A0A090N8Y5_HUMAN Loading...

U6 snRNA-associated Sm-like protein LSm5

Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA. Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA.

AlphaFold DB (P62322), UniProt , Accession A0A090N8Y5, Species HUMAN (Homo sapiens, Human), Gene LSM5, Length 91 aa.

						>A0A090N8Y5_HUMAN|A0A090N8Y5|LSM5
MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53	Low	62.2	Low	248 Å²	248	130.3 Å²	130.3	100%	1.222	79%	0.792	S	S	*	*				0	115	0	-71.2	-170	-165.6	0	0	107.3
2	A	50.2	Low	64.1	Low	98 Å²	98	125 Å²	125	81%	0.81	76%	0.755	S	S	*	*			trans	-76.5	127.1	175.8	0	0	0	0	0	108.7	N4	A2-N4 PolarHBondContact O-N 3.03Å
3	A	59	Low	66.2	Low	100 Å²	100	123.5 Å²	123.5	83%	0.826	74%	0.74	S	S	*	*			trans	-68.4	116.8	174	0	0	0	0	0	108.7	A5	A3-A5 PolarHBondContact O-N 3.29Å
4	N	55.8	Low	68	Low	153 Å²	153	121.9 Å²	121.9	82%	0.818	73%	0.734	S	S	*	*			trans	-62	106.8	166.3	-82.9	-14.2	0	0	0	107.6	A2 T6	A2-N4 PolarHBondContact O-N 3.03Å; N4-T6 PolarHBondContact O-N 3.19Å
5	A	61.3	Low	69.7	Low	88 Å²	88	119.7 Å²	119.7	73%	0.727	72%	0.716	S	S	*	*			trans	-61.8	104.5	165.3	0	0	0	0	0	107.1	A3 T7	A3-A5 PolarHBondContact O-N 3.29Å; A5-T7 VanDerWaalsContact C-N 3.26Å; A5-T7 PolarHBondContact O-N 2.86Å
6	T	63.5	Low	71.1	Confident	134 Å²	134	117.9 Å²	117.9	82%	0.822	70%	0.698	S	S	*	*			trans	-63.7	92.3	168.3	47.3	0	0	0	0	107.4	N4 N8	N4-T6 PolarHBondContact O-N 3.19Å; T6-N8 PolarHBondContact O-N 2.88Å; T6-N8 VanDerWaalsContact O-N 3.17Å
7	T	62.2	Low	72.3	Confident	118 Å²	118	115.8 Å²	115.8	72%	0.724	68%	0.682	S	S	*	*			trans	-57.5	117	166.2	51.3	0	0	0	0	106.8	A5 P9	A5-T7 VanDerWaalsContact C-N 3.26Å; A5-T7 PolarHBondContact O-N 2.86Å; T7-P9 WeakPolarHBondContact O-CD 3.1Å
8	N	69	Low	73.6	Confident	126 Å²	126	110.1 Å²	110.1	67%	0.674	65%	0.649	S	S	*	*			trans	-62.8	109.4	172.9	-177.6	4.5	0	0	0	107.8	T6 S10	T6-N8 PolarHBondContact O-N 2.88Å; T6-N8 VanDerWaalsContact O-N 3.17Å; N8-S10 VanDerWaalsContact CG-OG 3.25Å; N8-S10 PolarHBondContact ND2-OG 2.93Å; N8-S10 PolarHBondContact O-N 2.83Å; N8-S10 WeakPolarHBondContact OD1-CB 3.31Å; N8-S10 PolarHBondContact OD1-N 3.17Å; N8-S10 PolarHBondContact OD1-OG 3.4Å
9	P	63.2	Low	74.8	Confident	113 Å²	113	109.3 Å²	109.3	73%	0.734	64%	0.641	S	S	*	*			trans	-76.8	0.4	-175.6	33.7	-33.9	0	0	0	112	T7 Q11	T7-P9 WeakPolarHBondContact O-CD 3.1Å; P9-Q11 PolarHBondContact O-N 2.98Å
10	S	69.2	Low	75.8	Confident	71 Å²	71	110.6 Å²	110.6	50%	0.497	64%	0.638	S	S	.	*			trans	-68.5	96.3	-176.9	71.1	0	0	0	0	110.8	N8 L12	N8-S10 VanDerWaalsContact CG-OG 3.25Å; N8-S10 PolarHBondContact ND2-OG 2.93Å; N8-S10 PolarHBondContact O-N 2.83Å; N8-S10 WeakPolarHBondContact OD1-CB 3.31Å; N8-S10 PolarHBondContact OD1-N 3.17Å; N8-S10 PolarHBondContact OD1-OG 3.4Å; S10-L12 PolarHBondContact O-N 3.08Å
11	Q	77.5	Confident	76.7	Confident	184 Å²	184	105.7 Å²	105.7	86%	0.86	61%	0.611	S	S	*	*			trans	-80.6	23.4	166.3	-65.7	-177.8	-28.3	0	0	111.8	P9 L13	P9-Q11 PolarHBondContact O-N 2.98Å; Q11-L13 PolarHBondContact O-N 3.4Å
12	L	85.6	Confident	78.8	Confident	67 Å²	67	97.2 Å²	97.2	35%	0.351	57%	0.57	S	S	.	*			trans	-65.9	123.8	-172.5	-139.4	93	0	0	0	109.6	S10 E16 L17 K20	S10-L12 PolarHBondContact O-N 3.08Å; L12-E16 HydrophobicContact CD2-CB 4.39Å; L12-E16 HydrophobicContact CG-CB 4.12Å; L12-L17 HydrophobicContact CD2-CB 3.79Å; L12-L17 HydrophobicContact CD2-CD1 3.82Å; L12-L17 HydrophobicContact CD2-CG 4.4Å; L12-K20 VanDerWaalsContact CD1-NZ 3.3Å; L12-K20 HydrophobicContact CD2-CD 4.18Å
13	L	90.7	Very high	81.1	Confident	105 Å²	105	95.2 Å²	95.2	55%	0.55	56%	0.559	S	S	.	*			trans	-73.9	149.8	175.6	-62.7	175	0	0	0	109.7	Q11 L15 E16 L17	Q11-L13 PolarHBondContact O-N 3.4Å; L13-L15 VanDerWaalsContact C-N 3.26Å; L13-L15 PolarHBondContact O-N 3.37Å; L13-E16 HydrophobicContact CB-CB 4.34Å; L13-E16 HydrophobicContact CB-CG 3.95Å; L13-E16 PolarHBondContact N-OE2 2.91Å; L13-E16 WeakPolarHBondContact O-CA 3.33Å; L13-E16 WeakPolarHBondContact O-CB 3.46Å; L13-E16 PolarHBondContact O-N 3.14Å; L13-L17 PolarHBondContact O-N 3.36Å
14	P	91.5	Very high	82.9	Confident	102 Å²	102	93.3 Å²	93.3	66%	0.662	54%	0.539	S	S	*	.	H	α-helix	trans	-53.7	-41.8	179.5	-29.2	36	0	0	0	113.5	L17 V18	P14-L17 WeakPolarHBondContact O-CB 3.38Å; P14-L17 PolarHBondContact O-N 3.37Å; P14-L17 VanDerWaalsContact O-N 3.17Å; P14-V18 WeakPolarHBondContact O-CG2 3.45Å; P14-V18 PolarHBondContact O-N 3.21Å
15	L	93.5	Very high	84.9	Confident	89 Å²	89	90.2 Å²	90.2	47%	0.466	52%	0.516	S	S	.	.	H	α-helix	trans	-68.9	-33.4	177.4	-62.7	-179.7	0	0	0	112.6	L13 L17 V18 D19 F43 V47	L13-L15 VanDerWaalsContact C-N 3.26Å; L13-L15 PolarHBondContact O-N 3.37Å; L15-L17 VanDerWaalsContact C-N 3.27Å; L15-L17 PolarHBondContact O-N 3.33Å; L15-V18 PolarHBondContact O-N 3.01Å; L15-D19 WeakPolarHBondContact O-CB 3.35Å; L15-D19 PolarHBondContact O-N 3Å; L15-F43 HydrophobicContact CD2-CE2 4.1Å; L15-V47 HydrophobicContact CD2-CG2 4.21Å
16	E	92.8	Very high	86.7	Confident	90 Å²	90	86 Å²	86	42%	0.421	48%	0.481	S	S	.	.	H	α-helix	trans	-66	-32.3	172	-66.6	173.5	176.5	0	0	111.5	L12 L13 K20	L12-E16 HydrophobicContact CD2-CB 4.39Å; L12-E16 HydrophobicContact CG-CB 4.12Å; L13-E16 HydrophobicContact CB-CB 4.34Å; L13-E16 HydrophobicContact CB-CG 3.95Å; L13-E16 PolarHBondContact N-OE2 2.91Å; L13-E16 WeakPolarHBondContact O-CA 3.33Å; L13-E16 WeakPolarHBondContact O-CB 3.46Å; L13-E16 PolarHBondContact O-N 3.14Å; E16-K20 WeakPolarHBondContact O-CG 3.36Å; E16-K20 PolarHBondContact O-N 3.26Å
17	L	91.8	Very high	88.3	Confident	83 Å²	83	80.4 Å²	80.4	44%	0.435	45%	0.446	S	S	.	.	H	α-helix	trans	-67.5	-43.4	173.6	-172.8	58.9	0	0	0	111.2	L12 L13 P14 L15 K20 C21 P84	L12-L17 HydrophobicContact CD2-CB 3.79Å; L12-L17 HydrophobicContact CD2-CD1 3.82Å; L12-L17 HydrophobicContact CD2-CG 4.4Å; L13-L17 PolarHBondContact O-N 3.36Å; P14-L17 WeakPolarHBondContact O-CB 3.38Å; P14-L17 PolarHBondContact O-N 3.37Å; P14-L17 VanDerWaalsContact O-N 3.17Å; L15-L17 VanDerWaalsContact C-N 3.27Å; L15-L17 PolarHBondContact O-N 3.33Å; L17-K20 PolarHBondContact O-N 3.24Å; L17-C21 PolarHBondContact O-N 3.2Å; L17-C21 PolarHBondContact O-SG 2.72Å; L17-P84 HydrophobicContact CG-CG 4.44Å
