O-N 3.44Å
45	K	97.5	Very high	97.1	Very high	130 Å²	130	91.1 Å²	91.1	57%	0.565	50%	0.503	S	S	*	.	H	α-helix	trans	-63.8	-38.5	175.5	-68.3	-64.1	-175.7	-175.8	0	112	M41 A42 E43 D48 C49	M41-K45 WeakPolarHBondContact O-CG 3.5Å; M41-K45 PolarHBondContact O-N 3.23Å; A42-K45 WeakPolarHBondContact O-CB 3.41Å; A42-K45 PolarHBondContact O-N 3.31Å; E43-K45 VanDerWaalsContact C-N 3.33Å; E43-K45 PolarHBondContact O-N 3.06Å; K45-D48 PolarHBondContact O-N 3.3Å; K45-C49 WeakPolarHBondContact O-CB 3.37Å; K45-C49 PolarHBondContact O-N 2.95Å; K45-C49 PolarHBondContact O-SG 3.37Å
46	L	97.4	Very high	97	Very high	100 Å²	100	94.2 Å²	94.2	52%	0.524	51%	0.514	S	S	.	.	H	α-helix	trans	-62.6	-47.6	174.9	-173.3	158.1	0	0	0	110.8	A42 E43 K44 D48 C49 E50	A42-L46 PolarHBondContact O-N 3.09Å; E43-L46 WeakPolarHBondContact O-CB 3.45Å; E43-L46 PolarHBondContact O-N 3.2Å; K44-L46 VanDerWaalsContact C-N 3.33Å; L46-D48 PolarHBondContact O-N 2.89Å; L46-C49 WeakPolarHBondContact O-CB 3.49Å; L46-C49 PolarHBondContact O-N 3.36Å; L46-C49 VanDerWaalsContact O-N 3.15Å; L46-E50 HydrophobicContact CD2-CG 3.96Å; L46-E50 WeakPolarHBondContact CD2-OE1 3.39Å; L46-E50 PolarHBondContact O-N 3.25Å
47	A	97.5	Very high	96.9	Very high	51 Å²	51	89.6 Å²	89.6	42%	0.421	50%	0.502	S	S	.	.	H	α-helix	trans	-62.1	-40.4	177.5	0	0	0	0	0	112.6	E43 K44 E50 K51	E43-A47 PolarHBondContact O-N 3.31Å; K44-A47 PolarHBondContact O-N 3.04Å; A47-E50 PolarHBondContact O-N 3.45Å; A47-K51 WeakPolarHBondContact O-CB 3.35Å; A47-K51 PolarHBondContact O-N 2.92Å
48	D	97.6	Very high	96.9	Very high	77 Å²	77	92.5 Å²	92.5	41%	0.412	51%	0.506	S	S	.	.	H	α-helix	trans	-61.6	-44	173.3	-72.6	-25.7	0	0	0	110.9	K44 K45 L46 K51 T52	K44-D48 PolarHBondContact O-N 3.44Å; K45-D48 PolarHBondContact O-N 3.3Å; L46-D48 PolarHBondContact O-N 2.89Å; D48-K51 PolarHBondContact O-N 2.85Å; D48-T52 WeakPolarHBondContact O-CG2 3.39Å; D48-T52 PolarHBondContact O-N 2.9Å; D48-T52 PolarHBondContact O-OG1 3.35Å
49	C	96.4	Very high	97	Very high	83 Å²	83	92.7 Å²	92.7	56%	0.561	51%	0.507	S	S	*	.	H	α-helix	trans	-60.7	-46.1	174.9	-75	0	0	0	0	112.1	K45 L46 K51 T52 A53	K45-C49 WeakPolarHBondContact O-CB 3.37Å; K45-C49 PolarHBondContact O-N 2.95Å; K45-C49 PolarHBondContact O-SG 3.37Å; L46-C49 WeakPolarHBondContact O-CB 3.49Å; L46-C49 PolarHBondContact O-N 3.36Å; L46-C49 VanDerWaalsContact O-N 3.15Å; C49-K51 VanDerWaalsContact C-N 3.34Å; C49-K51 PolarHBondContact O-N 2.75Å; C49-T52 WeakPolarHBondContact CA-OG1 3.47Å; C49-T52 PolarHBondContact O-N 3.43Å; C49-T52 PolarHBondContact O-OG1 3.44Å; C49-A53 WeakPolarHBondContact O-CB 3.47Å; C49-A53 PolarHBondContact O-N 2.87Å
50	E	97.3	Very high	97	Very high	121 Å²	121	93.5 Å²	93.5	57%	0.565	51%	0.508	S	S	*	.	H	α-helix	trans	-58.7	-45.2	175.9	-74.5	-178.2	162.8	0	0	111.7	L46 A47 T52 A53 V54	L46-E50 HydrophobicContact CD2-CG 3.96Å; L46-E50 WeakPolarHBondContact CD2-OE1 3.39Å; L46-E50 PolarHBondContact O-N 3.25Å; A47-E50 PolarHBondContact O-N 3.45Å; E50-T52 PolarHBondContact O-N 2.95Å; E50-A53 WeakPolarHBondContact O-CB 3.37Å; E50-A53 PolarHBondContact O-N 3.45Å; E50-V54 WeakPolarHBondContact O-CG2 3.45Å; E50-V54 PolarHBondContact O-N 2.88Å
51	K	97.7	Very high	97	Very high	131 Å²	131	97.1 Å²	97.1	57%	0.57	52%	0.516	S	S	*	.	H	α-helix	trans	-58.4	-47.9	175.9	-176.9	-178	174.1	-173.9	0	111.4	A47 D48 C49 A53 V54 E55	A47-K51 WeakPolarHBondContact O-CB 3.35Å; A47-K51 PolarHBondContact O-N 2.92Å; D48-K51 PolarHBondContact O-N 2.85Å; C49-K51 VanDerWaalsContact C-N 3.34Å; C49-K51 PolarHBondContact O-N 2.75Å; K51-A53 VanDerWaalsContact C-N 3.32Å; K51-A53 PolarHBondContact O-N 2.95Å; K51-V54 PolarHBondContact O-N 3.15Å; K51-E55 WeakPolarHBondContact CE-OE1 3.33Å; K51-E55 WeakPolarHBondContact O-CG 3.5Å; K51-E55 PolarHBondContact O-N 3.17Å
52	T	97.1	Very high	97	Very high	63 Å²	63	93.5 Å²	93.5	39%	0.387	51%	0.508	S	S	.	.	H	α-helix	trans	-63.5	-37.7	177.6	61.1	0	0	0	0	112.2	D48 C49 E50 V54 E55 F56	D48-T52 WeakPolarHBondContact O-CG2 3.39Å; D48-T52 PolarHBondContact O-N 2.9Å; D48-T52 PolarHBondContact O-OG1 3.35Å; C49-T52 WeakPolarHBondContact CA-OG1 3.47Å; C49-T52 PolarHBondContact O-N 3.43Å; C49-T52 PolarHBondContact O-OG1 3.44Å; E50-T52 PolarHBondContact O-N 2.95Å; T52-V54 VanDerWaalsContact C-N 3.34Å; T52-V54 PolarHBondContact O-N 2.97Å; T52-E55 PolarHBondContact O-N 2.9Å; T52-F56 WeakPolarHBondContact O-CD2 3.45Å; T52-F56 PolarHBondContact O-N 3.48Å
