A0A093GVF1_STRCA Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB (G1NLZ1), UniProt , Accession A0A093GVF1, Species STRCA (Struthio camelus australis), Gene n/a, Length 71 aa.

						>A0A093GVF1_STRCA|A0A093GVF1
MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCVIL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.8	Very low	76.5	Confident	254 Å²	254	108 Å²	108	100%	1.251	64%	0.641	S	S	*	*				0	77.1	0	-60.1	-176.9	-150.9	0	0	109.6
2	A	54.7	Low	78.1	Confident	84 Å²	84	103.3 Å²	103.3	69%	0.694	62%	0.623	S	S	*	*			trans	-124.2	-6.4	-173.1	0	0	0	0	0	115	N4	A2-N4 PolarHBondContact O-N 3.47Å
3	S	58.1	Low	79.5	Confident	102 Å²	102	109.1 Å²	109.1	71%	0.713	63%	0.627	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.1	-13.4	-173.3	-67.3	0	0	0	0	116
4	N	64.7	Low	80.8	Confident	142 Å²	142	113.1 Å²	113.1	76%	0.759	63%	0.634	S	S	*	*	H	α-helix	trans	-90.2	-16.8	-174.4	-69.3	5.6	0	0	0	113.7	A2 S8	A2-N4 PolarHBondContact O-N 3.47Å; N4-S8 WeakPolarHBondContact O-CB 3.47Å; N4-S8 PolarHBondContact O-N 3.45Å
5	N	73.6	Confident	81.9	Confident	113 Å²	113	112.5 Å²	112.5	60%	0.604	63%	0.628	S	S	*	*	H	α-helix	trans	-77	-37.1	-172	-151.1	32.1	0	0	0	112.1	I9	N5-I9 VanDerWaalsContact O-CD1 3.31Å; N5-I9 WeakPolarHBondContact O-CD1 3.31Å; N5-I9 WeakPolarHBondContact O-CG1 3.3Å; N5-I9 PolarHBondContact O-N 3.23Å; N5-I9 VanDerWaalsContact O-N 3.07Å
6	T	81.6	Confident	83	Confident	101 Å²	101	109.8 Å²	109.8	62%	0.62	62%	0.615	S	S	*	*	H	α-helix	trans	-71.2	-39.5	-179.7	53.8	0	0	0	0	112.5	I9 A10	T6-I9 PolarHBondContact O-N 3.33Å; T6-A10 WeakPolarHBondContact O-CB 3.31Å; T6-A10 PolarHBondContact O-N 3.28Å
7	A	85.8	Confident	83.9	Confident	51 Å²	51	109.1 Å²	109.1	42%	0.421	61%	0.605	S	S	.	*	H	α-helix	trans	-65.4	-42.9	176	0	0	0	0	0	111.7	A10 Q11	A7-A10 PolarHBondContact O-N 2.74Å; A7-Q11 WeakPolarHBondContact O-CG 3.25Å; A7-Q11 PolarHBondContact O-N 3.3Å
8	S	92.1	Very high	84.7	Confident	64 Å²	64	108.3 Å²	108.3	45%	0.448	60%	0.597	S	S	.	*	H	α-helix	trans	-61.7	-44	175.1	178.9	0	0	0	0	111.9	N4 A10 Q11 A12	N4-S8 WeakPolarHBondContact O-CB 3.47Å; N4-S8 PolarHBondContact O-N 3.45Å; S8-A10 PolarHBondContact O-N 3.26Å; S8-Q11 PolarHBondContact O-N 3.33Å; S8-A12 WeakPolarHBondContact O-CB 3.32Å; S8-A12 PolarHBondContact O-N 3.34Å
9	I	93.5	Very high	85.4	Confident	78 Å²	78	107.4 Å²	107.4	40%	0.4	59%	0.59	S	S	.	*	H	α-helix	trans	-62.5	-41.7	175.9	-69.8	162.1	0	0	0	111.4	N5 T6 A12 R13	N5-I9 VanDerWaalsContact O-CD1 3.31Å; N5-I9 WeakPolarHBondContact O-CD1 3.31Å; N5-I9 WeakPolarHBondContact O-CG1 3.3Å; N5-I9 PolarHBondContact O-N 3.23Å; N5-I9 VanDerWaalsContact O-N 3.07Å; T6-I9 PolarHBondContact O-N 3.33Å; I9-A12 PolarHBondContact O-N 3.36Å; I9-R13 VanDerWaalsContact O-CG 3.3Å; I9-R13 WeakPolarHBondContact O-CG 3.45Å; I9-R13 PolarHBondContact O-N 3.36Å