18	V	94.6	Very high	90	Very high	13 Å²	13	74.8 Å²	74.8	8%	0.079	41%	0.411	C	S	.	.	H	α-helix	trans	-66.4	-40.6	178.8	179.2	0	0	0	0	111.1	P14 L15 K20 C21 L40 F43 M49 L82	P14-V18 WeakPolarHBondContact O-CG2 3.45Å; P14-V18 PolarHBondContact O-N 3.21Å; L15-V18 PolarHBondContact O-N 3.01Å; V18-K20 VanDerWaalsContact C-N 3.29Å; V18-K20 PolarHBondContact O-N 3.06Å; V18-C21 WeakPolarHBondContact O-CA 3.46Å; V18-C21 VanDerWaalsContact O-CB 3.26Å; V18-C21 WeakPolarHBondContact O-CB 3.44Å; V18-C21 PolarHBondContact O-N 2.72Å; V18-L40 HydrophobicContact CG1-CD2 4.01Å; V18-F43 HydrophobicContact CB-CE1 4.33Å; V18-F43 HydrophobicContact CB-CZ 4.27Å; V18-F43 HydrophobicContact CG1-CD1 3.74Å; V18-F43 HydrophobicContact CG1-CD2 4.18Å; V18-F43 HydrophobicContact CG1-CE1 3.82Å; V18-F43 HydrophobicContact CG1-CE2 4.27Å; V18-F43 HydrophobicContact CG1-CG 3.94Å; V18-F43 HydrophobicContact CG1-CZ 4.09Å; V18-M49 HydrophobicContact CG1-CE 3.94Å; V18-L82 HydrophobicContact CG2-CD1 3.63Å
19	D	96.1	Very high	91.3	Very high	95 Å²	95	70.2 Å²	70.2	51%	0.508	39%	0.388	S	S	.	.	H	α-helix	trans	-56.8	-42.5	173.6	-175.1	73	0	0	0	112.1	L15 C21 I22 F43	L15-D19 WeakPolarHBondContact O-CB 3.35Å; L15-D19 PolarHBondContact O-N 3Å; D19-C21 PolarHBondContact O-N 2.84Å; D19-C21 VanDerWaalsContact O-N 3.14Å; D19-I22 WeakPolarHBondContact O-CB 3.26Å; D19-I22 VanDerWaalsContact O-CG1 3.3Å; D19-I22 WeakPolarHBondContact O-CG1 3.46Å; D19-I22 PolarHBondContact O-N 2.97Å; D19-I22 VanDerWaalsContact O-N 3.08Å; D19-F43 HydrophobicContact CB-CE1 4.17Å; D19-F43 HydrophobicContact CB-CZ 4.33Å
20	K	94.8	Very high	92.8	Very high	134 Å²	134	65.7 Å²	65.7	58%	0.583	36%	0.357	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.2	-15.4	173.9	-72.3	-178.8	-177.3	-171.4	0	114.5	L12 E16 L17 V18 I22	L12-K20 VanDerWaalsContact CD1-NZ 3.3Å; L12-K20 HydrophobicContact CD2-CD 4.18Å; E16-K20 WeakPolarHBondContact O-CG 3.36Å; E16-K20 PolarHBondContact O-N 3.26Å; L17-K20 PolarHBondContact O-N 3.24Å; V18-K20 VanDerWaalsContact C-N 3.29Å; V18-K20 PolarHBondContact O-N 3.06Å; K20-I22 VanDerWaalsContact C-N 3.35Å
21	C	95.7	Very high	93.9	Very high	8 Å²	8	68 Å²	68	5%	0.054	36%	0.358	C	S	.	.	T	Hydrogen-bonded Turn	trans	-85.2	-8.3	176.3	-59.2	0	0	0	0	112.8	L17 V18 D19 G23 S24 I26 L40 P84	L17-C21 PolarHBondContact O-N 3.2Å; L17-C21 PolarHBondContact O-SG 2.72Å; V18-C21 WeakPolarHBondContact O-CA 3.46Å; V18-C21 VanDerWaalsContact O-CB 3.26Å; V18-C21 WeakPolarHBondContact O-CB 3.44Å; V18-C21 PolarHBondContact O-N 2.72Å; D19-C21 PolarHBondContact O-N 2.84Å; D19-C21 VanDerWaalsContact O-N 3.14Å; C21-G23 PolarHBondContact O-N 3.32Å; C21-S24 WeakPolarHBondContact O-CA 3.4Å; C21-S24 WeakPolarHBondContact O-CB 3.39Å; C21-S24 PolarHBondContact O-N 2.88Å; C21-I26 HydrophobicContact CB-CD1 4.25Å; C21-L40 HydrophobicContact CB-CD2 3.97Å; C21-P84 VanDerWaalsContact SG-CB 3.57Å; C21-P84 VanDerWaalsContact SG-CG 3.55Å
22	I	97.5	Very high	94.4	Very high	71 Å²	71	64.3 Å²	64.3	36%	0.364	35%	0.353	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60.3	133	177	-63.5	171.4	0	0	0	109.6	D19 K20 S24 L40 F43	D19-I22 WeakPolarHBondContact O-CB 3.26Å; D19-I22 VanDerWaalsContact O-CG1 3.3Å; D19-I22 WeakPolarHBondContact O-CG1 3.46Å; D19-I22 PolarHBondContact O-N 2.97Å; D19-I22 VanDerWaalsContact O-N 3.08Å; K20-I22 VanDerWaalsContact C-N 3.35Å; I22-S24 PolarHBondContact O-N 3.01Å; I22-L40 CarbonylContact C-O 3.57Å; I22-L40 WeakPolarHBondContact CA-O 3.36Å; I22-L40 HydrophobicContact CG1-CD2 4.02Å; I22-L40 HydrophobicContact CG1-CG 4.24Å; I22-F43 HydrophobicContact CD1-CD1 4.33Å; I22-F43 HydrophobicContact CD1-CE1 4.17Å
23	G	97.7	Very high	94.6	Very high	56 Å²	56	65.9 Å²	65.9	58%	0.577	36%	0.362	S	S	*	.	T	Hydrogen-bonded Turn	trans	76.7	1.2	-173.1	0	0	0	0	0	114.6	C21 L40	C21-G23 PolarHBondContact O-N 3.32Å; G23-L40 PolarHBondContact N-O 3.28Å
24	S	97.8	Very high	94.8	Very high	59 Å²	59	64.2 Å²	64.2	41%	0.413	35%	0.35	S	S	.	.	S	Bend	trans	-113.5	158.9	179.8	-59.8	0	0	0	0	112	C21 I22 T39 L40	C21-S24 WeakPolarHBondContact O-CA 3.4Å; C21-S24 WeakPolarHBondContact O-CB 3.39Å; C21-S24 PolarHBondContact O-N 2.88Å; I22-S24 PolarHBondContact O-N 3.01Å; S24-T39 WeakPolarHBondContact O-CA 3.43Å; S24-L40 PolarHBondContact O-N 2.9Å
25	R	97.4	Very high	95	Very high	88 Å²	88	61.6 Å²	61.6	33%	0.332	33%	0.329	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-61.9	135.6	171	-154.5	93.3	-164	157.6	11.8	109.5	V37 G38 D53 G85	R25-V37 HydrophobicContact CG-CG1 4.05Å; R25-V37 PolarHBondContact NH2-O 3.23Å; R25-G38 CarbonylContact C-O 3.56Å; R25-G38 WeakPolarHBondContact CA-O 3.41Å; R25-D53 PolarHBondContact NH2-O 2.84Å; R25-G85 VanDerWaalsContact O-CA 3.31Å; R25-G85 WeakPolarHBondContact O-CA 2.92Å; R25-G85 PolarHBondContact O-N 3.32Å
26	I	97.8	Very high	95.2	Very high	1 Å²	1	57.8 Å²	57.8	1%	0.005	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.1	139.4	172.1	-165.8	166.3	0	0	0	109.3	C21 I28 V37 G38 L40 L51 L82	C21-I26 HydrophobicContact CB-CD1 4.25Å; I26-I28 HydrophobicContact CG1-CG1 4.27Å; I26-I28 HydrophobicContact CG2-CD1 4.1Å; I26-I28 HydrophobicContact CG2-CG1 4.04Å; I26-V37 WeakPolarHBondContact O-CA 3.26Å; I26-G38 PolarHBondContact N-O 2.77Å; I26-G38 PolarHBondContact O-N 2.94Å; I26-G38 VanDerWaalsContact O-N 3.13Å; I26-L40 HydrophobicContact CG2-CB 4.09Å; I26-L51 HydrophobicContact CG2-CD2 3.6Å; I26-L82 HydrophobicContact CD1-CB 4.2Å; I26-L82 HydrophobicContact CD1-CD2 4Å
27	H	97.7	Very high	95.4	Very high	16 Å²	16	53.7 Å²	53.7	7%	0.074	29%	0.29	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.6	125	169.1	172.7	-148	0	0	0	109.1	E35 I36 V37 V83	H27-E35 IonicContact CE1-OE2 2.92Å; H27-E35 PolarHBondContact CE1-OE2 3.35Å; H27-E35 WeakPolarHBondContact NE2-CB 3.42Å; H27-E35 IonicContact NE2-OE2 2.88Å; H27-E35 PolarHBondContact NE2-OE2 2.86Å; H27-I36 CarbonylContact C-O 3.57Å; H27-I36 WeakPolarHBondContact CA-O 3.28Å; H27-V37 HydrophobicContact CB-CG2 3.93Å; H27-V83 HydrophobicContact CB-CB 4.11Å; H27-V83 PolarHBondContact N-O 2.82Å; H27-V83 PolarHBondContact O-N 3.26Å