53	A	96.5	Very high	97	Very high	60 Å²	60	96.7 Å²	96.7	50%	0.496	51%	0.511	S	S	.	.	H	α-helix	trans	-63.2	-40.2	176.7	0	0	0	0	0	111.8	C49 E50 K51 F56 G57	C49-A53 WeakPolarHBondContact O-CB 3.47Å; C49-A53 PolarHBondContact O-N 2.87Å; E50-A53 WeakPolarHBondContact O-CB 3.37Å; E50-A53 PolarHBondContact O-N 3.45Å; K51-A53 VanDerWaalsContact C-N 3.32Å; K51-A53 PolarHBondContact O-N 2.95Å; A53-F56 PolarHBondContact O-N 2.9Å; A53-G57 PolarHBondContact O-N 3.43Å
54	V	97.5	Very high	96.9	Very high	90 Å²	90	98.2 Å²	98.2	55%	0.545	51%	0.512	S	S	.	.	H	α-helix	trans	-64.4	-43.1	173.7	172.6	0	0	0	0	111.3	E50 K51 T52 F56 G57 N58	E50-V54 WeakPolarHBondContact O-CG2 3.45Å; E50-V54 PolarHBondContact O-N 2.88Å; K51-V54 PolarHBondContact O-N 3.15Å; T52-V54 VanDerWaalsContact C-N 3.34Å; T52-V54 PolarHBondContact O-N 2.97Å; V54-F56 PolarHBondContact O-N 3.49Å; V54-G57 PolarHBondContact O-N 3.2Å; V54-N58 PolarHBondContact O-N 3.47Å; V54-N58 PolarHBondContact O-ND2 3.26Å
55	E	97.3	Very high	96.9	Very high	93 Å²	93	94.1 Å²	94.1	44%	0.435	50%	0.504	S	S	.	.	H	α-helix	trans	-61.8	-42.3	176.1	-71.6	171.2	-175.1	0	0	112.1	K51 T52 N58 Q59	K51-E55 WeakPolarHBondContact CE-OE1 3.33Å; K51-E55 WeakPolarHBondContact O-CG 3.5Å; K51-E55 PolarHBondContact O-N 3.17Å; T52-E55 PolarHBondContact O-N 2.9Å; E55-N58 PolarHBondContact O-N 3.3Å; E55-Q59 PolarHBondContact O-N 2.97Å
56	F	96.2	Very high	96.9	Very high	132 Å²	132	92.5 Å²	92.5	58%	0.579	51%	0.505	S	S	*	.	H	α-helix	trans	-62.5	-42.3	172.5	-80.6	-64.3	0	0	0	112	T52 A53 V54 N58 Q59 L60	T52-F56 WeakPolarHBondContact O-CD2 3.45Å; T52-F56 PolarHBondContact O-N 3.48Å; A53-F56 PolarHBondContact O-N 2.9Å; V54-F56 PolarHBondContact O-N 3.49Å; F56-N58 PolarHBondContact O-N 3.43Å; F56-Q59 PolarHBondContact O-N 3.25Å; F56-L60 WeakPolarHBondContact O-CB 3.09Å; F56-L60 WeakPolarHBondContact O-CG 3.43Å; F56-L60 PolarHBondContact O-N 3Å
57	G	95.6	Very high	96.9	Very high	36 Å²	36	92.1 Å²	92.1	37%	0.371	50%	0.503	S	S	.	.	H	α-helix	trans	-56.9	-48.1	174.6	0	0	0	0	0	111.8	A53 V54 Q59 L60 E61	A53-G57 PolarHBondContact O-N 3.43Å; V54-G57 PolarHBondContact O-N 3.2Å; G57-Q59 PolarHBondContact O-N 3.21Å; G57-L60 PolarHBondContact O-N 2.69Å; G57-E61 WeakPolarHBondContact O-CB 3.39Å; G57-E61 PolarHBondContact O-N 3.44Å
58	N	96.1	Very high	96.9	Very high	111 Å²	111	91.6 Å²	91.6	59%	0.594	50%	0.503	S	S	*	.	H	α-helix	trans	-63.8	-40.6	177.6	-68.5	-27.6	0	0	0	112.6	V54 E55 F56 E61 G62	V54-N58 PolarHBondContact O-N 3.47Å; V54-N58 PolarHBondContact O-ND2 3.26Å; E55-N58 PolarHBondContact O-N 3.3Å; F56-N58 PolarHBondContact O-N 3.43Å; N58-E61 PolarHBondContact O-N 3.28Å; N58-G62 PolarHBondContact O-N 3.45Å
59	Q	97.3	Very high	96.8	Very high	113 Å²	113	91.8 Å²	91.8	53%	0.528	51%	0.507	S	S	.	.	H	α-helix	trans	-63.5	-42.4	175	-79.3	-159.8	17.6	0	0	112.3	E55 F56 G57 G62 K63	E55-Q59 PolarHBondContact O-N 2.97Å; F56-Q59 PolarHBondContact O-N 3.25Å; G57-Q59 PolarHBondContact O-N 3.21Å; Q59-G62 PolarHBondContact O-N 2.92Å; Q59-K63 WeakPolarHBondContact O-CG 3.38Å; Q59-K63 PolarHBondContact O-N 3.06Å
60	L	97.9	Very high	96.9	Very high	91 Å²	91	92.3 Å²	92.3	48%	0.476	50%	0.503	S	S	.	.	H	α-helix	trans	-65.3	-46	177.6	-73.5	172.8	0	0	0	110.4	F56 G57 G62 K63 W64	F56-L60 WeakPolarHBondContact O-CB 3.09Å; F56-L60 WeakPolarHBondContact O-CG 3.43Å; F56-L60 PolarHBondContact O-N 3Å; G57-L60 PolarHBondContact O-N 2.69Å; L60-G62 VanDerWaalsContact C-N 3.29Å; L60-G62 PolarHBondContact O-N 3.01Å; L60-K63 CarbonylContact O-C 3.54Å; L60-K63 PolarHBondContact O-N 3.48Å; L60-K63 VanDerWaalsContact O-N 3.09Å; L60-W64 VanDerWaalsContact C-CD1 3.49Å; L60-W64 WeakPolarHBondContact O-CB 3.19Å; L60-W64 PolarHBondContact O-N 3.37Å
61	E	96.3	Very high	96.8	Very high	111 Å²	111	92.8 Å²	92.8	52%	0.519	51%	0.509	S	S	.	.	H	α-helix	trans	-56.5	-44.3	175.9	-170	61.3	-152.3	0	0	111.4	G57 N58 K63 W64 A65	G57-E61 WeakPolarHBondContact O-CB 3.39Å; G57-E61 PolarHBondContact O-N 3.44Å; N58-E61 PolarHBondContact O-N 3.28Å; E61-K63 PolarHBondContact O-N 2.96Å; E61-W64 PolarHBondContact O-N 2.79Å; E61-A65 WeakPolarHBondContact O-CB 3.44Å; E61-A65 PolarHBondContact O-N 3.29Å
62	G	95.7	Very high	96.8	Very high	41 Å²	41	93.1 Å²	93.1	42%	0.423	51%	0.513	S	S	.	.	H	α-helix	trans	-60.4	-43.7	174.4	0	0	0	0	0	113.2	N58 Q59 L60 A65 V66	N58-G62 PolarHBondContact O-N 3.45Å; Q59-G62 PolarHBondContact O-N 2.92Å; L60-G62 VanDerWaalsContact C-N 3.29Å; L60-G62 PolarHBondContact O-N 3.01Å; G62-A65 PolarHBondContact O-N 3.35Å; G62-V66 WeakPolarHBondContact O-CG2 3.43Å; G62-V66 PolarHBondContact O-N 2.86Å