10	A	93.9	Very high	86	Confident	58 Å²	58	107.4 Å²	107.4	48%	0.479	58%	0.584	S	S	.	*	H	α-helix	trans	-64.2	-41.4	177.9	0	0	0	0	0	112	T6 A7 S8 R13 K14	T6-A10 WeakPolarHBondContact O-CB 3.31Å; T6-A10 PolarHBondContact O-N 3.28Å; A7-A10 PolarHBondContact O-N 2.74Å; S8-A10 PolarHBondContact O-N 3.26Å; A10-R13 PolarHBondContact O-N 3.46Å; A10-K14 PolarHBondContact O-N 3.37Å
11	Q	95.3	Very high	86.6	Confident	141 Å²	141	108.7 Å²	108.7	66%	0.659	59%	0.588	S	S	*	*	H	α-helix	trans	-63.5	-45.7	174.5	-73.3	175	-28.3	0	0	111.9	A7 S8 R13 K14 L15	A7-Q11 WeakPolarHBondContact O-CG 3.25Å; A7-Q11 PolarHBondContact O-N 3.3Å; S8-Q11 PolarHBondContact O-N 3.33Å; Q11-R13 VanDerWaalsContact C-N 3.32Å; Q11-R13 PolarHBondContact O-N 2.85Å; Q11-K14 PolarHBondContact O-N 2.99Å; Q11-L15 PolarHBondContact O-N 3.11Å
12	A	96.1	Very high	89	Confident	52 Å²	52	100.7 Å²	100.7	43%	0.43	55%	0.547	S	S	.	.	H	α-helix	trans	-60.8	-41.7	177.9	0	0	0	0	0	111.8	S8 I9 L15 V16	S8-A12 WeakPolarHBondContact O-CB 3.32Å; S8-A12 PolarHBondContact O-N 3.34Å; I9-A12 PolarHBondContact O-N 3.36Å; A12-L15 PolarHBondContact O-N 3.19Å; A12-V16 WeakPolarHBondContact O-CG2 3.46Å; A12-V16 PolarHBondContact O-N 3.45Å
13	R	96.9	Very high	91	Very high	178 Å²	178	99.5 Å²	99.5	67%	0.672	54%	0.537	S	S	*	.	H	α-helix	trans	-60.8	-47.3	174.3	-73.9	172.1	-177.9	-103.6	1.2	111.6	I9 A10 Q11 L15 V16 E17	I9-R13 VanDerWaalsContact O-CG 3.3Å; I9-R13 WeakPolarHBondContact O-CG 3.45Å; I9-R13 PolarHBondContact O-N 3.36Å; A10-R13 PolarHBondContact O-N 3.46Å; Q11-R13 VanDerWaalsContact C-N 3.32Å; Q11-R13 PolarHBondContact O-N 2.85Å; R13-L15 VanDerWaalsContact C-N 3.29Å; R13-L15 PolarHBondContact O-N 3.37Å; R13-V16 PolarHBondContact O-N 2.95Å; R13-E17 WeakPolarHBondContact O-CG 3.35Å; R13-E17 PolarHBondContact O-N 3.34Å
14	K	97.4	Very high	92.9	Very high	166 Å²	166	101.1 Å²	101.1	72%	0.722	54%	0.538	S	S	*	.	H	α-helix	trans	-58.6	-42.4	177.2	-173.9	-178.5	176.9	-176.3	0	111.7	A10 Q11 E17 Q18	A10-K14 PolarHBondContact O-N 3.37Å; Q11-K14 PolarHBondContact O-N 2.99Å; K14-E17 PolarHBondContact O-N 2.91Å; K14-Q18 PolarHBondContact O-N 3.02Å
15	L	97.7	Very high	94.5	Very high	104 Å²	104	99.3 Å²	99.3	55%	0.545	53%	0.527	S	S	.	.	H	α-helix	trans	-63.6	-42.7	177.1	-179.9	62.4	0	0	0	111.8	Q11 A12 R13 E17 Q18 L19	Q11-L15 PolarHBondContact O-N 3.11Å; A12-L15 PolarHBondContact O-N 3.19Å; R13-L15 VanDerWaalsContact C-N 3.29Å; R13-L15 PolarHBondContact O-N 3.37Å; L15-E17 VanDerWaalsContact C-N 3.34Å; L15-E17 PolarHBondContact O-N 3.48Å; L15-Q18 WeakPolarHBondContact O-CB 3.45Å; L15-Q18 PolarHBondContact O-N 3.26Å; L15-L19 HydrophobicContact CD1-CD1 4.31Å; L15-L19 HydrophobicContact CD1-CG 4.28Å; L15-L19 HydrophobicContact CG-CD1 4.04Å; L15-L19 HydrophobicContact CG-CG 4.44Å; L15-L19 WeakPolarHBondContact O-CG 3.2Å; L15-L19 PolarHBondContact O-N 3.38Å
16	V	98.2	Very high	95.6	Very high	69 Å²	69	101.6 Å²	101.6	42%	0.418	54%	0.539	S	S	.	.	H	α-helix	trans	-62	-43.2	177	168.1	0	0	0	0	111.2	A12 R13 Q18 L19 K20	A12-V16 WeakPolarHBondContact O-CG2 3.46Å; A12-V16 PolarHBondContact O-N 3.45Å; R13-V16 PolarHBondContact O-N 2.95Å; V16-Q18 VanDerWaalsContact C-N 3.33Å; V16-Q18 PolarHBondContact O-N 3.48Å; V16-L19 PolarHBondContact O-N 2.99Å; V16-K20 HydrophobicContact CG1-CD 4.23Å; V16-K20 HydrophobicContact CG1-CG 4.5Å; V16-K20 VanDerWaalsContact O-CG 3.31Å; V16-K20 WeakPolarHBondContact O-CG 3.48Å; V16-K20 PolarHBondContact O-N 3.19Å