28	I	97.4	Very high	95.7	Very high	0 Å²	0	49.7 Å²	49.7	0%	0	27%	0.269	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.4	118.6	-174.8	-51.7	179	0	0	0	108.4	I26 M30 E35 I36 M49 L51 L74 I79 M81 L82	I26-I28 HydrophobicContact CG1-CG1 4.27Å; I26-I28 HydrophobicContact CG2-CD1 4.1Å; I26-I28 HydrophobicContact CG2-CG1 4.04Å; I28-M30 HydrophobicContact CG2-SD 3.86Å; I28-E35 CarbonylContact O-C 3.59Å; I28-E35 WeakPolarHBondContact O-CA 3.45Å; I28-I36 HydrophobicContact CB-CB 4.37Å; I28-I36 PolarHBondContact N-O 3.15Å; I28-I36 PolarHBondContact O-N 2.76Å; I28-M49 HydrophobicContact CD1-SD 3.54Å; I28-M49 VanDerWaalsContact CD1-SD 3.54Å; I28-L51 HydrophobicContact CD1-CD1 3.55Å; I28-L51 HydrophobicContact CD1-CD2 4.13Å; I28-L51 HydrophobicContact CD1-CG 4.41Å; I28-L74 HydrophobicContact CB-CD2 4.43Å; I28-L74 HydrophobicContact CD1-CD2 3.58Å; I28-L74 HydrophobicContact CG2-CD2 3.86Å; I28-I79 HydrophobicContact CG2-CB 4.46Å; I28-I79 HydrophobicContact CG2-CD1 4.18Å; I28-I79 HydrophobicContact CG2-CG1 3.92Å; I28-I79 HydrophobicContact CG2-CG2 3.96Å; I28-M81 WeakPolarHBondContact CA-O 3.46Å; I28-L82 HydrophobicContact CB-CD2 4.2Å; I28-L82 HydrophobicContact CD1-CD2 4.17Å; I28-L82 HydrophobicContact CG1-CD2 3.69Å; I28-L82 HydrophobicContact CG2-CD2 3.87Å
29	V	96.6	Very high	95.9	Very high	29 Å²	29	50 Å²	50	18%	0.176	27%	0.271	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93	121.9	172.7	-174.9	0	0	0	0	107.8	E35 T80 M81	V29-E35 HydrophobicContact CB-CG 4.44Å; V29-E35 HydrophobicContact CG1-CG 4.18Å; V29-E35 HydrophobicContact CG2-CG 4.21Å; V29-T80 WeakPolarHBondContact O-CA 3.47Å; V29-T80 WeakPolarHBondContact O-CB 3.43Å; V29-T80 PolarHBondContact O-N 3.04Å; V29-M81 HydrophobicContact CB-CB 4.15Å; V29-M81 HydrophobicContact CG2-CB 4.38Å; V29-M81 HydrophobicContact CG2-CE 3.73Å; V29-M81 PolarHBondContact N-O 3.13Å; V29-M81 PolarHBondContact O-N 3.23Å; V29-M81 VanDerWaalsContact O-N 3.15Å
30	M	95.5	Very high	96	Very high	18 Å²	18	45.5 Å²	45.5	9%	0.089	25%	0.247	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-86.9	172.6	-179.7	-57.4	-64.6	-71.9	0	0	111.1	I28 K34 I36 L74 N78 I79 T80	I28-M30 HydrophobicContact CG2-SD 3.86Å; M30-K34 HydrophobicContact CB-CB 4.06Å; M30-K34 VanDerWaalsContact CB-O 3.24Å; M30-K34 WeakPolarHBondContact CB-O 3.3Å; M30-K34 HydrophobicContact CG-CB 4.18Å; M30-K34 PolarHBondContact N-O 3.04Å; M30-I36 HydrophobicContact CG-CD1 4.06Å; M30-I36 HydrophobicContact CG-CG1 4.39Å; M30-I36 HydrophobicContact SD-CD1 4.16Å; M30-L74 HydrophobicContact CE-CD1 3.48Å; M30-L74 VanDerWaalsContact CE-CD1 3.48Å; M30-L74 HydrophobicContact CE-CD2 4.37Å; M30-L74 HydrophobicContact CE-CG 4.02Å; M30-L74 HydrophobicContact SD-CD1 3.8Å; M30-L74 HydrophobicContact SD-CD2 3.77Å; M30-L74 HydrophobicContact SD-CG 4.09Å; M30-N78 CarbonylContact C-O 3.57Å; M30-N78 VanDerWaalsContact C-O 3.31Å; M30-N78 WeakPolarHBondContact CA-O 3.47Å; M30-N78 HydrophobicContact CE-CB 3.44Å; M30-N78 VanDerWaalsContact CE-CB 3.44Å; M30-I79 HydrophobicContact SD-CG1 4.03Å; M30-T80 PolarHBondContact O-OG1 3.13Å
31	K	91.8	Very high	96.2	Very high	119 Å²	119	42.3 Å²	42.3	52%	0.517	24%	0.236	S	C	.	.	S	Bend	trans	-69.5	136.6	158.8	-66.5	179.8	-176.9	166.6	0	106.8	N77 N78 T80	K31-N77 VanDerWaalsContact CE-O 3.25Å; K31-N77 WeakPolarHBondContact CE-O 3.4Å; K31-N77 PolarHBondContact NZ-O 3.44Å; K31-N78 PolarHBondContact N-O 2.84Å; K31-T80 PolarHBondContact N-OG1 2.67Å
32	S	87.4	Confident	96.3	Very high	107 Å²	107	42.8 Å²	42.8	75%	0.748	24%	0.242	S	C	*	.	S	Bend	trans	77.6	-165.4	-171.1	-48.1	0	0	0	0	113.7	K34	S32-K34 PolarHBondContact O-N 3.05Å
33	D	90.1	Very high	96.3	Very high	101 Å²	101	42.1 Å²	42.1	54%	0.54	24%	0.237	S	C	.	.	S	Bend	trans	-82.3	33.2	-168.2	-65.6	-51.6	0	0	0	113.9	E58 I59	D33-E58 CarbonylContact O-C 3.31Å; D33-E58 WeakPolarHBondContact O-CA 3.47Å; D33-I59 HydrophobicContact CB-CB 3.94Å; D33-I59 WeakPolarHBondContact CB-O 3.09Å; D33-I59 PolarHBondContact O-N 2.9Å
34	K	94.6	Very high	96.3	Very high	70 Å²	70	42.4 Å²	42.4	30%	0.304	23%	0.225	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-122	134.3	-175.8	-68.8	-174.6	-178.5	-124.6	0	112.6	M30 S32 E56 F57 E58	M30-K34 HydrophobicContact CB-CB 4.06Å; M30-K34 VanDerWaalsContact CB-O 3.24Å; M30-K34 WeakPolarHBondContact CB-O 3.3Å; M30-K34 HydrophobicContact CG-CB 4.18Å; M30-K34 PolarHBondContact N-O 3.04Å; S32-K34 PolarHBondContact O-N 3.05Å; K34-E56 WeakPolarHBondContact CD-OE1 3.4Å; K34-E56 IonicContact NZ-OE1 2.77Å; K34-E56 PolarHBondContact NZ-OE1 2.92Å; K34-F57 CarbonylContact C-O 3.56Å; K34-F57 WeakPolarHBondContact CA-O 3.5Å; K34-E58 WeakPolarHBondContact CE-OE1 3.36Å; K34-E58 HydrophobicContact CG-CB 4.27Å; K34-E58 HydrophobicContact CG-CG 4.08Å; K34-E58 IonicContact NZ-OE1 2.92Å; K34-E58 PolarHBondContact NZ-OE1 3.1Å; K34-E58 IonicContact NZ-OE2 3.75Å
35	E	96.8	Very high	96.1	Very high	46 Å²	46	46.7 Å²	46.7	22%	0.215	24%	0.243	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-131.1	139.3	174.8	-74.2	178.4	-125.3	0	0	108.9	H27 I28 V29 F57 P89	H27-E35 IonicContact CE1-OE2 2.92Å; H27-E35 PolarHBondContact CE1-OE2 3.35Å; H27-E35 WeakPolarHBondContact NE2-CB 3.42Å; H27-E35 IonicContact NE2-OE2 2.88Å; H27-E35 PolarHBondContact NE2-OE2 2.86Å; I28-E35 CarbonylContact O-C 3.59Å; I28-E35 WeakPolarHBondContact O-CA 3.45Å; V29-E35 HydrophobicContact CB-CG 4.44Å; V29-E35 HydrophobicContact CG1-CG 4.18Å; V29-E35 HydrophobicContact CG2-CG 4.21Å; E35-F57 HydrophobicContact CB-CB 4.26Å; E35-F57 HydrophobicContact CB-CD2 4.44Å; E35-F57 PolarHBondContact N-O 3.12Å; E35-F57 PolarHBondContact O-N 2.74Å; E35-P89 WeakPolarHBondContact OE2-CD 3.25Å; E35-P89 VanDerWaalsContact OE2-CG 3.3Å; E35-P89 WeakPolarHBondContact OE2-CG 3.26Å