63	K	97.2	Very high	96.7	Very high	126 Å²	126	95.2 Å²	95.2	55%	0.548	52%	0.518	S	S	.	.	H	α-helix	trans	-65.8	-40.9	175.7	-72.2	174.6	-177.9	175.1	0	111.9	Q59 L60 E61 V66 L67	Q59-K63 WeakPolarHBondContact O-CG 3.38Å; Q59-K63 PolarHBondContact O-N 3.06Å; L60-K63 CarbonylContact O-C 3.54Å; L60-K63 PolarHBondContact O-N 3.48Å; L60-K63 VanDerWaalsContact O-N 3.09Å; E61-K63 PolarHBondContact O-N 2.96Å; K63-V66 PolarHBondContact O-N 2.97Å; K63-L67 WeakPolarHBondContact O-CG 3.45Å; K63-L67 PolarHBondContact O-N 3.47Å
64	W	96	Very high	96.7	Very high	159 Å²	159	99.8 Å²	99.8	60%	0.602	52%	0.524	S	S	*	.	H	α-helix	trans	-64.7	-39.5	176.9	-74.3	121.5	0	0	0	112	L60 E61 V66 L67 G68	L60-W64 VanDerWaalsContact C-CD1 3.49Å; L60-W64 WeakPolarHBondContact O-CB 3.19Å; L60-W64 PolarHBondContact O-N 3.37Å; E61-W64 PolarHBondContact O-N 2.79Å; W64-V66 VanDerWaalsContact C-N 3.35Å; W64-V66 PolarHBondContact O-N 2.92Å; W64-L67 HydrophobicContact CE3-CD1 4.02Å; W64-L67 HydrophobicContact CZ3-CD1 4.16Å; W64-L67 PolarHBondContact O-N 3.09Å; W64-G68 PolarHBondContact O-N 3.36Å
65	A	96.9	Very high	96.6	Very high	57 Å²	57	96.7 Å²	96.7	47%	0.471	51%	0.51	S	S	.	.	H	α-helix	trans	-59.5	-44.7	173.7	0	0	0	0	0	111.7	E61 G62 G68 T69	E61-A65 WeakPolarHBondContact O-CB 3.44Å; E61-A65 PolarHBondContact O-N 3.29Å; G62-A65 PolarHBondContact O-N 3.35Å; A65-G68 PolarHBondContact O-N 3.42Å; A65-T69 WeakPolarHBondContact O-CG2 3.45Å; A65-T69 PolarHBondContact O-N 3.47Å
66	V	97.1	Very high	96.6	Very high	96 Å²	96	95.7 Å²	95.7	58%	0.582	51%	0.507	S	S	*	.	H	α-helix	trans	-65.7	-40.7	176.4	175.2	0	0	0	0	112.1	G62 K63 W64 G68 T69 L70	G62-V66 WeakPolarHBondContact O-CG2 3.43Å; G62-V66 PolarHBondContact O-N 2.86Å; K63-V66 PolarHBondContact O-N 2.97Å; W64-V66 VanDerWaalsContact C-N 3.35Å; W64-V66 PolarHBondContact O-N 2.92Å; V66-G68 VanDerWaalsContact C-N 3.3Å; V66-G68 PolarHBondContact O-N 3.38Å; V66-T69 PolarHBondContact O-N 3.34Å; V66-T69 PolarHBondContact O-OG1 2.95Å; V66-L70 WeakPolarHBondContact O-CB 3.48Å; V66-L70 PolarHBondContact O-N 2.73Å
67	L	97.7	Very high	96.6	Very high	93 Å²	93	94 Å²	94	49%	0.487	50%	0.504	S	S	.	.	H	α-helix	trans	-64.8	-37.6	174.6	-73.2	173	0	0	0	111.7	K63 W64 L70 L71	K63-L67 WeakPolarHBondContact O-CG 3.45Å; K63-L67 PolarHBondContact O-N 3.47Å; W64-L67 HydrophobicContact CE3-CD1 4.02Å; W64-L67 HydrophobicContact CZ3-CD1 4.16Å; W64-L67 PolarHBondContact O-N 3.09Å; L67-L70 PolarHBondContact O-N 2.94Å; L67-L71 WeakPolarHBondContact O-CB 3.45Å; L67-L71 PolarHBondContact O-N 2.94Å
68	G	96.6	Very high	96.6	Very high	40 Å²	40	97.7 Å²	97.7	41%	0.412	51%	0.511	S	S	.	.	H	α-helix	trans	-61.5	-44.6	175	0	0	0	0	0	112.5	W64 A65 V66 L71 Q72	W64-G68 PolarHBondContact O-N 3.36Å; A65-G68 PolarHBondContact O-N 3.42Å; V66-G68 VanDerWaalsContact C-N 3.3Å; V66-G68 PolarHBondContact O-N 3.38Å; G68-L71 PolarHBondContact O-N 2.87Å; G68-Q72 PolarHBondContact O-N 3.49Å; G68-Q72 VanDerWaalsContact O-N 3.12Å
69	T	97	Very high	96.5	Very high	80 Å²	80	99.3 Å²	99.3	49%	0.491	51%	0.509	S	S	.	.	H	α-helix	trans	-65.9	-42.7	175.4	60.1	0	0	0	0	111.5	A65 V66 L71 Q72 E73	A65-T69 WeakPolarHBondContact O-CG2 3.45Å; A65-T69 PolarHBondContact O-N 3.47Å; V66-T69 PolarHBondContact O-N 3.34Å; V66-T69 PolarHBondContact O-OG1 2.95Å; T69-L71 VanDerWaalsContact C-N 3.3Å; T69-L71 PolarHBondContact O-N 3.41Å; T69-Q72 WeakPolarHBondContact O-CB 3.43Å; T69-Q72 PolarHBondContact O-N 3.28Å; T69-Q72 VanDerWaalsContact O-N 3.16Å; T69-E73 WeakPolarHBondContact O-CG 3.45Å; T69-E73 PolarHBondContact O-N 2.83Å
70	L	97	Very high	96.3	Very high	94 Å²	94	101.4 Å²	101.4	49%	0.492	51%	0.512	S	S	.	.	H	α-helix	trans	-60.8	-38.9	177.2	-176.1	62.1	0	0	0	112.3	V66 L67 E73 Y74	V66-L70 WeakPolarHBondContact O-CB 3.48Å; V66-L70 PolarHBondContact O-N 2.73Å; L67-L70 PolarHBondContact O-N 2.94Å; L70-E73 PolarHBondContact O-N 3.3Å; L70-Y74 PolarHBondContact O-N 3.47Å
71	L	96.9	Very high	96.1	Very high	132 Å²	132	101.9 Å²	101.9	69%	0.691	51%	0.514	S	S	*	.	H	α-helix	trans	-65.3	-40	176	-174.8	62.8	0	0	0	111.8	L67 G68 T69 Y74 G75	L67-L71 WeakPolarHBondContact O-CB 3.45Å; L67-L71 PolarHBondContact O-N 2.94Å; G68-L71 PolarHBondContact O-N 2.87Å; T69-L71 VanDerWaalsContact C-N 3.3Å; T69-L71 PolarHBondContact O-N 3.41Å; L71-Y74 PolarHBondContact O-N 3.31Å; L71-G75 PolarHBondContact O-N 2.99Å
72	Q	96.4	Very high	95.9	Very high	137 Å²	137	100.5 Å²	100.5	64%	0.64	51%	0.508	S	S	*	.	H	α-helix	trans	-62	-43.2	174.2	179.7	177	-19.8	0	0	111.7	G68 T69 G75 L76	G68-Q72 PolarHBondContact O-N 3.49Å; G68-Q72 VanDerWaalsContact O-N 3.12Å; T69-Q72 WeakPolarHBondContact O-CB 3.43Å; T69-Q72 PolarHBondContact O-N 3.28Å; T69-Q72 VanDerWaalsContact O-N 3.16Å; Q72-G75 PolarHBondContact O-N 3.22Å; Q72-L76 PolarHBondContact O-N 2.87Å