17	E	98.2	Very high	96.4	Very high	97 Å²	97	105.6 Å²	105.6	45%	0.453	54%	0.543	S	S	.	.	H	α-helix	trans	-64.1	-38.6	176.7	-64	-48.4	125.3	0	0	112	R13 K14 L15 K20 M21	R13-E17 WeakPolarHBondContact O-CG 3.35Å; R13-E17 PolarHBondContact O-N 3.34Å; K14-E17 PolarHBondContact O-N 2.91Å; L15-E17 VanDerWaalsContact C-N 3.34Å; L15-E17 PolarHBondContact O-N 3.48Å; E17-K20 PolarHBondContact O-N 3.32Å; E17-K20 IonicContact OE1-NZ 2.74Å; E17-K20 PolarHBondContact OE1-NZ 2.94Å; E17-K20 IonicContact OE2-NZ 3.71Å; E17-M21 WeakPolarHBondContact O-CG 3.49Å; E17-M21 PolarHBondContact O-N 3.42Å
18	Q	98.2	Very high	97	Very high	96 Å²	96	108.3 Å²	108.3	45%	0.449	55%	0.549	S	S	.	.	H	α-helix	trans	-61.2	-49.2	173.1	-178.4	63	29.1	0	0	111.9	K14 L15 V16 K20 M21 E22	K14-Q18 PolarHBondContact O-N 3.02Å; L15-Q18 WeakPolarHBondContact O-CB 3.45Å; L15-Q18 PolarHBondContact O-N 3.26Å; V16-Q18 VanDerWaalsContact C-N 3.33Å; V16-Q18 PolarHBondContact O-N 3.48Å; Q18-K20 VanDerWaalsContact C-N 3.3Å; Q18-K20 PolarHBondContact O-N 3.38Å; Q18-M21 WeakPolarHBondContact O-CB 3.45Å; Q18-M21 PolarHBondContact O-N 3.45Å; Q18-M21 VanDerWaalsContact O-N 3.11Å; Q18-E22 WeakPolarHBondContact CG-OE1 3.45Å; Q18-E22 PolarHBondContact NE2-OE1 3.4Å; Q18-E22 PolarHBondContact O-N 2.97Å
19	L	98.4	Very high	97.3	Very high	90 Å²	90	113 Å²	113	47%	0.471	56%	0.562	S	S	.	*	H	α-helix	trans	-64.1	-35.3	-179.2	-70.1	171.8	0	0	0	112.2	L15 V16 M21 E22 A23	L15-L19 HydrophobicContact CD1-CD1 4.31Å; L15-L19 HydrophobicContact CD1-CG 4.28Å; L15-L19 HydrophobicContact CG-CD1 4.04Å; L15-L19 HydrophobicContact CG-CG 4.44Å; L15-L19 WeakPolarHBondContact O-CG 3.2Å; L15-L19 PolarHBondContact O-N 3.38Å; V16-L19 PolarHBondContact O-N 2.99Å; L19-M21 VanDerWaalsContact C-N 3.33Å; L19-E22 PolarHBondContact O-N 2.96Å; L19-A23 VanDerWaalsContact O-CB 3.25Å; L19-A23 WeakPolarHBondContact O-CB 3.37Å; L19-A23 PolarHBondContact O-N 2.91Å
20	K	98.3	Very high	97.5	Very high	107 Å²	107	115.2 Å²	115.2	47%	0.465	58%	0.579	S	S	.	*	H	α-helix	trans	-61.5	-42.2	172.9	-75.6	171.2	-179.6	172.3	0	111.6	V16 E17 Q18 N24	V16-K20 HydrophobicContact CG1-CD 4.23Å; V16-K20 HydrophobicContact CG1-CG 4.5Å; V16-K20 VanDerWaalsContact O-CG 3.31Å; V16-K20 WeakPolarHBondContact O-CG 3.48Å; V16-K20 PolarHBondContact O-N 3.19Å; E17-K20 PolarHBondContact O-N 3.32Å; E17-K20 IonicContact OE1-NZ 2.74Å; E17-K20 PolarHBondContact OE1-NZ 2.94Å; E17-K20 IonicContact OE2-NZ 3.71Å; Q18-K20 VanDerWaalsContact C-N 3.3Å; Q18-K20 PolarHBondContact O-N 3.38Å; K20-N24 VanDerWaalsContact O-CG 3.28Å; K20-N24 PolarHBondContact O-N 3.03Å; K20-N24 PolarHBondContact O-ND2 3.46Å