36	I	97.3	Very high	96	Very high	9 Å²	9	49.8 Å²	49.8	5%	0.046	26%	0.259	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.1	129	-172.5	-62.4	174.9	0	0	0	108.9	H27 I28 M30 L51 V54 T55 E56 I72 L74	H27-I36 CarbonylContact C-O 3.57Å; H27-I36 WeakPolarHBondContact CA-O 3.28Å; I28-I36 HydrophobicContact CB-CB 4.37Å; I28-I36 PolarHBondContact N-O 3.15Å; I28-I36 PolarHBondContact O-N 2.76Å; M30-I36 HydrophobicContact CG-CD1 4.06Å; M30-I36 HydrophobicContact CG-CG1 4.39Å; M30-I36 HydrophobicContact SD-CD1 4.16Å; I36-L51 HydrophobicContact CG2-CD1 4.02Å; I36-V54 HydrophobicContact CG2-CG1 3.59Å; I36-T55 WeakPolarHBondContact CA-O 3.49Å; I36-E56 HydrophobicContact CG1-CG 4.4Å; I36-I72 HydrophobicContact CD1-CD1 4.13Å; I36-I72 HydrophobicContact CG2-CD1 4.11Å; I36-L74 HydrophobicContact CD1-CD1 3.39Å; I36-L74 HydrophobicContact CD1-CD2 4.2Å; I36-L74 HydrophobicContact CD1-CG 4.43Å
37	V	97.9	Very high	95.9	Very high	4 Å²	4	51.3 Å²	51.3	2%	0.024	27%	0.269	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.2	117.1	177.4	177.2	0	0	0	0	109.4	R25 I26 H27 V54 T55 F57 G88	R25-V37 HydrophobicContact CG-CG1 4.05Å; R25-V37 PolarHBondContact NH2-O 3.23Å; I26-V37 WeakPolarHBondContact O-CA 3.26Å; H27-V37 HydrophobicContact CB-CG2 3.93Å; V37-V54 CarbonylContact O-C 3.54Å; V37-V54 WeakPolarHBondContact O-CA 3.3Å; V37-T55 PolarHBondContact N-O 2.88Å; V37-T55 PolarHBondContact O-N 2.81Å; V37-F57 HydrophobicContact CB-CE2 4.2Å; V37-F57 HydrophobicContact CG2-CD2 4.36Å; V37-F57 HydrophobicContact CG2-CE2 3.74Å; V37-G88 VanDerWaalsContact CG2-CA 3.43Å
38	G	97.9	Very high	95.9	Very high	0 Å²	0	52.3 Å²	52.3	0%	0	28%	0.275	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-154	178	-178.6	0	0	0	0	0	111.9	R25 I26 E52	R25-G38 CarbonylContact C-O 3.56Å; R25-G38 WeakPolarHBondContact CA-O 3.41Å; I26-G38 PolarHBondContact N-O 2.77Å; I26-G38 PolarHBondContact O-N 2.94Å; I26-G38 VanDerWaalsContact O-N 3.13Å; G38-E52 WeakPolarHBondContact CA-O 3.36Å
39	T	98.3	Very high	95.9	Very high	20 Å²	20	52.3 Å²	52.3	12%	0.123	28%	0.275	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.8	123.8	171.1	-58	0	0	0	0	108.7	S24 L41 L51 E52	S24-T39 WeakPolarHBondContact O-CA 3.43Å; T39-L41 PolarHBondContact O-N 3.14Å; T39-L51 VanDerWaalsContact O-CA 3.28Å; T39-L51 WeakPolarHBondContact O-CA 3.35Å; T39-E52 HydrophobicContact CG2-CG 4.34Å; T39-E52 PolarHBondContact N-O 2.8Å; T39-E52 PolarHBondContact O-N 3.3Å
40	L	98.4	Very high	96	Very high	0 Å²	0	53.4 Å²	53.4	0%	0	28%	0.282	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.4	117.9	179.9	-179.7	63.7	0	0	0	110.6	V18 C21 I22 G23 S24 I26 G42 M49 L51	V18-L40 HydrophobicContact CG1-CD2 4.01Å; C21-L40 HydrophobicContact CB-CD2 3.97Å; I22-L40 CarbonylContact C-O 3.57Å; I22-L40 WeakPolarHBondContact CA-O 3.36Å; I22-L40 HydrophobicContact CG1-CD2 4.02Å; I22-L40 HydrophobicContact CG1-CG 4.24Å; G23-L40 PolarHBondContact N-O 3.28Å; S24-L40 PolarHBondContact O-N 2.9Å; I26-L40 HydrophobicContact CG2-CB 4.09Å; L40-G42 WeakPolarHBondContact CD1-O 3.48Å; L40-M49 HydrophobicContact CD1-CB 3.95Å; L40-M49 HydrophobicContact CD1-CG 4.11Å; L40-M49 HydrophobicContact CD1-SD 3.94Å; L40-L51 HydrophobicContact CB-CD2 4.2Å; L40-L51 HydrophobicContact CD1-CD2 4.15Å
41	L	98.3	Very high	96.1	Very high	66 Å²	66	52.6 Å²	52.6	35%	0.346	28%	0.277	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.3	-31.9	175	-69.6	-177.4	0	0	0	112.5	T39 V50 E52	T39-L41 PolarHBondContact O-N 3.14Å; L41-V50 HydrophobicContact CB-CB 4.2Å; L41-V50 HydrophobicContact CB-CG1 4.12Å; L41-V50 WeakPolarHBondContact CB-O 3.36Å; L41-V50 HydrophobicContact CD1-CG1 3.99Å; L41-V50 PolarHBondContact N-O 3.07Å; L41-E52 HydrophobicContact CD1-CB 3.92Å; L41-E52 HydrophobicContact CD1-CG 4.1Å; L41-E52 VanDerWaalsContact CD2-CD 3.46Å; L41-E52 HydrophobicContact CD2-CG 3.95Å; L41-E52 HydrophobicContact CG-CB 4.26Å; L41-E52 HydrophobicContact CG-CG 3.96Å
42	G	98	Very high	96.4	Very high	19 Å²	19	50.3 Å²	50.3	20%	0.196	27%	0.268	C	S	.	.	E	Extended strand (participates in β ladder)	trans	172.9	168.9	178.9	0	0	0	0	0	111.7	L40 M49 V50	L40-G42 WeakPolarHBondContact CD1-O 3.48Å; G42-M49 WeakPolarHBondContact O-CA 3.45Å; G42-V50 PolarHBondContact O-N 2.82Å
43	F	98	Very high	96.9	Very high	56 Å²	56	50 Å²	50	25%	0.246	26%	0.258	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-146.3	166	177.5	70.9	-74.5	0	0	0	110.9	L15 V18 D19 I22 N48 M49	L15-F43 HydrophobicContact CD2-CE2 4.1Å; V18-F43 HydrophobicContact CB-CE1 4.33Å; V18-F43 HydrophobicContact CB-CZ 4.27Å; V18-F43 HydrophobicContact CG1-CD1 3.74Å; V18-F43 HydrophobicContact CG1-CD2 4.18Å; V18-F43 HydrophobicContact CG1-CE1 3.82Å; V18-F43 HydrophobicContact CG1-CE2 4.27Å; V18-F43 HydrophobicContact CG1-CG 3.94Å; V18-F43 HydrophobicContact CG1-CZ 4.09Å; D19-F43 HydrophobicContact CB-CE1 4.17Å; D19-F43 HydrophobicContact CB-CZ 4.33Å; I22-F43 HydrophobicContact CD1-CD1 4.33Å; I22-F43 HydrophobicContact CD1-CE1 4.17Å; F43-N48 CarbonylContact C-O 3.57Å; F43-N48 WeakPolarHBondContact CA-O 3.46Å; F43-N48 WeakPolarHBondContact CB-O 3.25Å; F43-M49 HydrophobicContact CB-CG 4.06Å
44	D	96.5	Very high	97.3	Very high	62 Å²	62	45.2 Å²	45.2	33%	0.332	23%	0.233	S	C	.	.			trans	-111.3	-179.7	175.3	72.2	5.3	0	0	0	112.7	F46 V47 N48	D44-F46 PolarHBondContact O-N 3.45Å; D44-F46 VanDerWaalsContact O-N 3.1Å; D44-F46 WeakPolarHBondContact OD1-CA 3.44Å; D44-F46 PolarHBondContact OD1-N 2.98Å; D44-V47 PolarHBondContact O-N 3.17Å; D44-V47 PolarHBondContact OD1-N 2.99Å; D44-N48 PolarHBondContact N-O 2.83Å; D44-N48 VanDerWaalsContact N-O 3.12Å; D44-N48 WeakPolarHBondContact OD1-CB 3.47Å; D44-N48 PolarHBondContact OD1-N 3.22Å; D44-N48 PolarHBondContact OD1-ND2 2.78Å; D44-N48 PolarHBondContact OD2-ND2 2.94Å
45	D	94.4	Very high	97.4	Very high	149 Å²	149	42.2 Å²	42.2	80%	0.797	22%	0.22	S	C	*	.	T	Hydrogen-bonded Turn	trans	-61.1	-19.5	179.5	-66.5	-25.3	0	0	0	113.9
46	F	94.9	Very high	97.4	Very high	153 Å²	153	41.6 Å²	41.6	67%	0.671	22%	0.218	S	C	*	.	T	Hydrogen-bonded Turn	trans	-95.4	5.2	176.4	-58.1	-75.8	0	0	0	112.5	D44 N48	D44-F46 PolarHBondContact O-N 3.45Å; D44-F46 VanDerWaalsContact O-N 3.1Å; D44-F46 WeakPolarHBondContact OD1-CA 3.44Å; D44-F46 PolarHBondContact OD1-N 2.98Å; F46-N48 PolarHBondContact O-N 2.97Å