73	E	96	Very high	95.6	Very high	108 Å²	108	103 Å²	103	51%	0.505	51%	0.512	S	S	.	.	H	α-helix	trans	-63.4	-41.7	175.4	-68	-54	147.5	0	0	111.7	T69 L70 G75 L76 L77	T69-E73 WeakPolarHBondContact O-CG 3.45Å; T69-E73 PolarHBondContact O-N 2.83Å; L70-E73 PolarHBondContact O-N 3.3Å; E73-G75 VanDerWaalsContact C-N 3.33Å; E73-G75 PolarHBondContact O-N 3.01Å; E73-L76 PolarHBondContact O-N 3.02Å; E73-L77 WeakPolarHBondContact O-CB 3.39Å; E73-L77 PolarHBondContact O-N 3.12Å
74	Y	95.2	Very high	95.2	Very high	156 Å²	156	100.1 Å²	100.1	61%	0.612	50%	0.504	S	S	*	.	H	α-helix	trans	-58.3	-44.6	173.9	-115.2	-84.9	0	0	0	112	L70 L71 L76 L77 Q78	L70-Y74 PolarHBondContact O-N 3.47Å; L71-Y74 PolarHBondContact O-N 3.31Å; Y74-L76 VanDerWaalsContact C-N 3.33Å; Y74-L76 PolarHBondContact O-N 3Å; Y74-L77 PolarHBondContact O-N 3.09Å; Y74-Q78 WeakPolarHBondContact O-CB 3.47Å; Y74-Q78 PolarHBondContact O-N 3.35Å
75	G	96.4	Very high	94.9	Very high	24 Å²	24	97.6 Å²	97.6	25%	0.247	50%	0.5	C	S	.	.	H	α-helix	trans	-66.8	-31	177.2	0	0	0	0	0	113.8	L71 Q72 E73 R79	L71-G75 PolarHBondContact O-N 2.99Å; Q72-G75 PolarHBondContact O-N 3.22Å; E73-G75 VanDerWaalsContact C-N 3.33Å; E73-G75 PolarHBondContact O-N 3.01Å; G75-R79 PolarHBondContact O-N 3.29Å; G75-R79 PolarHBondContact O-NE 3.46Å
76	L	96.5	Very high	94.5	Very high	73 Å²	73	100 Å²	100	38%	0.382	50%	0.504	S	S	.	.	H	α-helix	trans	-69.5	-43.1	171.1	178.9	64.5	0	0	0	110.9	Q72 E73 Y74 Q78 R79 R80	Q72-L76 PolarHBondContact O-N 2.87Å; E73-L76 PolarHBondContact O-N 3.02Å; Y74-L76 VanDerWaalsContact C-N 3.33Å; Y74-L76 PolarHBondContact O-N 3Å; L76-Q78 VanDerWaalsContact C-N 3.34Å; L76-Q78 PolarHBondContact O-N 2.97Å; L76-R79 PolarHBondContact O-N 3.09Å; L76-R80 WeakPolarHBondContact O-CG 3.4Å; L76-R80 PolarHBondContact O-N 3.32Å
77	L	96.7	Very high	94	Very high	96 Å²	96	96.9 Å²	96.9	50%	0.503	48%	0.484	S	S	.	.	H	α-helix	trans	-64.4	-40.1	-179.9	-156.6	67.3	0	0	0	111.5	E73 Y74 R80 L81	E73-L77 WeakPolarHBondContact O-CB 3.39Å; E73-L77 PolarHBondContact O-N 3.12Å; Y74-L77 PolarHBondContact O-N 3.09Å; L77-R80 PolarHBondContact O-N 3.33Å; L77-L81 PolarHBondContact O-N 2.93Å
78	Q	95.4	Very high	93.4	Very high	113 Å²	113	96.1 Å²	96.1	53%	0.528	48%	0.48	S	S	.	.	H	α-helix	trans	-60.3	-48.2	173.3	-174.3	-179.3	-18.2	0	0	111.9	Y74 L76 R80 L81 E82	Y74-Q78 WeakPolarHBondContact O-CB 3.47Å; Y74-Q78 PolarHBondContact O-N 3.35Å; L76-Q78 VanDerWaalsContact C-N 3.34Å; L76-Q78 PolarHBondContact O-N 2.97Å; Q78-R80 VanDerWaalsContact C-N 3.28Å; Q78-R80 PolarHBondContact O-N 3.16Å; Q78-L81 WeakPolarHBondContact O-CB 3.45Å; Q78-L81 PolarHBondContact O-N 2.85Å; Q78-L81 VanDerWaalsContact O-N 3.09Å; Q78-E82 WeakPolarHBondContact CG-OE1 3.42Å; Q78-E82 PolarHBondContact NE2-OE1 3.31Å; Q78-E82 WeakPolarHBondContact O-CG 3.42Å; Q78-E82 PolarHBondContact O-N 2.91Å
79	R	94.9	Very high	92.8	Very high	145 Å²	145	102.5 Å²	102.5	55%	0.547	50%	0.499	S	S	.	.	H	α-helix	trans	-59.8	-37.2	175.5	-81.3	176.2	-86.9	139.5	-8.9	112.8	G75 L76 N83	G75-R79 PolarHBondContact O-N 3.29Å; G75-R79 PolarHBondContact O-NE 3.46Å; L76-R79 PolarHBondContact O-N 3.09Å; R79-N83 WeakPolarHBondContact O-CB 3.41Å; R79-N83 PolarHBondContact O-N 3.27Å
80	R	92.2	Very high	92.1	Very high	157 Å²	157	104 Å²	104	59%	0.592	50%	0.504	S	S	*	.	H	α-helix	trans	-67.3	-39.6	174.8	-71.4	-179.3	70.5	-114.9	-0.7	111.6	L76 L77 Q78 N83 V84	L76-R80 WeakPolarHBondContact O-CG 3.4Å; L76-R80 PolarHBondContact O-N 3.32Å; L77-R80 PolarHBondContact O-N 3.33Å; Q78-R80 VanDerWaalsContact C-N 3.28Å; Q78-R80 PolarHBondContact O-N 3.16Å; R80-N83 PolarHBondContact O-N 3.49Å; R80-V84 WeakPolarHBondContact O-CG2 3.32Å; R80-V84 PolarHBondContact O-N 3.22Å; R80-V84 VanDerWaalsContact O-N 3.08Å
81	L	93.2	Very high	91	Very high	101 Å²	101	109.2 Å²	109.2	53%	0.529	52%	0.517	S	S	.	.	H	α-helix	trans	-63.7	-50.9	175.5	-176.4	64.1	0	0	0	110.8	L77 Q78 N83 V84 E85	L77-L81 PolarHBondContact O-N 2.93Å; Q78-L81 WeakPolarHBondContact O-CB 3.45Å; Q78-L81 PolarHBondContact O-N 2.85Å; Q78-L81 VanDerWaalsContact O-N 3.09Å; L81-N83 VanDerWaalsContact C-N 3.25Å; L81-N83 PolarHBondContact O-N 2.88Å; L81-V84 PolarHBondContact O-N 2.87Å; L81-E85 WeakPolarHBondContact O-CG 3.34Å; L81-E85 PolarHBondContact O-N 3.02Å