21	M	98.1	Very high	97.7	Very high	135 Å²	135	116.7 Å²	116.7	67%	0.665	59%	0.585	S	S	*	*	H	α-helix	trans	-63.8	-46.5	175.5	-68.4	-173.7	-176.8	0	0	111.3	E17 Q18 L19 A23 N24	E17-M21 WeakPolarHBondContact O-CG 3.49Å; E17-M21 PolarHBondContact O-N 3.42Å; Q18-M21 WeakPolarHBondContact O-CB 3.45Å; Q18-M21 PolarHBondContact O-N 3.45Å; Q18-M21 VanDerWaalsContact O-N 3.11Å; L19-M21 VanDerWaalsContact C-N 3.33Å; M21-A23 PolarHBondContact O-N 3.21Å; M21-N24 PolarHBondContact O-N 2.98Å
22	E	97.7	Very high	97.9	Very high	87 Å²	87	115.7 Å²	115.7	41%	0.407	58%	0.579	S	S	.	*	H	α-helix	trans	-67.1	-33.2	-179.9	-70.3	175.4	-167	0	0	113.6	Q18 L19 N24 I25 R27	Q18-E22 WeakPolarHBondContact CG-OE1 3.45Å; Q18-E22 PolarHBondContact NE2-OE1 3.4Å; Q18-E22 PolarHBondContact O-N 2.97Å; L19-E22 PolarHBondContact O-N 2.96Å; E22-N24 VanDerWaalsContact C-N 3.27Å; E22-N24 PolarHBondContact O-N 3.32Å; E22-I25 HydrophobicContact CB-CD1 4.44Å; E22-I25 PolarHBondContact O-N 2.97Å; E22-R27 PolarHBondContact O-NH2 3.27Å
23	A	97.6	Very high	98	Very high	59 Å²	59	114.7 Å²	114.7	49%	0.488	57%	0.57	S	S	.	*	H	α-helix	trans	-63.1	-37.4	175	0	0	0	0	0	111.5	L19 M21 I25 R27	L19-A23 VanDerWaalsContact O-CB 3.25Å; L19-A23 WeakPolarHBondContact O-CB 3.37Å; L19-A23 PolarHBondContact O-N 2.91Å; M21-A23 PolarHBondContact O-N 3.21Å; A23-I25 PolarHBondContact O-N 3.42Å; A23-R27 PolarHBondContact O-NH1 3.01Å
24	N	97.4	Very high	98	Very high	136 Å²	136	108.8 Å²	108.8	73%	0.727	56%	0.56	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.3	7.2	-178.4	-68.8	-16.9	0	0	0	114.2	K20 M21 E22 D26	K20-N24 VanDerWaalsContact O-CG 3.28Å; K20-N24 PolarHBondContact O-N 3.03Å; K20-N24 PolarHBondContact O-ND2 3.46Å; M21-N24 PolarHBondContact O-N 2.98Å; E22-N24 VanDerWaalsContact C-N 3.27Å; E22-N24 PolarHBondContact O-N 3.32Å; N24-D26 PolarHBondContact O-N 3.29Å
25	I	97.7	Very high	98.1	Very high	103 Å²	103	103.1 Å²	103.1	53%	0.528	54%	0.544	S	S	.	.	S	Bend	trans	-74.3	125.2	173.1	-61.9	173	0	0	0	109.3	E22 A23 R27	E22-I25 HydrophobicContact CB-CD1 4.44Å; E22-I25 PolarHBondContact O-N 2.97Å; A23-I25 PolarHBondContact O-N 3.42Å; I25-R27 PolarHBondContact O-N 3.07Å; I25-R27 PolarHBondContact O-NH1 3.35Å
26	D	97.9	Very high	98.1	Very high	161 Å²	161	102.3 Å²	102.3	86%	0.861	54%	0.54	S	S	*	.	P	Polyproline II helix	trans	-64.2	122.9	173	-71.9	-42.4	0	0	0	110.7	N24	N24-D26 PolarHBondContact O-N 3.29Å
27	R	97.6	Very high	98.2	Very high	186 Å²	186	104.7 Å²	104.7	70%	0.702	55%	0.55	S	S	*	*	P	Polyproline II helix	trans	-102.3	143.6	-179.5	-65.5	176.6	-175.4	75.5	1.8	110.4	E22 A23 I25	E22-R27 PolarHBondContact O-NH2 3.27Å; A23-R27 PolarHBondContact O-NH1 3.01Å; I25-R27 PolarHBondContact O-N 3.07Å; I25-R27 PolarHBondContact O-NH1 3.35Å
28	I	98	Very high	98.1	Very high	107 Å²	107	105.4 Å²	105.4	55%	0.549	56%	0.555	S	S	.	*	P	Polyproline II helix	trans	-91.5	158.1	167.3	63.5	171.9	0	0	0	110.6	A33	I28-A33 HydrophobicContact CD1-CB 3.74Å; I28-A33 HydrophobicContact CG1-CB 4.25Å