47	V	95.5	Very high	97.3	Very high	33 Å²	33	41.9 Å²	41.9	20%	0.2	22%	0.219	C	C	.	.			trans	62.1	27.9	-178.4	-161.6	0	0	0	0	111.7	L15 D44 M49 G76 I79 L82	L15-V47 HydrophobicContact CD2-CG2 4.21Å; D44-V47 PolarHBondContact O-N 3.17Å; D44-V47 PolarHBondContact OD1-N 2.99Å; V47-M49 HydrophobicContact CG1-CE 3.42Å; V47-M49 VanDerWaalsContact CG1-CE 3.42Å; V47-G76 WeakPolarHBondContact O-CA 3.38Å; V47-I79 HydrophobicContact CG1-CD1 4.24Å; V47-I79 WeakPolarHBondContact O-CD1 3.45Å; V47-L82 HydrophobicContact CG1-CD1 4.32Å
48	N	97.3	Very high	97.2	Very high	38 Å²	38	43.9 Å²	43.9	20%	0.203	23%	0.228	C	C	.	.			trans	-68.9	135.6	161.5	-58.1	-56.6	0	0	0	107.9	F43 D44 F46 L74 N75 G76	F43-N48 CarbonylContact C-O 3.57Å; F43-N48 WeakPolarHBondContact CA-O 3.46Å; F43-N48 WeakPolarHBondContact CB-O 3.25Å; D44-N48 PolarHBondContact N-O 2.83Å; D44-N48 VanDerWaalsContact N-O 3.12Å; D44-N48 WeakPolarHBondContact OD1-CB 3.47Å; D44-N48 PolarHBondContact OD1-N 3.22Å; D44-N48 PolarHBondContact OD1-ND2 2.78Å; D44-N48 PolarHBondContact OD2-ND2 2.94Å; F46-N48 PolarHBondContact O-N 2.97Å; N48-L74 CarbonylContact C-O 3.57Å; N48-L74 WeakPolarHBondContact CA-O 3.41Å; N48-L74 WeakPolarHBondContact CB-O 3.43Å; N48-N75 WeakPolarHBondContact OD1-CA 3.35Å; N48-G76 PolarHBondContact OD1-N 2.67Å
49	M	98	Very high	96.9	Very high	0 Å²	0	48.6 Å²	48.6	0%	0	25%	0.252	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.8	137.8	-170.9	-59.8	-169.1	171.4	0	0	112	V18 I28 L40 G42 F43 V47 L51 L73 L74 I79 L82	V18-M49 HydrophobicContact CG1-CE 3.94Å; I28-M49 HydrophobicContact CD1-SD 3.54Å; I28-M49 VanDerWaalsContact CD1-SD 3.54Å; L40-M49 HydrophobicContact CD1-CB 3.95Å; L40-M49 HydrophobicContact CD1-CG 4.11Å; L40-M49 HydrophobicContact CD1-SD 3.94Å; G42-M49 WeakPolarHBondContact O-CA 3.45Å; F43-M49 HydrophobicContact CB-CG 4.06Å; V47-M49 HydrophobicContact CG1-CE 3.42Å; V47-M49 VanDerWaalsContact CG1-CE 3.42Å; M49-L51 HydrophobicContact CB-CG 4.43Å; M49-L73 CarbonylContact O-C 3.56Å; M49-L73 WeakPolarHBondContact O-CA 3.47Å; M49-L74 HydrophobicContact CB-CB 4.25Å; M49-L74 PolarHBondContact N-O 3.07Å; M49-L74 PolarHBondContact O-N 3.07Å; M49-I79 HydrophobicContact CE-CD1 4.12Å; M49-I79 HydrophobicContact CG-CD1 4.23Å; M49-I79 HydrophobicContact SD-CD1 4.1Å; M49-L82 HydrophobicContact CE-CD1 3.41Å; M49-L82 VanDerWaalsContact CE-CD1 3.41Å; M49-L82 HydrophobicContact CE-CD2 3.47Å; M49-L82 VanDerWaalsContact CE-CD2 3.47Å; M49-L82 HydrophobicContact CE-CG 4.08Å; M49-L82 HydrophobicContact SD-CD2 3.99Å
50	V	98.3	Very high	96.5	Very high	52 Å²	52	49.3 Å²	49.3	32%	0.315	26%	0.256	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97	126	165.8	-174.2	0	0	0	0	107.7	L41 G42 Q71 I72 L73	L41-V50 HydrophobicContact CB-CB 4.2Å; L41-V50 HydrophobicContact CB-CG1 4.12Å; L41-V50 WeakPolarHBondContact CB-O 3.36Å; L41-V50 HydrophobicContact CD1-CG1 3.99Å; L41-V50 PolarHBondContact N-O 3.07Å; G42-V50 PolarHBondContact O-N 2.82Å; V50-Q71 HydrophobicContact CG1-CG 4.26Å; V50-I72 WeakPolarHBondContact CA-O 3.2Å; V50-L73 HydrophobicContact CG2-CD1 3.99Å
51	L	98.5	Very high	96.2	Very high	0 Å²	0	55.5 Å²	55.5	0%	0	30%	0.296	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.3	146.6	-179.4	-61.7	153.1	0	0	0	110.1	I26 I28 I36 T39 L40 M49 V54 Q71 I72 L74	I26-L51 HydrophobicContact CG2-CD2 3.6Å; I28-L51 HydrophobicContact CD1-CD1 3.55Å; I28-L51 HydrophobicContact CD1-CD2 4.13Å; I28-L51 HydrophobicContact CD1-CG 4.41Å; I36-L51 HydrophobicContact CG2-CD1 4.02Å; T39-L51 VanDerWaalsContact O-CA 3.28Å; T39-L51 WeakPolarHBondContact O-CA 3.35Å; L40-L51 HydrophobicContact CB-CD2 4.2Å; L40-L51 HydrophobicContact CD1-CD2 4.15Å; M49-L51 HydrophobicContact CB-CG 4.43Å; L51-V54 HydrophobicContact CB-CG2 3.62Å; L51-Q71 CarbonylContact O-C 3.58Å; L51-Q71 VanDerWaalsContact O-CA 3.25Å; L51-Q71 WeakPolarHBondContact O-CA 3.49Å; L51-Q71 WeakPolarHBondContact O-CG 3.49Å; L51-I72 HydrophobicContact CB-CG1 4.11Å; L51-I72 HydrophobicContact CD1-CD1 4.06Å; L51-I72 HydrophobicContact CD1-CG1 4.17Å; L51-I72 PolarHBondContact N-O 2.8Å; L51-I72 VanDerWaalsContact N-O 3.07Å; L51-I72 PolarHBondContact O-N 3.15Å; L51-L74 HydrophobicContact CD1-CB 4.43Å; L51-L74 HydrophobicContact CD1-CD2 4.16Å
52	E	98.3	Very high	95.9	Very high	71 Å²	71	60.2 Å²	60.2	33%	0.332	32%	0.317	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.6	166.8	169.4	67.4	-177.8	-177	0	0	112.2	G38 T39 L41 V54 D70	G38-E52 WeakPolarHBondContact CA-O 3.36Å; T39-E52 HydrophobicContact CG2-CG 4.34Å; T39-E52 PolarHBondContact N-O 2.8Å; T39-E52 PolarHBondContact O-N 3.3Å; L41-E52 HydrophobicContact CD1-CB 3.92Å; L41-E52 HydrophobicContact CD1-CG 4.1Å; L41-E52 VanDerWaalsContact CD2-CD 3.46Å; L41-E52 HydrophobicContact CD2-CG 3.95Å; L41-E52 HydrophobicContact CG-CB 4.26Å; L41-E52 HydrophobicContact CG-CG 3.96Å; E52-V54 VanDerWaalsContact C-N 3.3Å; E52-V54 PolarHBondContact O-N 2.91Å; E52-D70 CarbonylContact C-O 3.55Å; E52-D70 VanDerWaalsContact CA-O 3.26Å; E52-D70 WeakPolarHBondContact CA-O 3.12Å
53	D	97.7	Very high	95.5	Very high	100 Å²	100	60.9 Å²	60.9	54%	0.535	32%	0.324	S	S	.	.	E	Extended strand (participates in β ladder)	trans	51.3	47.8	-179.3	-67.7	-36.2	0	0	0	112.7	R25 D70	R25-D53 PolarHBondContact NH2-O 2.84Å; D53-D70 PolarHBondContact N-O 3.02Å
54	V	97.9	Very high	95.1	Very high	1 Å²	1	62.2 Å²	62.2	1%	0.006	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84	139.7	-164.4	179.4	0	0	0	0	111.8	I36 V37 L51 E52 K68 L69 I72	I36-V54 HydrophobicContact CG2-CG1 3.59Å; V37-V54 CarbonylContact O-C 3.54Å; V37-V54 WeakPolarHBondContact O-CA 3.3Å; L51-V54 HydrophobicContact CB-CG2 3.62Å; E52-V54 VanDerWaalsContact C-N 3.3Å; E52-V54 PolarHBondContact O-N 2.91Å; V54-K68 WeakPolarHBondContact O-CA 3.45Å; V54-L69 HydrophobicContact CB-CB 4.22Å; V54-L69 WeakPolarHBondContact CB-O 3.45Å; V54-L69 PolarHBondContact N-O 2.76Å; V54-L69 PolarHBondContact O-N 2.96Å; V54-I72 HydrophobicContact CB-CG2 4.5Å; V54-I72 HydrophobicContact CG1-CD1 4.13Å; V54-I72 HydrophobicContact CG1-CG2 4.46Å; V54-I72 HydrophobicContact CG2-CG1 4.13Å; V54-I72 HydrophobicContact CG2-CG2 4.33Å