82	E	93	Very high	89.7	Confident	82 Å²	82	105.8 Å²	105.8	38%	0.383	50%	0.499	S	S	.	.	H	α-helix	trans	-55.3	-40.5	175.2	-72.5	169.8	-168.4	0	0	111.6	Q78 E85 N86	Q78-E82 WeakPolarHBondContact CG-OE1 3.42Å; Q78-E82 PolarHBondContact NE2-OE1 3.31Å; Q78-E82 WeakPolarHBondContact O-CG 3.42Å; Q78-E82 PolarHBondContact O-N 2.91Å; E82-E85 PolarHBondContact O-N 3.06Å; E82-N86 WeakPolarHBondContact O-CB 3.44Å; E82-N86 VanDerWaalsContact O-CG 3.24Å; E82-N86 PolarHBondContact O-N 3.42Å; E82-N86 PolarHBondContact O-ND2 2.89Å
83	N	90.3	Very high	88.4	Confident	95 Å²	95	104.1 Å²	104.1	51%	0.508	49%	0.49	S	S	.	.	H	α-helix	trans	-64.7	-41.9	176.3	-179.2	71.8	0	0	0	112.8	R79 R80 L81 N86 L87	R79-N83 WeakPolarHBondContact O-CB 3.41Å; R79-N83 PolarHBondContact O-N 3.27Å; R80-N83 PolarHBondContact O-N 3.49Å; L81-N83 VanDerWaalsContact C-N 3.25Å; L81-N83 PolarHBondContact O-N 2.88Å; N83-N86 PolarHBondContact O-N 3.3Å; N83-L87 WeakPolarHBondContact O-CG 3.47Å; N83-L87 PolarHBondContact O-N 2.98Å
84	V	88.4	Confident	87	Confident	64 Å²	64	107.9 Å²	107.9	39%	0.388	50%	0.5	S	S	.	.	H	α-helix	trans	-66.4	-43	175.7	172.5	0	0	0	0	110.6	R80 L81 N86 L87 L88	R80-V84 WeakPolarHBondContact O-CG2 3.32Å; R80-V84 PolarHBondContact O-N 3.22Å; R80-V84 VanDerWaalsContact O-N 3.08Å; L81-V84 PolarHBondContact O-N 2.87Å; V84-N86 VanDerWaalsContact C-N 3.32Å; V84-N86 PolarHBondContact O-N 3.44Å; V84-L87 WeakPolarHBondContact O-CB 3.48Å; V84-L87 PolarHBondContact O-N 3.19Å; V84-L87 VanDerWaalsContact O-N 3.16Å; V84-L88 HydrophobicContact CG1-CD1 4.3Å; V84-L88 WeakPolarHBondContact O-CG 3.26Å; V84-L88 PolarHBondContact O-N 3.02Å
85	E	89.1	Confident	85.7	Confident	107 Å²	107	106 Å²	106	50%	0.5	50%	0.499	S	S	.	.	H	α-helix	trans	-58.2	-44.8	175	-71.7	176.3	166.6	0	0	111.4	L81 E82 L87 L88 H89	L81-E85 WeakPolarHBondContact O-CG 3.34Å; L81-E85 PolarHBondContact O-N 3.02Å; E82-E85 PolarHBondContact O-N 3.06Å; E85-L87 PolarHBondContact O-N 3.3Å; E85-L88 PolarHBondContact O-N 3.24Å; E85-H89 WeakPolarHBondContact O-CB 3.35Å; E85-H89 PolarHBondContact O-N 2.87Å
86	N	89	Confident	84.2	Confident	107 Å²	107	109 Å²	109	57%	0.572	51%	0.509	S	S	*	.	H	α-helix	trans	-61.9	-39.1	175.1	-76.6	-41.7	0	0	0	112.8	E82 N83 V84 H89 N90	E82-N86 WeakPolarHBondContact O-CB 3.44Å; E82-N86 VanDerWaalsContact O-CG 3.24Å; E82-N86 PolarHBondContact O-N 3.42Å; E82-N86 PolarHBondContact O-ND2 2.89Å; N83-N86 PolarHBondContact O-N 3.3Å; V84-N86 VanDerWaalsContact C-N 3.32Å; V84-N86 PolarHBondContact O-N 3.44Å; N86-H89 PolarHBondContact O-N 3.16Å; N86-N90 VanDerWaalsContact O-CB 3.26Å; N86-N90 WeakPolarHBondContact O-CB 3.42Å; N86-N90 PolarHBondContact O-N 3.04Å
87	L	87	Confident	82.8	Confident	31 Å²	31	112.7 Å²	112.7	16%	0.162	52%	0.518	C	S	.	.	H	α-helix	trans	-62.9	-41.2	175.2	-75	170.3	0	0	0	112.1	N83 V84 E85 N92 I95	N83-L87 WeakPolarHBondContact O-CG 3.47Å; N83-L87 PolarHBondContact O-N 2.98Å; V84-L87 WeakPolarHBondContact O-CB 3.48Å; V84-L87 PolarHBondContact O-N 3.19Å; V84-L87 VanDerWaalsContact O-N 3.16Å; E85-L87 PolarHBondContact O-N 3.3Å; L87-N92 HydrophobicContact CD2-CB 3.94Å; L87-N92 PolarHBondContact O-N 3.26Å; L87-N92 VanDerWaalsContact O-N 3.09Å; L87-I95 HydrophobicContact CD2-CD1 3.96Å
88	L	83.6	Confident	81.1	Confident	76 Å²	76	115 Å²	115	40%	0.398	53%	0.53	S	S	.	.	H	α-helix	trans	-67.5	-43.3	176.4	-62.8	175	0	0	0	111.1	V84 E85 R91 F93 L96	V84-L88 HydrophobicContact CG1-CD1 4.3Å; V84-L88 WeakPolarHBondContact O-CG 3.26Å; V84-L88 PolarHBondContact O-N 3.02Å; E85-L88 PolarHBondContact O-N 3.24Å; L88-R91 PolarHBondContact O-N 3.43Å; L88-F93 HydrophobicContact CB-CE1 4.44Å; L88-F93 HydrophobicContact CB-CZ 4.19Å; L88-F93 HydrophobicContact CD2-CD1 3.89Å; L88-F93 HydrophobicContact CD2-CE1 3.17Å; L88-F93 HydrophobicContact CD2-CZ 3.77Å; L88-F93 HydrophobicContact CG-CE1 4.38Å; L88-F93 WeakPolarHBondContact O-CE2 3.44Å; L88-F93 WeakPolarHBondContact O-CZ 3.46Å; L88-L96 HydrophobicContact CD2-CD1 3.97Å
89	H	84.6	Confident	79.3	Confident	175 Å²	175	115 Å²	115	81%	0.81	54%	0.54	S	S	*	.	H	α-helix	trans	-68.8	-35.7	-178.7	-138.6	66.4	0	0	0	112.7	E85 N86 R91	E85-H89 WeakPolarHBondContact O-CB 3.35Å; E85-H89 PolarHBondContact O-N 2.87Å; N86-H89 PolarHBondContact O-N 3.16Å; H89-R91 PolarHBondContact O-N 3.43Å
90	N	82.6	Confident	77.4	Confident	111 Å²	111	113.3 Å²	113.3	59%	0.594	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	-76.3	-0.8	178.2	-158.1	-69.4	0	0	0	113.2	N86 N92	N86-N90 VanDerWaalsContact O-CB 3.26Å; N86-N90 WeakPolarHBondContact O-CB 3.42Å; N86-N90 PolarHBondContact O-N 3.04Å; N90-N92 HydrophobicContact CB-CB 4.43Å; N90-N92 PolarHBondContact O-N 3.43Å; N90-N92 VanDerWaalsContact O-N 3.16Å; N90-N92 PolarHBondContact OD1-ND2 3.08Å