29	K	98.4	Very high	98.2	Very high	164 Å²	164	103.3 Å²	103.3	71%	0.713	55%	0.554	S	S	*	*	P	Polyproline II helix	trans	-63.2	138.7	173.5	-67.3	-175.3	179.6	179.4	0	110	S31 K32 A33	K29-S31 PolarHBondContact O-N 3.31Å; K29-K32 HydrophobicContact CB-CB 4.45Å; K29-K32 WeakPolarHBondContact O-CB 3.49Å; K29-K32 PolarHBondContact O-N 3.49Å; K29-A33 PolarHBondContact O-N 3.07Å
30	V	98.5	Very high	98.2	Very high	124 Å²	124	105.9 Å²	105.9	75%	0.752	56%	0.558	S	S	*	*	H	α-helix	trans	-57.3	-38.8	176.6	178.5	0	0	0	0	111.5	K32 A33 A34	V30-K32 VanDerWaalsContact C-N 3.29Å; V30-K32 PolarHBondContact O-N 3.09Å; V30-A33 PolarHBondContact O-N 2.78Å; V30-A34 WeakPolarHBondContact O-CB 3.4Å; V30-A34 PolarHBondContact O-N 3.09Å
31	S	98.4	Very high	98.2	Very high	88 Å²	88	104.7 Å²	104.7	62%	0.615	56%	0.562	S	S	*	*	H	α-helix	trans	-60.6	-36.9	176.5	56.5	0	0	0	0	113.1	K29 A35	K29-S31 PolarHBondContact O-N 3.31Å; S31-A35 WeakPolarHBondContact O-CB 3.36Å; S31-A35 PolarHBondContact O-N 3.29Å; S31-A35 VanDerWaalsContact O-N 3.09Å
32	K	98.4	Very high	98.1	Very high	120 Å²	120	104.1 Å²	104.1	52%	0.522	56%	0.558	S	S	.	*	H	α-helix	trans	-69.1	-50	174.9	176.6	172.5	178	169.1	0	110.7	K29 V30 A34 A35 D36	K29-K32 HydrophobicContact CB-CB 4.45Å; K29-K32 WeakPolarHBondContact O-CB 3.49Å; K29-K32 PolarHBondContact O-N 3.49Å; V30-K32 VanDerWaalsContact C-N 3.29Å; V30-K32 PolarHBondContact O-N 3.09Å; K32-A34 VanDerWaalsContact C-N 3.25Å; K32-A34 PolarHBondContact O-N 2.94Å; K32-A35 PolarHBondContact O-N 3.27Å; K32-A35 VanDerWaalsContact O-N 3.09Å; K32-D36 VanDerWaalsContact O-CG 3.26Å; K32-D36 PolarHBondContact O-N 3.42Å
33	A	98.5	Very high	98.1	Very high	31 Å²	31	103.3 Å²	103.3	26%	0.256	57%	0.566	S	S	.	*	H	α-helix	trans	-57	-41.6	178.7	0	0	0	0	0	111.9	I28 K29 V30 D36 L37	I28-A33 HydrophobicContact CD1-CB 3.74Å; I28-A33 HydrophobicContact CG1-CB 4.25Å; K29-A33 PolarHBondContact O-N 3.07Å; V30-A33 PolarHBondContact O-N 2.78Å; A33-D36 PolarHBondContact O-N 2.89Å; A33-L37 VanDerWaalsContact O-CG 3.29Å; A33-L37 WeakPolarHBondContact O-CG 3.43Å; A33-L37 PolarHBondContact O-N 3.31Å
34	A	98.5	Very high	98.1	Very high	55 Å²	55	103.9 Å²	103.9	46%	0.455	56%	0.559	S	S	.	*	H	α-helix	trans	-64.7	-41.8	176.4	0	0	0	0	0	112.4	V30 K32 L37 M38	V30-A34 WeakPolarHBondContact O-CB 3.4Å; V30-A34 PolarHBondContact O-N 3.09Å; K32-A34 VanDerWaalsContact C-N 3.25Å; K32-A34 PolarHBondContact O-N 2.94Å; A34-L37 PolarHBondContact O-N 3.44Å; A34-M38 WeakPolarHBondContact O-CB 3.35Å; A34-M38 PolarHBondContact O-N 2.88Å
35	A	98.5	Very high	98	Very high	47 Å²	47	98.6 Å²	98.6	39%	0.388	53%	0.534	S	S	.	.	H	α-helix	trans	-64.4	-42.2	176	0	0	0	0	0	111.9	S31 K32 M38 A39	S31-A35 WeakPolarHBondContact O-CB 3.36Å; S31-A35 PolarHBondContact O-N 3.29Å; S31-A35 VanDerWaalsContact O-N 3.09Å; K32-A35 PolarHBondContact O-N 3.27Å; K32-A35 VanDerWaalsContact O-N 3.09Å; A35-M38 PolarHBondContact O-N 3.01Å; A35-A39 WeakPolarHBondContact O-CB 3.29Å; A35-A39 PolarHBondContact O-N 3.03Å