55	T	97.4	Very high	95	Very high	7 Å²	7	66.3 Å²	66.3	4%	0.043	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.2	113.9	166.5	-46	0	0	0	0	108.7	I36 V37 F57 I66 T67 K68	I36-T55 WeakPolarHBondContact CA-O 3.49Å; V37-T55 PolarHBondContact N-O 2.88Å; V37-T55 PolarHBondContact O-N 2.81Å; T55-F57 HydrophobicContact CG2-CD1 4.36Å; T55-F57 HydrophobicContact CG2-CE1 3.71Å; T55-F57 HydrophobicContact CG2-CE2 3.86Å; T55-F57 HydrophobicContact CG2-CZ 3.45Å; T55-F57 VanDerWaalsContact CG2-CZ 3.45Å; T55-I66 HydrophobicContact CG2-CG2 3.64Å; T55-T67 CarbonylContact C-O 3.59Å; T55-T67 WeakPolarHBondContact CA-O 3.33Å; T55-K68 HydrophobicContact CG2-CD 3.99Å; T55-K68 WeakPolarHBondContact OG1-CD 3.24Å; T55-K68 WeakPolarHBondContact OG1-CE 3.18Å; T55-K68 PolarHBondContact OG1-NZ 3.31Å
56	E	96.3	Very high	95.1	Very high	33 Å²	33	63.1 Å²	63.1	15%	0.154	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93	131.6	171.5	-177.9	-174.7	-167	0	0	108.9	K34 I36 I66 T67	K34-E56 WeakPolarHBondContact CD-OE1 3.4Å; K34-E56 IonicContact NZ-OE1 2.77Å; K34-E56 PolarHBondContact NZ-OE1 2.92Å; I36-E56 HydrophobicContact CG1-CG 4.4Å; E56-I66 WeakPolarHBondContact O-CA 3.33Å; E56-T67 PolarHBondContact N-O 2.79Å; E56-T67 PolarHBondContact O-N 2.83Å
57	F	96	Very high	95.1	Very high	16 Å²	16	57.5 Å²	57.5	7%	0.07	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.4	120.7	171.3	-55.1	-76.2	0	0	0	108.1	K34 E35 V37 T55 R64 R65 I66 P89	K34-F57 CarbonylContact C-O 3.56Å; K34-F57 WeakPolarHBondContact CA-O 3.5Å; E35-F57 HydrophobicContact CB-CB 4.26Å; E35-F57 HydrophobicContact CB-CD2 4.44Å; E35-F57 PolarHBondContact N-O 3.12Å; E35-F57 PolarHBondContact O-N 2.74Å; V37-F57 HydrophobicContact CB-CE2 4.2Å; V37-F57 HydrophobicContact CG2-CD2 4.36Å; V37-F57 HydrophobicContact CG2-CE2 3.74Å; T55-F57 HydrophobicContact CG2-CD1 4.36Å; T55-F57 HydrophobicContact CG2-CE1 3.71Å; T55-F57 HydrophobicContact CG2-CE2 3.86Å; T55-F57 HydrophobicContact CG2-CZ 3.45Å; T55-F57 VanDerWaalsContact CG2-CZ 3.45Å; F57-R64 VanDerWaalsContact CD1-CZ 3.47Å; F57-R65 WeakPolarHBondContact CA-O 3.43Å; F57-I66 HydrophobicContact CD1-CB 4.46Å; F57-I66 HydrophobicContact CD1-CD1 4.16Å; F57-I66 HydrophobicContact CD1-CG1 3.91Å; F57-I66 HydrophobicContact CD1-CG2 4.07Å; F57-I66 HydrophobicContact CE1-CD1 4.02Å; F57-I66 HydrophobicContact CE1-CG1 4.21Å; F57-I66 HydrophobicContact CE1-CG2 3.93Å; F57-P89 HydrophobicContact CB-CG 4.49Å; F57-P89 HydrophobicContact CD2-CG 4.42Å; F57-P89 HydrophobicContact CG-CG 4.4Å
58	E	95	Very high	95.2	Very high	46 Å²	46	63.1 Å²	63.1	22%	0.215	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.5	124	179.5	-179.2	175.8	-143.3	0	0	108.8	D33 K34 T60 R64 R65	D33-E58 CarbonylContact O-C 3.31Å; D33-E58 WeakPolarHBondContact O-CA 3.47Å; K34-E58 WeakPolarHBondContact CE-OE1 3.36Å; K34-E58 HydrophobicContact CG-CB 4.27Å; K34-E58 HydrophobicContact CG-CG 4.08Å; K34-E58 IonicContact NZ-OE1 2.92Å; K34-E58 PolarHBondContact NZ-OE1 3.1Å; K34-E58 IonicContact NZ-OE2 3.75Å; E58-T60 HydrophobicContact CG-CG2 3.91Å; E58-T60 PolarHBondContact O-N 2.9Å; E58-R64 CarbonylContact O-C 3.52Å; E58-R64 WeakPolarHBondContact O-CA 3.48Å; E58-R65 HydrophobicContact CB-CB 4.39Å; E58-R65 PolarHBondContact N-O 3.32Å; E58-R65 PolarHBondContact O-N 2.96Å
59	I	91.5	Very high	95.2	Very high	98 Å²	98	64.5 Å²	64.5	50%	0.503	33%	0.327	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.9	114.8	171.9	-51.6	169.2	0	0	0	107.3	D33	D33-I59 HydrophobicContact CB-CB 3.94Å; D33-I59 WeakPolarHBondContact CB-O 3.09Å; D33-I59 PolarHBondContact O-N 2.9Å
60	T	91.1	Very high	95.2	Very high	35 Å²	35	71.4 Å²	71.4	22%	0.215	36%	0.364	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	162	176.6	66.4	0	0	0	0	109.6	E58 E62 G63 R65	E58-T60 HydrophobicContact CG-CG2 3.91Å; E58-T60 PolarHBondContact O-N 2.9Å; T60-E62 PolarHBondContact O-N 3.48Å; T60-E62 VanDerWaalsContact O-N 3.11Å; T60-E62 PolarHBondContact OG1-OE2 2.9Å; T60-G63 WeakPolarHBondContact CA-O 3.36Å; T60-G63 PolarHBondContact N-O 2.76Å; T60-G63 PolarHBondContact O-N 2.85Å; T60-G63 PolarHBondContact OG1-N 2.79Å; T60-G63 PolarHBondContact OG1-O 2.9Å; T60-R65 HydrophobicContact CG2-CB 4.28Å
61	P	91.2	Very high	95.2	Very high	130 Å²	130	74.9 Å²	74.9	84%	0.844	38%	0.377	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.5	-27.2	172.8	-26.3	36	0	0	0	113.8
62	E	91.4	Very high	95.2	Very high	166 Å²	166	76.4 Å²	76.4	78%	0.776	38%	0.384	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.1	-8	178.3	-59.3	73.8	-157	0	0	113.7	T60	T60-E62 PolarHBondContact O-N 3.48Å; T60-E62 VanDerWaalsContact O-N 3.11Å; T60-E62 PolarHBondContact OG1-OE2 2.9Å
63	G	90	Very high	95.2	Very high	33 Å²	33	79.5 Å²	79.5	34%	0.34	40%	0.402	S	S	.	.	E	Extended strand (participates in β ladder)	trans	126.6	-164.6	-177.3	0	0	0	0	0	113.3	T60	T60-G63 WeakPolarHBondContact CA-O 3.36Å; T60-G63 PolarHBondContact N-O 2.76Å; T60-G63 PolarHBondContact O-N 2.85Å; T60-G63 PolarHBondContact OG1-N 2.79Å; T60-G63 PolarHBondContact OG1-O 2.9Å
64	R	90.9	Very high	95.1	Very high	83 Å²	83	75.4 Å²	75.4	31%	0.313	38%	0.38	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.1	118.4	179.8	-175.4	173.1	171.7	-169.3	-3.8	110.6	F57 E58 I66 P89 E90	F57-R64 VanDerWaalsContact CD1-CZ 3.47Å; E58-R64 CarbonylContact O-C 3.52Å; E58-R64 WeakPolarHBondContact O-CA 3.48Å; R64-I66 HydrophobicContact CG-CG1 4.44Å; R64-P89 PolarHBondContact NH1-O 2.77Å; R64-P89 PolarHBondContact NH2-O 2.86Å; R64-E90 PolarHBondContact NH1-O 2.94Å
65	R	94	Very high	95	Very high	149 Å²	149	79 Å²	79	56%	0.562	40%	0.399	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-91.2	131.9	170.8	-177.5	178.5	178.5	170.6	0.7	109.5	F57 E58 T60	F57-R65 WeakPolarHBondContact CA-O 3.43Å; E58-R65 HydrophobicContact CB-CB 4.39Å; E58-R65 PolarHBondContact N-O 3.32Å; E58-R65 PolarHBondContact O-N 2.96Å; T60-R65 HydrophobicContact CG2-CB 4.28Å