91	R	74.5	Confident	75.3	Confident	203 Å²	203	108.6 Å²	108.6	77%	0.766	55%	0.548	S	S	*	.	T	Hydrogen-bonded Turn	trans	55.1	23.7	-168.4	-61.6	176.5	176.1	179.8	-1.6	113.8	L88 H89 F93	L88-R91 PolarHBondContact O-N 3.43Å; H89-R91 PolarHBondContact O-N 3.43Å; R91-F93 HydrophobicContact CB-CD2 4.18Å; R91-F93 HydrophobicContact CB-CE2 4.33Å; R91-F93 HydrophobicContact CG-CE2 4.34Å; R91-F93 PolarHBondContact O-N 3.02Å
92	N	68.2	Low	72.9	Confident	60 Å²	60	109.6 Å²	109.6	32%	0.321	56%	0.564	S	S	.	*	T	Hydrogen-bonded Turn	trans	-76.4	35.6	172.7	-84.8	-34.1	0	0	0	112	L87 N90 W94 I95	L87-N92 HydrophobicContact CD2-CB 3.94Å; L87-N92 PolarHBondContact O-N 3.26Å; L87-N92 VanDerWaalsContact O-N 3.09Å; N90-N92 HydrophobicContact CB-CB 4.43Å; N90-N92 PolarHBondContact O-N 3.43Å; N90-N92 VanDerWaalsContact O-N 3.16Å; N90-N92 PolarHBondContact OD1-ND2 3.08Å; N92-W94 PolarHBondContact O-N 2.88Å; N92-W94 VanDerWaalsContact O-N 3.14Å; N92-I95 HydrophobicContact CB-CD1 4.06Å; N92-I95 HydrophobicContact CB-CG1 4.49Å; N92-I95 WeakPolarHBondContact O-CB 3.36Å; N92-I95 PolarHBondContact O-N 3.44Å
93	F	69.7	Low	70.7	Confident	102 Å²	102	115.3 Å²	115.3	45%	0.447	59%	0.587	S	S	.	*	H	α-helix	trans	-60.5	-20.6	174	-66.5	-84	0	0	0	112.3	L88 R91 I95 L96 R97	L88-F93 HydrophobicContact CB-CE1 4.44Å; L88-F93 HydrophobicContact CB-CZ 4.19Å; L88-F93 HydrophobicContact CD2-CD1 3.89Å; L88-F93 HydrophobicContact CD2-CE1 3.17Å; L88-F93 HydrophobicContact CD2-CZ 3.77Å; L88-F93 HydrophobicContact CG-CE1 4.38Å; L88-F93 WeakPolarHBondContact O-CE2 3.44Å; L88-F93 WeakPolarHBondContact O-CZ 3.46Å; R91-F93 HydrophobicContact CB-CD2 4.18Å; R91-F93 HydrophobicContact CB-CE2 4.33Å; R91-F93 HydrophobicContact CG-CE2 4.34Å; R91-F93 PolarHBondContact O-N 3.02Å; F93-I95 PolarHBondContact O-N 2.95Å; F93-L96 CarbonylContact O-C 3.6Å; F93-L96 PolarHBondContact O-N 3.26Å; F93-L96 VanDerWaalsContact O-N 3.08Å; F93-R97 PolarHBondContact O-N 3.4Å
94	W	66.7	Low	68.6	Low	187 Å²	187	114.4 Å²	114.4	71%	0.708	60%	0.6	S	S	*	*	H	α-helix	trans	-61.6	-24.4	173.3	-63.4	102.1	0	0	0	113.1	N92 R97	N92-W94 PolarHBondContact O-N 2.88Å; N92-W94 VanDerWaalsContact O-N 3.14Å; W94-R97 WeakPolarHBondContact O-CB 3.35Å
95	I	67.6	Low	66.5	Low	117 Å²	117	120 Å²	120	60%	0.6	62%	0.622	S	S	*	*	H	α-helix	trans	-79.5	-31.6	174.7	-57.6	175.2	0	0	0	110.9	L87 N92 F93 R97	L87-I95 HydrophobicContact CD2-CD1 3.96Å; N92-I95 HydrophobicContact CB-CD1 4.06Å; N92-I95 HydrophobicContact CB-CG1 4.49Å; N92-I95 WeakPolarHBondContact O-CB 3.36Å; N92-I95 PolarHBondContact O-N 3.44Å; F93-I95 PolarHBondContact O-N 2.95Å; I95-R97 VanDerWaalsContact C-N 3.29Å
96	L	65.8	Low	64.4	Low	87 Å²	87	119.8 Å²	119.8	46%	0.455	63%	0.632	S	S	.	*	H	α-helix	trans	-79.4	-13.7	172.9	-68.7	174.8	0	0	0	112.8	L88 F93 L98	L88-L96 HydrophobicContact CD2-CD1 3.97Å; F93-L96 CarbonylContact O-C 3.6Å; F93-L96 PolarHBondContact O-N 3.26Å; F93-L96 VanDerWaalsContact O-N 3.08Å; L96-L98 VanDerWaalsContact C-N 3.35Å; L96-L98 PolarHBondContact O-N 3.02Å
97	R	67.4	Low	62.3	Low	151 Å²	151	120.6 Å²	120.6	57%	0.57	64%	0.644	S	S	*	*	S	Bend	trans	-67.4	99.2	168.9	-168	171.5	177.8	156.5	-1.5	106.8	F93 W94 I95	F93-R97 PolarHBondContact O-N 3.4Å; W94-R97 WeakPolarHBondContact O-CB 3.35Å; I95-R97 VanDerWaalsContact C-N 3.29Å
98	L	60.6	Low	60.4	Low	145 Å²	145	128.2 Å²	128.2	76%	0.759	68%	0.675	S	S	*	*			trans	-43.3	137.3	165.6	-89.2	79.3	0	0	0	108	L96 P100	L96-L98 VanDerWaalsContact C-N 3.35Å; L96-L98 PolarHBondContact O-N 3.02Å; L98-P100 VanDerWaalsContact O-N 3.07Å
99	P	56.2	Low	58.5	Low	112 Å²	112	130.2 Å²	130.2	73%	0.727	69%	0.691	S	S	*	*			trans	-49.3	126.2	173.3	21	-30.9	0	0	0	106.9	G101	P99-G101 PolarHBondContact O-N 2.89Å
100	P	55.8	Low	56.7	Low	109 Å²	109	128.5 Å²	128.5	71%	0.708	69%	0.693	S	S	*	*			trans	-53.4	112.8	-174.2	19.1	-30.1	0	0	0	107.8	L98 S102	L98-P100 VanDerWaalsContact O-N 3.07Å; P100-S102 PolarHBondContact O-N 3.45Å
101	G	47.3	Very low	55.1	Low	59 Å²	59	129 Å²	129	61%	0.608	70%	0.703	S	S	*	*			trans	-54.3	113.2	178.6	0	0	0	0	0	108.6	P99 K103	P99-G101 PolarHBondContact O-N 2.89Å; G101-K103 VanDerWaalsContact C-N 3.33Å; G101-K103 PolarHBondContact O-N 2.97Å
102	S	44.3	Very low	53.9	Low	122 Å²	122	124.7 Å²	124.7	85%	0.853	70%	0.703	S	S	*	*			trans	22.7	68.3	137.1	60.2	0	0	0	0	114.7	P100	P100-S102 PolarHBondContact O-N 3.45Å
103	K	45.4	Very low	53.1	Low	201 Å²	201	126.6 Å²	126.6	87%	0.874	72%	0.719	S	S	*	*			trans	-88.1	113.5	153.1	-76	-154.4	175.8	-173.1	0	105.9	G101	G101-K103 VanDerWaalsContact C-N 3.33Å; G101-K103 PolarHBondContact O-N 2.97Å