36	D	98.4	Very high	97.8	Very high	87 Å²	87	102.4 Å²	102.4	47%	0.465	55%	0.546	S	S	.	.	H	α-helix	trans	-63.3	-42.4	178	-64.6	-20.1	0	0	0	110.8	K32 A33 Y40	K32-D36 VanDerWaalsContact O-CG 3.26Å; K32-D36 PolarHBondContact O-N 3.42Å; A33-D36 PolarHBondContact O-N 2.89Å; D36-Y40 WeakPolarHBondContact O-CB 3.48Å; D36-Y40 PolarHBondContact O-N 2.89Å
37	L	98.6	Very high	97.6	Very high	119 Å²	119	101.7 Å²	101.7	62%	0.623	54%	0.538	S	S	*	.	H	α-helix	trans	-63.9	-44.3	174.7	-71.9	172.6	0	0	0	112.2	A33 A34 Y40 C41	A33-L37 VanDerWaalsContact O-CG 3.29Å; A33-L37 WeakPolarHBondContact O-CG 3.43Å; A33-L37 PolarHBondContact O-N 3.31Å; A34-L37 PolarHBondContact O-N 3.44Å; L37-Y40 PolarHBondContact O-N 3.4Å; L37-C41 PolarHBondContact O-N 3.35Å; L37-C41 PolarHBondContact O-SG 3Å; L37-C41 VanDerWaalsContact O-SG 3.33Å
38	M	98.1	Very high	97.6	Very high	111 Å²	111	96.1 Å²	96.1	55%	0.547	52%	0.522	S	S	.	.	H	α-helix	trans	-62	-47.8	178.2	-173.9	177	77.2	0	0	111.1	A34 A35 Y40 C41 E42	A34-M38 WeakPolarHBondContact O-CB 3.35Å; A34-M38 PolarHBondContact O-N 2.88Å; A35-M38 PolarHBondContact O-N 3.01Å; M38-Y40 VanDerWaalsContact C-N 3.28Å; M38-Y40 PolarHBondContact O-N 3.19Å; M38-C41 PolarHBondContact O-N 3.35Å; M38-E42 HydrophobicContact CG-CG 4.43Å; M38-E42 WeakPolarHBondContact O-CB 3.31Å; M38-E42 WeakPolarHBondContact O-CG 3.29Å; M38-E42 PolarHBondContact O-N 3.48Å
39	A	98.4	Very high	97.4	Very high	52 Å²	52	94.5 Å²	94.5	43%	0.43	52%	0.518	S	S	.	.	H	α-helix	trans	-59.7	-40	177.8	0	0	0	0	0	111.9	A35 A43	A35-A39 WeakPolarHBondContact O-CB 3.29Å; A35-A39 PolarHBondContact O-N 3.03Å; A39-A43 VanDerWaalsContact O-CB 3.31Å; A39-A43 WeakPolarHBondContact O-CB 3.36Å; A39-A43 PolarHBondContact O-N 3.24Å
40	Y	98.4	Very high	97.2	Very high	145 Å²	145	94.6 Å²	94.6	57%	0.569	53%	0.526	S	S	*	.	H	α-helix	trans	-62.4	-48.8	175.3	-179	-95.3	0	0	0	111.8	D36 L37 M38 E42 A43 H44	D36-Y40 WeakPolarHBondContact O-CB 3.48Å; D36-Y40 PolarHBondContact O-N 2.89Å; L37-Y40 PolarHBondContact O-N 3.4Å; M38-Y40 VanDerWaalsContact C-N 3.28Å; M38-Y40 PolarHBondContact O-N 3.19Å; Y40-E42 PolarHBondContact O-N 3.33Å; Y40-A43 PolarHBondContact O-N 2.86Å; Y40-H44 AromaticContact CD2-CE1 3.58Å; Y40-H44 AromaticContact CD2-ND1 3.74Å; Y40-H44 AromaticContact CE2-CE1 3.29Å; Y40-H44 WeakPolarHBondContact CE2-CE1 3.31Å; Y40-H44 AromaticContact CE2-ND1 3.62Å; Y40-H44 AromaticContact CE2-NE2 3.96Å; Y40-H44 AromaticContact CZ-CE1 3.88Å; Y40-H44 AromaticContact CZ-ND1 3.86Å; Y40-H44 PolarHBondContact O-N 3.02Å; Y40-H44 PolarHBondContact O-ND1 3.3Å
41	C	98	Very high	97.1	Very high	81 Å²	81	94 Å²	94	55%	0.547	52%	0.518	S	S	.	.	H	α-helix	trans	-61.4	-44.6	178.1	-68.7	0	0	0	0	111.8	L37 M38 A43 H44 A45	L37-C41 PolarHBondContact O-N 3.35Å; L37-C41 PolarHBondContact O-SG 3Å; L37-C41 VanDerWaalsContact O-SG 3.33Å; M38-C41 PolarHBondContact O-N 3.35Å; C41-A43 PolarHBondContact O-N 3.41Å; C41-H44 PolarHBondContact O-N 2.88Å; C41-A45 WeakPolarHBondContact O-CA 3.5Å; C41-A45 VanDerWaalsContact O-CB 3.31Å; C41-A45 WeakPolarHBondContact O-CB 3.46Å; C41-A45 PolarHBondContact O-N 2.93Å