66	I	95.2	Very high	94.9	Very high	82 Å²	82	79.2 Å²	79.2	42%	0.421	40%	0.403	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.1	122.7	177.1	-49.3	-175.1	0	0	0	108.5	T55 E56 F57 R64	T55-I66 HydrophobicContact CG2-CG2 3.64Å; E56-I66 WeakPolarHBondContact O-CA 3.33Å; F57-I66 HydrophobicContact CD1-CB 4.46Å; F57-I66 HydrophobicContact CD1-CD1 4.16Å; F57-I66 HydrophobicContact CD1-CG1 3.91Å; F57-I66 HydrophobicContact CD1-CG2 4.07Å; F57-I66 HydrophobicContact CE1-CD1 4.02Å; F57-I66 HydrophobicContact CE1-CG1 4.21Å; F57-I66 HydrophobicContact CE1-CG2 3.93Å; R64-I66 HydrophobicContact CG-CG1 4.44Å
67	T	96.4	Very high	94.9	Very high	35 Å²	35	82.9 Å²	82.9	22%	0.215	42%	0.424	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.8	132.8	178.1	-52.5	0	0	0	0	109.5	T55 E56 L69	T55-T67 CarbonylContact C-O 3.59Å; T55-T67 WeakPolarHBondContact CA-O 3.33Å; E56-T67 PolarHBondContact N-O 2.79Å; E56-T67 PolarHBondContact O-N 2.83Å; T67-L69 HydrophobicContact CG2-CD2 4.05Å; T67-L69 HydrophobicContact CG2-CG 4.14Å
68	K	97.2	Very high	94.8	Very high	151 Å²	151	85.9 Å²	85.9	66%	0.657	44%	0.441	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.3	134.2	173.1	-65.9	-71.7	-175.4	171.6	0	109.2	V54 T55	V54-K68 WeakPolarHBondContact O-CA 3.45Å; T55-K68 HydrophobicContact CG2-CD 3.99Å; T55-K68 WeakPolarHBondContact OG1-CD 3.24Å; T55-K68 WeakPolarHBondContact OG1-CE 3.18Å; T55-K68 PolarHBondContact OG1-NZ 3.31Å
69	L	97.8	Very high	94.9	Very high	67 Å²	67	85 Å²	85	35%	0.351	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.6	140.1	-178.9	-59.6	168.6	0	0	0	108.9	V54 T67 I72	V54-L69 HydrophobicContact CB-CB 4.22Å; V54-L69 WeakPolarHBondContact CB-O 3.45Å; V54-L69 PolarHBondContact N-O 2.76Å; V54-L69 PolarHBondContact O-N 2.96Å; T67-L69 HydrophobicContact CG2-CD2 4.05Å; T67-L69 HydrophobicContact CG2-CG 4.14Å; L69-I72 HydrophobicContact CB-CG2 3.93Å; L69-I72 HydrophobicContact CD1-CG2 3.57Å; L69-I72 HydrophobicContact CG-CG2 4.38Å
70	D	97.8	Very high	95.1	Very high	145 Å²	145	84.7 Å²	84.7	78%	0.775	44%	0.44	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-70.4	-45.3	-177.8	-62	-19.7	0	0	0	111.4	E52 D53	E52-D70 CarbonylContact C-O 3.55Å; E52-D70 VanDerWaalsContact CA-O 3.26Å; E52-D70 WeakPolarHBondContact CA-O 3.12Å; D53-D70 PolarHBondContact N-O 3.02Å
71	Q	97.8	Very high	95.4	Very high	125 Å²	125	87.9 Å²	87.9	58%	0.584	45%	0.454	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-151	143.5	179.2	-171	175.5	63.8	0	0	111	V50 L51	V50-Q71 HydrophobicContact CG1-CG 4.26Å; L51-Q71 CarbonylContact O-C 3.58Å; L51-Q71 VanDerWaalsContact O-CA 3.25Å; L51-Q71 WeakPolarHBondContact O-CA 3.49Å; L51-Q71 WeakPolarHBondContact O-CG 3.49Å
72	I	98.1	Very high	95.6	Very high	31 Å²	31	83.8 Å²	83.8	16%	0.159	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.1	157.3	173.6	76.4	172.2	0	0	0	111.8	I36 V50 L51 V54 L69 L74	I36-I72 HydrophobicContact CD1-CD1 4.13Å; I36-I72 HydrophobicContact CG2-CD1 4.11Å; V50-I72 WeakPolarHBondContact CA-O 3.2Å; L51-I72 HydrophobicContact CB-CG1 4.11Å; L51-I72 HydrophobicContact CD1-CD1 4.06Å; L51-I72 HydrophobicContact CD1-CG1 4.17Å; L51-I72 PolarHBondContact N-O 2.8Å; L51-I72 VanDerWaalsContact N-O 3.07Å; L51-I72 PolarHBondContact O-N 3.15Å; V54-I72 HydrophobicContact CB-CG2 4.5Å; V54-I72 HydrophobicContact CG1-CD1 4.13Å; V54-I72 HydrophobicContact CG1-CG2 4.46Å; V54-I72 HydrophobicContact CG2-CG1 4.13Å; V54-I72 HydrophobicContact CG2-CG2 4.33Å; L69-I72 HydrophobicContact CB-CG2 3.93Å; L69-I72 HydrophobicContact CD1-CG2 3.57Å; L69-I72 HydrophobicContact CG-CG2 4.38Å; I72-L74 HydrophobicContact CD1-CB 4.32Å; I72-L74 HydrophobicContact CD1-CD1 4.2Å
73	L	97.8	Very high	95.9	Very high	136 Å²	136	78.2 Å²	78.2	71%	0.712	40%	0.402	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.6	120.9	158.2	176.6	65.4	0	0	0	108.3	M49 V50	M49-L73 CarbonylContact O-C 3.56Å; M49-L73 WeakPolarHBondContact O-CA 3.47Å; V50-L73 HydrophobicContact CG2-CD1 3.99Å
74	L	96.5	Very high	96.2	Very high	14 Å²	14	79.8 Å²	79.8	7%	0.073	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.9	133.9	-178.3	-168.6	65.3	0	0	0	110.9	I28 M30 I36 N48 M49 L51 I72 I79	I28-L74 HydrophobicContact CB-CD2 4.43Å; I28-L74 HydrophobicContact CD1-CD2 3.58Å; I28-L74 HydrophobicContact CG2-CD2 3.86Å; M30-L74 HydrophobicContact CE-CD1 3.48Å; M30-L74 VanDerWaalsContact CE-CD1 3.48Å; M30-L74 HydrophobicContact CE-CD2 4.37Å; M30-L74 HydrophobicContact CE-CG 4.02Å; M30-L74 HydrophobicContact SD-CD1 3.8Å; M30-L74 HydrophobicContact SD-CD2 3.77Å; M30-L74 HydrophobicContact SD-CG 4.09Å; I36-L74 HydrophobicContact CD1-CD1 3.39Å; I36-L74 HydrophobicContact CD1-CD2 4.2Å; I36-L74 HydrophobicContact CD1-CG 4.43Å; N48-L74 CarbonylContact C-O 3.57Å; N48-L74 WeakPolarHBondContact CA-O 3.41Å; N48-L74 WeakPolarHBondContact CB-O 3.43Å; M49-L74 HydrophobicContact CB-CB 4.25Å; M49-L74 PolarHBondContact N-O 3.07Å; M49-L74 PolarHBondContact O-N 3.07Å; L51-L74 HydrophobicContact CD1-CB 4.43Å; L51-L74 HydrophobicContact CD1-CD2 4.16Å; I72-L74 HydrophobicContact CD1-CB 4.32Å; I72-L74 HydrophobicContact CD1-CD1 4.2Å; L74-I79 HydrophobicContact CD2-CD1 3.98Å; L74-I79 HydrophobicContact CD2-CG1 4.14Å
75	N	95.6	Very high	96.4	Very high	76 Å²	76	78.3 Å²	78.3	41%	0.406	42%	0.417	S	S	.	.			trans	-81	119.4	177	-172.7	-39.4	0	0	0	111.1	N48 N77 N78	N48-N75 WeakPolarHBondContact OD1-CA 3.35Å; N75-N77 VanDerWaalsContact C-N 3.26Å; N75-N77 PolarHBondContact O-N 3.11Å; N75-N77 VanDerWaalsContact OD1-CB 3.26Å; N75-N77 WeakPolarHBondContact OD1-CB 3.38Å; N75-N77 PolarHBondContact OD1-N 3.4Å; N75-N78 PolarHBondContact O-N 2.83Å
76	G	95.9	Very high	96.3	Very high	12 Å²	12	71.9 Å²	71.9	12%	0.124	40%	0.396	C	S	.	.	G	3₁₀ helix	trans	-62.7	-26.7	-177.3	0	0	0	0	0	114.5	V47 N48 N78 I79	V47-G76 WeakPolarHBondContact O-CA 3.38Å; N48-G76 PolarHBondContact OD1-N 2.67Å; G76-N78 PolarHBondContact O-N 2.95Å; G76-N78 VanDerWaalsContact O-N 3.13Å; G76-I79 PolarHBondContact O-N 2.92Å
77	N	95.7	Very high	96.2	Very high	110 Å²	110	76.4 Å²	76.4	59%	0.588	42%	0.416	S	S	*	.	G	3₁₀ helix	trans	-63.5	-23.3	178.9	-70.2	-35	0	0	0	113.2	K31 N75	K31-N77 VanDerWaalsContact CE-O 3.25Å; K31-N77 WeakPolarHBondContact CE-O 3.4Å; K31-N77 PolarHBondContact NZ-O 3.44Å; N75-N77 VanDerWaalsContact C-N 3.26Å; N75-N77 PolarHBondContact O-N 3.11Å; N75-N77 VanDerWaalsContact OD1-CB 3.26Å; N75-N77 WeakPolarHBondContact OD1-CB 3.38Å; N75-N77 PolarHBondContact OD1-N 3.4Å