104	G	46	Very low	52.2	Low	76 Å²	76	127.1 Å²	127.1	78%	0.784	74%	0.735	S	S	*	*			trans	-60.4	136	-175.8	0	0	0	0	0	111.8
105	E	45.8	Very low	51.3	Low	182 Å²	182	123.8 Å²	123.8	85%	0.85	74%	0.738	S	S	*	*			trans	-153	96.8	151.1	-146.8	162.6	152.1	0	0	109.6
106	S	44	Very low	50.4	Low	102 Å²	102	129.6 Å²	129.6	71%	0.713	75%	0.752	S	S	*	*			trans	56.5	128.9	149.9	61.9	0	0	0	0	121.8
107	P	44.3	Very low	49.6	Very low	124 Å²	124	129.9 Å²	129.9	81%	0.805	76%	0.762	S	S	*	*			trans	-86.2	129.9	173.4	35.1	-29.2	0	0	0	110.7
108	K	48.3	Very low	49.1	Very low	191 Å²	191	128.5 Å²	128.5	83%	0.83	78%	0.775	S	S	*	*			trans	-152.8	92.1	161.4	-107.9	165.5	-176.4	175.4	0	109
109	T	44.3	Very low	48.7	Very low	119 Å²	119	127.8 Å²	127.8	73%	0.73	78%	0.779	S	S	*	*				59.2	101.2	109.3	59.8	0	0	0	0	114
110	T	46.1	Very low	48.5	Very low	139 Å²	139	134.2 Å²	134.2	85%	0.853	79%	0.788	S	S	*	*				-164.5	131.7	104.8	30.7	0	0	0	0	109.5
111	P	47.9	Very low	48.7	Very low	122 Å²	122	136.6 Å²	136.6	79%	0.792	79%	0.794	S	S	*	*			trans	-95.1	177.4	-171	38.4	-34.6	0	0	0	113.1
112	S	49.8	Very low	49.1	Very low	111 Å²	111	139.5 Å²	139.5	78%	0.776	80%	0.796	S	S	*	*			trans	104.3	149.9	151.4	-125.6	0	0	0	0	117.6
113	P	50.8	Low	49.7	Very low	100 Å²	100	142.3 Å²	142.3	65%	0.649	79%	0.793	S	S	*	*				-142.7	148	-90	36.1	-15.3	0	0	0	116.1
114	S	50.9	Low	49.7	Very low	113 Å²	113	136.3 Å²	136.3	79%	0.79	79%	0.788	S	S	*	*			trans	52.5	179.5	135.2	-48.1	0	0	0	0	121
115	P	49.3	Very low	49.8	Very low	118 Å²	118	144.1 Å²	144.1	77%	0.766	79%	0.794	S	S	*	*				-130.8	152.1	-84	37.7	-20.7	0	0	0	112.9
116	R	48	Very low	49.9	Very low	239 Å²	239	140.9 Å²	140.9	90%	0.902	79%	0.791	S	S	*	*			trans	-142.8	94.5	166	-108.2	178.3	-159.9	-115.2	0.3	113.8
117	S	50.2	Low	50.1	Low	93 Å²	93	141.1 Å²	141.1	65%	0.65	79%	0.79	S	S	*	*				32.1	114.2	128.1	59.3	0	0	0	0	118.9
118	S	56.2	Low	50	Low	121 Å²	121	139.8 Å²	139.8	85%	0.846	79%	0.79	S	S	*	*			trans	-170.6	108.7	136.2	-80.1	0	0	0	0	111
119	P	51.4	Low	50.3	Low	130 Å²	130	137.7 Å²	137.7	84%	0.844	79%	0.793	S	S	*	*			trans	-86.2	125	163.6	19.8	-5.2	0	0	0	109.9
120	R	53.4	Low	50.3	Low	247 Å²	247	135.2 Å²	135.2	93%	0.932	79%	0.791	S	S	*	*			trans	-71.4	125.1	174.1	-86.4	-178	176.2	-124.5	0.8	111.1
121	L	59.4	Low	50.1	Low	159 Å²	159	133 Å²	133	83%	0.832	79%	0.787	S	S	*	*				4.5	137.8	125.7	-114	56.6	0	0	0	114.1
122	N	55.1	Low	50	Low	121 Å²	121	132 Å²	132	65%	0.647	79%	0.79	S	S	*	*			cis	169	164.6	11.2	173.2	19.7	0	0	0	108.1
123	K	56.7	Low	49.9	Very low	180 Å²	180	134.1 Å²	134.1	78%	0.783	79%	0.791	S	S	*	*			trans	88.2	87.1	148.3	-129.5	103.5	178.5	-178.1	0	117.4
124	G	45.4	Very low	50.2	Low	75 Å²	75	134.6 Å²	134.6	77%	0.773	79%	0.792	S	S	*	*				81.1	118.1	103.4	0	0	0	0	0	117.5
125	R	48	Very low	50.6	Low	241 Å²	241	135 Å²	135	91%	0.909	79%	0.792	S	S	*	*				136.3	90	123	-155.7	174	-153.2	-148.2	4.8	112.5
126	S	48	Very low	51	Low	113 Å²	113	139.3 Å²	139.3	79%	0.79	79%	0.793	S	S	*	*			trans	-65.4	151.1	143.8	-51.2	0	0	0	0	108
127	P	48.9	Very low	51.2	Low	107 Å²	107	135.7 Å²	135.7	70%	0.695	78%	0.784	S	S	*	*				-147.3	161.6	68.1	35.6	-14.7	0	0	0	116.4
128	A	41.7	Very low	51.3	Low	97 Å²	97	138.9 Å²	138.9	80%	0.802	79%	0.789	S	S	*	*			trans	27.9	112.9	143	0	0	0	0	0	118.4
129	T	53.9	Low	51.2	Low	146 Å²	146	139.7 Å²	139.7	90%	0.896	78%	0.781	S	S	*	*			trans	-148.9	121.6	149.4	-35.9	0	0	0	0	110.4
130	G	45.1	Very low	51.3	Low	67 Å²	67	141.7 Å²	141.7	69%	0.691	78%	0.777	S	S	*	*			trans	85.2	90.1	148.5	0	0	0	0	0	116	A132	G130-A132 PolarHBondContact O-N 2.99Å
131	A	41.8	Very low	51	Low	93 Å²	93	137.1 Å²	137.1	77%	0.769	77%	0.77	S	S	*	*			trans	-48	108.7	146.9	0	0	0	0	0	108.4	L133	A131-L133 PolarHBondContact O-N 3.16Å
132	A	45.3	Very low	50.2	Low	102 Å²	102	137.4 Å²	137.4	84%	0.843	76%	0.76	S	S	*	*			trans	-71.4	86.1	167.1	0	0	0	0	0	107.2	G130 T134	G130-A132 PolarHBondContact O-N 2.99Å; A132-T134 PolarHBondContact O-N 3.09Å; A132-T134 VanDerWaalsContact O-N 3.09Å
133	L	47.8	Very low	50.4	Low	155 Å²	155	135.5 Å²	135.5	81%	0.812	75%	0.753	S	S	*	*			trans	-51.6	112.3	158	-83.5	140.1	0	0	0	107.2	A131	A131-L133 PolarHBondContact O-N 3.16Å
134	T	57.3	Low	50.4	Low	109 Å²	109	131.9 Å²	131.9	67%	0.669	75%	0.748	S	S	*	*			trans	-10.8	133.4	158.6	29.7	0	0	0	0	114.5	A132 R136	A132-T134 PolarHBondContact O-N 3.09Å; A132-T134 VanDerWaalsContact O-N 3.09Å; T134-R136 PolarHBondContact O-N 3.02Å
135	P	58.8	Low	51.2	Low	121 Å²	121	134 Å²	134	79%	0.786	75%	0.746	S	S	*	*			trans	-65.8	88	156.5	0.6	15.3	0	0	0	106.5	F137	P135-F137 PolarHBondContact O-N 2.93Å