42	E	96.8	Very high	96.8	Very high	124 Å²	124	92.9 Å²	92.9	58%	0.579	51%	0.507	S	S	*	.	H	α-helix	trans	-62.9	-41.2	178.9	-73.5	176.1	174	0	0	112.4	M38 Y40 H44	M38-E42 HydrophobicContact CG-CG 4.43Å; M38-E42 WeakPolarHBondContact O-CB 3.31Å; M38-E42 WeakPolarHBondContact O-CG 3.29Å; M38-E42 PolarHBondContact O-N 3.48Å; Y40-E42 PolarHBondContact O-N 3.33Å; E42-H44 VanDerWaalsContact C-N 3.3Å; E42-H44 PolarHBondContact O-N 2.82Å
43	A	97.6	Very high	96.4	Very high	69 Å²	69	92.5 Å²	92.5	57%	0.57	52%	0.517	S	S	*	.	H	α-helix	trans	-62.9	-36.2	178.6	0	0	0	0	0	112.4	A39 Y40 C41	A39-A43 VanDerWaalsContact O-CB 3.31Å; A39-A43 WeakPolarHBondContact O-CB 3.36Å; A39-A43 PolarHBondContact O-N 3.24Å; Y40-A43 PolarHBondContact O-N 2.86Å; C41-A43 PolarHBondContact O-N 3.41Å
44	H	97.2	Very high	96.1	Very high	72 Å²	72	93.7 Å²	93.7	33%	0.333	52%	0.521	S	S	.	.	H	α-helix	trans	-102.5	-2.9	-175.5	-59	83.5	0	0	0	113.8	Y40 C41 E42 K46 E47 D48	Y40-H44 AromaticContact CD2-CE1 3.58Å; Y40-H44 AromaticContact CD2-ND1 3.74Å; Y40-H44 AromaticContact CE2-CE1 3.29Å; Y40-H44 WeakPolarHBondContact CE2-CE1 3.31Å; Y40-H44 AromaticContact CE2-ND1 3.62Å; Y40-H44 AromaticContact CE2-NE2 3.96Å; Y40-H44 AromaticContact CZ-CE1 3.88Å; Y40-H44 AromaticContact CZ-ND1 3.86Å; Y40-H44 PolarHBondContact O-N 3.02Å; Y40-H44 PolarHBondContact O-ND1 3.3Å; C41-H44 PolarHBondContact O-N 2.88Å; E42-H44 VanDerWaalsContact C-N 3.3Å; E42-H44 PolarHBondContact O-N 2.82Å; H44-K46 PolarHBondContact O-N 2.89Å; H44-K46 VanDerWaalsContact O-N 3.09Å; H44-E47 IonicContact CD2-OE2 3.86Å; H44-E47 PolarHBondContact O-N 3.5Å; H44-D48 PolarHBondContact O-N 3.32Å
45	A	95.9	Very high	95.8	Very high	25 Å²	25	94.3 Å²	94.3	21%	0.207	52%	0.521	C	S	.	.	T	Hydrogen-bonded Turn	trans	-56.6	-31	-176.3	0	0	0	0	0	113.9	C41 L51 T52	C41-A45 WeakPolarHBondContact O-CA 3.5Å; C41-A45 VanDerWaalsContact O-CB 3.31Å; C41-A45 WeakPolarHBondContact O-CB 3.46Å; C41-A45 PolarHBondContact O-N 2.93Å; A45-L51 HydrophobicContact CB-CD2 3.7Å; A45-T52 PolarHBondContact O-OG1 2.85Å
46	K	93.5	Very high	95.3	Very high	182 Å²	182	95.5 Å²	95.5	79%	0.791	53%	0.53	S	S	*	.	T	Hydrogen-bonded Turn	trans	-77.4	-22.6	178.6	-64.9	-178.3	-177.6	175.6	0	113.3	H44	H44-K46 PolarHBondContact O-N 2.89Å; H44-K46 VanDerWaalsContact O-N 3.09Å
47	E	94.3	Very high	94.8	Very high	146 Å²	146	95.2 Å²	95.2	68%	0.682	54%	0.535	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.4	-15.4	-178.7	-62.2	178.6	-169.7	0	0	111.8	H44 P49	H44-E47 IonicContact CD2-OE2 3.86Å; H44-E47 PolarHBondContact O-N 3.5Å; E47-P49 WeakPolarHBondContact O-CD 3.15Å
48	D	96.6	Very high	94.4	Very high	70 Å²	70	95.6 Å²	95.6	37%	0.374	53%	0.534	S	S	.	.			trans	-80.2	108.2	175.1	-174.4	-20.2	0	0	0	110.5	H44 L50 L51 T52	H44-D48 PolarHBondContact O-N 3.32Å; D48-L50 PolarHBondContact O-N 3.09Å; D48-L50 WeakPolarHBondContact OD1-CA 3.41Å; D48-L50 VanDerWaalsContact OD1-CB 3.3Å; D48-L50 WeakPolarHBondContact OD1-CB 3.3Å; D48-L50 PolarHBondContact OD1-N 3.24Å; D48-L51 HydrophobicContact CB-CB 3.98Å; D48-L51 PolarHBondContact O-N 2.86Å; D48-L51 PolarHBondContact OD1-N 3.3Å; D48-T52 PolarHBondContact O-N 3.23Å