78	N	94.9	Very high	95.9	Very high	80 Å²	80	75.7 Å²	75.7	43%	0.428	42%	0.416	S	S	.	.	G	3₁₀ helix	trans	-98.6	5.3	-180	-67	-28.8	0	0	0	112.6	M30 K31 N75 G76	M30-N78 CarbonylContact C-O 3.57Å; M30-N78 VanDerWaalsContact C-O 3.31Å; M30-N78 WeakPolarHBondContact CA-O 3.47Å; M30-N78 HydrophobicContact CE-CB 3.44Å; M30-N78 VanDerWaalsContact CE-CB 3.44Å; K31-N78 PolarHBondContact N-O 2.84Å; N75-N78 PolarHBondContact O-N 2.83Å; G76-N78 PolarHBondContact O-N 2.95Å; G76-N78 VanDerWaalsContact O-N 3.13Å
79	I	96.3	Very high	95.5	Very high	27 Å²	27	70.4 Å²	70.4	14%	0.138	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82	132.2	176.6	-62.8	178.2	0	0	0	109.3	I28 M30 V47 M49 L74 G76 L82	I28-I79 HydrophobicContact CG2-CB 4.46Å; I28-I79 HydrophobicContact CG2-CD1 4.18Å; I28-I79 HydrophobicContact CG2-CG1 3.92Å; I28-I79 HydrophobicContact CG2-CG2 3.96Å; M30-I79 HydrophobicContact SD-CG1 4.03Å; V47-I79 HydrophobicContact CG1-CD1 4.24Å; V47-I79 WeakPolarHBondContact O-CD1 3.45Å; M49-I79 HydrophobicContact CE-CD1 4.12Å; M49-I79 HydrophobicContact CG-CD1 4.23Å; M49-I79 HydrophobicContact SD-CD1 4.1Å; L74-I79 HydrophobicContact CD2-CD1 3.98Å; L74-I79 HydrophobicContact CD2-CG1 4.14Å; G76-I79 PolarHBondContact O-N 2.92Å; I79-L82 HydrophobicContact CD1-CD2 4.44Å; I79-L82 HydrophobicContact CG2-CD2 3.84Å; I79-L82 HydrophobicContact CG2-CG 4.01Å
80	T	96.4	Very high	94.5	Very high	92 Å²	92	76.2 Å²	76.2	56%	0.564	42%	0.422	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.8	-44.9	174.8	-57.6	0	0	0	0	111	V29 M30 K31	V29-T80 WeakPolarHBondContact O-CA 3.47Å; V29-T80 WeakPolarHBondContact O-CB 3.43Å; V29-T80 PolarHBondContact O-N 3.04Å; M30-T80 PolarHBondContact O-OG1 3.13Å; K31-T80 PolarHBondContact N-OG1 2.67Å
81	M	95.9	Very high	92.7	Very high	101 Å²	101	77.4 Å²	77.4	50%	0.498	43%	0.434	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.9	147.2	-177	-174.5	172.5	61.6	0	0	111.3	I28 V29 V83	I28-M81 WeakPolarHBondContact CA-O 3.46Å; V29-M81 HydrophobicContact CB-CB 4.15Å; V29-M81 HydrophobicContact CG2-CB 4.38Å; V29-M81 HydrophobicContact CG2-CE 3.73Å; V29-M81 PolarHBondContact N-O 3.13Å; V29-M81 PolarHBondContact O-N 3.23Å; V29-M81 VanDerWaalsContact O-N 3.15Å; M81-V83 HydrophobicContact CE-CG2 3.83Å; M81-V83 HydrophobicContact CG-CG2 4.16Å; M81-V83 HydrophobicContact SD-CG2 4.27Å
82	L	96.7	Very high	92.4	Very high	45 Å²	45	75 Å²	75	24%	0.236	43%	0.427	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	127.4	174.6	-63.5	172.5	0	0	0	108.9	V18 I26 I28 V47 M49 I79	V18-L82 HydrophobicContact CG2-CD1 3.63Å; I26-L82 HydrophobicContact CD1-CB 4.2Å; I26-L82 HydrophobicContact CD1-CD2 4Å; I28-L82 HydrophobicContact CB-CD2 4.2Å; I28-L82 HydrophobicContact CD1-CD2 4.17Å; I28-L82 HydrophobicContact CG1-CD2 3.69Å; I28-L82 HydrophobicContact CG2-CD2 3.87Å; V47-L82 HydrophobicContact CG1-CD1 4.32Å; M49-L82 HydrophobicContact CE-CD1 3.41Å; M49-L82 VanDerWaalsContact CE-CD1 3.41Å; M49-L82 HydrophobicContact CE-CD2 3.47Å; M49-L82 VanDerWaalsContact CE-CD2 3.47Å; M49-L82 HydrophobicContact CE-CG 4.08Å; M49-L82 HydrophobicContact SD-CD2 3.99Å; I79-L82 HydrophobicContact CD1-CD2 4.44Å; I79-L82 HydrophobicContact CG2-CD2 3.84Å; I79-L82 HydrophobicContact CG2-CG 4.01Å
83	V	96.7	Very high	92.1	Very high	48 Å²	48	77.3 Å²	77.3	29%	0.291	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.1	97.8	-179.4	-175.9	0	0	0	0	108.5	H27 M81 G85 G86	H27-V83 HydrophobicContact CB-CB 4.11Å; H27-V83 PolarHBondContact N-O 2.82Å; H27-V83 PolarHBondContact O-N 3.26Å; M81-V83 HydrophobicContact CE-CG2 3.83Å; M81-V83 HydrophobicContact CG-CG2 4.16Å; M81-V83 HydrophobicContact SD-CG2 4.27Å; V83-G85 PolarHBondContact O-N 2.94Å; V83-G86 PolarHBondContact O-N 3.02Å; V83-G86 VanDerWaalsContact O-N 3.15Å
84	P	95.8	Very high	91.8	Very high	67 Å²	67	74.1 Å²	74.1	44%	0.435	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-56.3	129.4	175.1	-25.8	35.7	0	0	0	111.4	L17 C21 G86	L17-P84 HydrophobicContact CG-CG 4.44Å; C21-P84 VanDerWaalsContact SG-CB 3.57Å; C21-P84 VanDerWaalsContact SG-CG 3.55Å; P84-G86 PolarHBondContact O-N 3.25Å
85	G	94.7	Very high	91.5	Very high	52 Å²	52	77.6 Å²	77.6	54%	0.536	45%	0.446	S	S	.	.	T	Hydrogen-bonded Turn	trans	70.8	4.8	-179.7	0	0	0	0	0	115.4	R25 V83	R25-G85 VanDerWaalsContact O-CA 3.31Å; R25-G85 WeakPolarHBondContact O-CA 2.92Å; R25-G85 PolarHBondContact O-N 3.32Å; V83-G85 PolarHBondContact O-N 2.94Å
86	G	93.4	Very high	91.3	Very high	13 Å²	13	77.7 Å²	77.7	13%	0.134	45%	0.449	C	S	.	.			trans	-68	143.7	179.4	0	0	0	0	0	112.8	V83 P84	V83-G86 PolarHBondContact O-N 3.02Å; V83-G86 VanDerWaalsContact O-N 3.15Å; P84-G86 PolarHBondContact O-N 3.25Å
87	E	92	Very high	91	Very high	177 Å²	177	82.1 Å²	82.1	83%	0.827	47%	0.471	S	S	*	.			trans	-97.1	-0.8	-178.7	-60.9	-172	161	0	0	113.4
88	G	90.3	Very high	90.6	Very high	21 Å²	21	80.1 Å²	80.1	22%	0.216	46%	0.462	C	S	.	.			trans	91	-172.4	-174	0	0	0	0	0	112.6	V37	V37-G88 VanDerWaalsContact CG2-CA 3.43Å
89	P	88.9	Confident	90.3	Very high	40 Å²	40	80.1 Å²	80.1	26%	0.26	47%	0.465	S	S	.	.	S	Bend	trans	-68.2	139.5	175.4	6.5	0.2	0	0	0	110.2	E35 F57 R64 V91	E35-P89 WeakPolarHBondContact OE2-CD 3.25Å; E35-P89 VanDerWaalsContact OE2-CG 3.3Å; E35-P89 WeakPolarHBondContact OE2-CG 3.26Å; F57-P89 HydrophobicContact CB-CG 4.49Å; F57-P89 HydrophobicContact CD2-CG 4.42Å; F57-P89 HydrophobicContact CG-CG 4.4Å; R64-P89 PolarHBondContact NH1-O 2.77Å; R64-P89 PolarHBondContact NH2-O 2.86Å; P89-V91 PolarHBondContact O-N 2.73Å
90	E	77.5	Confident	89.8	Confident	189 Å²	189	84.5 Å²	84.5	88%	0.883	49%	0.492	S	S	*	.			trans	-50.8	132	169.8	-65.4	-176.7	176.1	0	0	109.2	R64	R64-E90 PolarHBondContact NH1-O 2.94Å
91	V	59.4	Low	89.2	Confident	169 Å²	169	83.8 Å²	83.8	100%	1.024	49%	0.485	S	S	*	.			trans	-81.6	0	177.8	-178.3	0	0	0	0	109.5	P89	P89-V91 PolarHBondContact O-N 2.73Å

Retrieved 91 of 91 residues in 17 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).