136	R	57.7	Low	51.6	Low	209 Å²	209	129 Å²	129	79%	0.789	73%	0.732	S	S	*	*			trans	-48.5	105.4	162.3	-172.8	173.5	-178	170.2	0.4	105.3	T134 Q138	T134-R136 PolarHBondContact O-N 3.02Å; R136-Q138 PolarHBondContact O-N 3.14Å
137	F	52.8	Low	51.8	Low	163 Å²	163	128.8 Å²	128.8	72%	0.715	72%	0.721	S	S	*	*			trans	-59.1	82.4	165.1	-92.6	-90.4	0	0	0	107.2	P135 M139	P135-F137 PolarHBondContact O-N 2.93Å; F137-M139 PolarHBondContact O-N 3.27Å
138	Q	52.5	Low	52.3	Low	161 Å²	161	131.5 Å²	131.5	75%	0.752	72%	0.724	S	S	*	*			trans	-81.4	66.8	167.6	-158.4	-170.4	116.9	0	0	105.7	R136	R136-Q138 PolarHBondContact O-N 3.14Å
139	M	53.8	Low	53.1	Low	138 Å²	138	135.4 Å²	135.4	68%	0.68	72%	0.723	S	S	*	*			trans	-122.1	131.3	165.2	-89.3	-172.9	172.1	0	0	105.9	F137	F137-M139 PolarHBondContact O-N 3.27Å
140	F	53.2	Low	53.1	Low	172 Å²	172	135.7 Å²	135.7	75%	0.754	72%	0.718	S	S	*	*			trans	81.4	46.4	178.8	-50.9	-80	0	0	0	117.5	W142	F140-W142 PolarHBondContact O-N 3.08Å; F140-W142 VanDerWaalsContact O-N 3.17Å
141	L	47.6	Very low	53.7	Low	150 Å²	150	142.2 Å²	142.2	79%	0.785	72%	0.722	S	S	*	*			trans	-76.6	76.4	131.4	-82.5	166.7	0	0	0	107.4	T143	L141-T143 PolarHBondContact O-N 2.95Å
142	W	42.2	Very low	54.2	Low	165 Å²	165	143 Å²	143	63%	0.625	72%	0.719	S	S	*	*			trans	-67.2	83.1	159.6	-170.1	-73.6	0	0	0	106.3	F140 P144 M147	F140-W142 PolarHBondContact O-N 3.08Å; F140-W142 VanDerWaalsContact O-N 3.17Å; W142-P144 WeakPolarHBondContact O-CD 3.5Å; W142-M147 HydrophobicContact CH2-CE 3.9Å; W142-M147 HydrophobicContact CZ2-CE 3.1Å; W142-M147 HydrophobicContact CZ2-CG 3.67Å; W142-M147 HydrophobicContact CZ2-SD 3.88Å; W142-M147 VanDerWaalsContact NE1-CG 3.3Å
143	T	59.8	Low	54.8	Low	82 Å²	82	143.8 Å²	143.8	50%	0.503	72%	0.718	S	S	.	*			trans	-62.7	121.9	173.5	28.5	0	0	0	0	107.9	L141 V145	L141-T143 PolarHBondContact O-N 2.95Å; T143-V145 PolarHBondContact O-N 2.88Å
144	P	56.9	Low	55.5	Low	103 Å²	103	148 Å²	148	67%	0.669	72%	0.723	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.3	-0.1	-178.3	26.2	-31.8	0	0	0	113.2	W142	W142-P144 WeakPolarHBondContact O-CD 3.5Å
145	V	61.5	Low	55.4	Low	120 Å²	120	153.7 Å²	153.7	73%	0.727	75%	0.75	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.6	-19.7	-177.8	179	0	0	0	0	112.9	T143	T143-V145 PolarHBondContact O-N 2.88Å
146	Q	56.5	Low	55.3	Low	135 Å²	135	155.4 Å²	155.4	63%	0.631	75%	0.748	S	S	*	*	S	Bend	trans	-97.3	-12.9	177.2	-72.3	-70.4	-16.2	0	0	114.5	Q148 K149	Q146-Q148 VanDerWaalsContact C-N 3.26Å; Q146-Q148 PolarHBondContact O-N 3.03Å; Q146-K149 PolarHBondContact O-N 2.85Å
147	M	53.7	Low	55.1	Low	110 Å²	110	152.5 Å²	152.5	54%	0.542	75%	0.746	S	S	.	*	G	3₁₀ helix	trans	-74.9	-7.3	179.3	-95.6	-76.2	-152.7	0	0	114.4	W142	W142-M147 HydrophobicContact CH2-CE 3.9Å; W142-M147 HydrophobicContact CZ2-CE 3.1Å; W142-M147 HydrophobicContact CZ2-CG 3.67Å; W142-M147 HydrophobicContact CZ2-SD 3.88Å; W142-M147 VanDerWaalsContact NE1-CG 3.3Å
148	Q	57.8	Low	55.3	Low	163 Å²	163	151.9 Å²	151.9	76%	0.762	75%	0.748	S	S	*	*	G	3₁₀ helix	trans	-82.6	-9.4	173.5	-96.5	177.4	24.3	0	0	114.2	Q146	Q146-Q148 VanDerWaalsContact C-N 3.26Å; Q146-Q148 PolarHBondContact O-N 3.03Å
149	K	60.2	Low	55.4	Low	179 Å²	179	151.4 Å²	151.4	78%	0.778	75%	0.747	S	S	*	*	G	3₁₀ helix	trans	-96.7	5.2	-174.4	-147.3	158.1	-171.5	177	0	115.2	Q146	Q146-K149 PolarHBondContact O-N 2.85Å
150	L	52.9	Low	55.5	Low	152 Å²	152	152.3 Å²	152.3	80%	0.796	75%	0.751	S	S	*	*	G	3₁₀ helix	trans	-123.3	23.6	178.6	-72.5	169.2	0	0	0	113.1	P152	L150-P152 WeakPolarHBondContact O-CD 3.42Å
151	R	57	Low	55.7	Low	205 Å²	205	150.9 Å²	150.9	77%	0.774	75%	0.751	S	S	*	*			trans	-87	113.7	170.2	-153.4	-174.9	-66.3	-155.6	1.4	108.5	S153	R151-S153 PolarHBondContact O-N 2.99Å
152	P	52.6	Low	56.3	Low	110 Å²	110	151 Å²	151	71%	0.714	75%	0.749	S	S	*	*			trans	-69	127.3	173.7	27.2	-29.6	0	0	0	108.7	L150 R154	L150-P152 WeakPolarHBondContact O-CD 3.42Å; P152-R154 PolarHBondContact O-N 2.86Å; P152-R154 VanDerWaalsContact O-N 3.15Å
153	S	59.2	Low	57.4	Low	117 Å²	117	149.9 Å²	149.9	82%	0.818	76%	0.758	S	S	*	*			trans	-55.6	116.5	164.5	-86.6	0	0	0	0	108.2	R151	R151-S153 PolarHBondContact O-N 2.99Å
154	R	61.1	Low	57.2	Low	244 Å²	244	155.6 Å²	155.6	92%	0.921	78%	0.78	S	S	*	*			trans	-86	111.7	155.2	-84.7	-176.6	172.9	176.4	-2.9	106.4	P152	P152-R154 PolarHBondContact O-N 2.86Å; P152-R154 VanDerWaalsContact O-N 3.15Å
155	D	56.6	Low	57.2	Low	229 Å²	229	160.4 Å²	160.4	100%	1.225	79%	0.79	S	S	*	*			trans	-60.7	0	145.7	-67.6	-43.7	0	0	0	110.2

Retrieved 155 of 155 residues in 86.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).