49	P	94.4	Very high	94.1	Very high	72 Å²	72	93 Å²	93	47%	0.468	52%	0.522	S	S	.	.	T	Hydrogen-bonded Turn	trans	-69.2	-15.7	-178.3	-19.5	36	0	0	0	113.8	E47 T52 V54	E47-P49 WeakPolarHBondContact O-CD 3.15Å; P49-T52 CarbonylContact C-O 3.57Å; P49-T52 WeakPolarHBondContact CA-O 3.46Å; P49-V54 HydrophobicContact CB-CG1 3.88Å; P49-V54 HydrophobicContact CB-CG2 4.26Å; P49-V54 HydrophobicContact CG-CG1 4.36Å
50	L	94.5	Very high	93.8	Very high	166 Å²	166	96 Å²	96	87%	0.869	54%	0.538	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.8	-29	177.8	-57.1	-180	0	0	0	111.5	D48	D48-L50 PolarHBondContact O-N 3.09Å; D48-L50 WeakPolarHBondContact OD1-CA 3.41Å; D48-L50 VanDerWaalsContact OD1-CB 3.3Å; D48-L50 WeakPolarHBondContact OD1-CB 3.3Å; D48-L50 PolarHBondContact OD1-N 3.24Å
51	L	94.9	Very high	93.4	Very high	113 Å²	113	98 Å²	98	59%	0.592	55%	0.55	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.7	-46.9	174.5	-174.4	61.8	0	0	0	111.7	A45 D48	A45-L51 HydrophobicContact CB-CD2 3.7Å; D48-L51 HydrophobicContact CB-CB 3.98Å; D48-L51 PolarHBondContact O-N 2.86Å; D48-L51 PolarHBondContact OD1-N 3.3Å
52	T	92.7	Very high	92.9	Very high	63 Å²	63	100.5 Å²	100.5	39%	0.387	55%	0.547	S	S	.	.	T	Hydrogen-bonded Turn	trans	-110.6	103.2	176.7	-54.4	0	0	0	0	108.8	A45 D48 P49 V54	A45-T52 PolarHBondContact O-OG1 2.85Å; D48-T52 PolarHBondContact O-N 3.23Å; P49-T52 CarbonylContact C-O 3.57Å; P49-T52 WeakPolarHBondContact CA-O 3.46Å; T52-V54 PolarHBondContact O-N 3.22Å
53	P	90.6	Very high	92.3	Very high	113 Å²	113	103 Å²	103	73%	0.734	56%	0.559	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59	126.8	-175.8	-25.1	34.1	0	0	0	112.1
54	V	92.6	Very high	91.4	Very high	55 Å²	55	107.7 Å²	107.7	33%	0.333	57%	0.566	S	S	.	*	P	Polyproline II helix	trans	-81.3	154.7	174.2	-63.4	0	0	0	0	111.2	P49 T52 E58 N59	P49-V54 HydrophobicContact CB-CG1 3.88Å; P49-V54 HydrophobicContact CB-CG2 4.26Å; P49-V54 HydrophobicContact CG-CG1 4.36Å; T52-V54 PolarHBondContact O-N 3.22Å; V54-E58 HydrophobicContact CB-CB 4.33Å; V54-E58 HydrophobicContact CG2-CB 4.43Å; V54-N59 HydrophobicContact CG2-CB 4.26Å
55	P	91.8	Very high	90.1	Very high	69 Å²	69	112.4 Å²	112.4	45%	0.448	59%	0.586	S	S	.	*	P	Polyproline II helix	trans	-53.9	148.5	173.2	-25.9	35.3	0	0	0	112.1	S57 E58 N59	P55-S57 PolarHBondContact O-N 3.05Å; P55-E58 PolarHBondContact O-N 3.13Å; P55-N59 PolarHBondContact O-N 2.89Å; P55-N59 VanDerWaalsContact O-N 3.13Å
56	A	88.1	Confident	88.9	Confident	71 Å²	71	119.9 Å²	119.9	59%	0.587	61%	0.614	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.7	-27.8	177	0	0	0	0	0	112.2	E58 N59 R62	A56-E58 VanDerWaalsContact C-N 3.26Å; A56-E58 PolarHBondContact O-N 3.48Å; A56-N59 PolarHBondContact O-N 3.38Å; A56-R62 WeakPolarHBondContact O-CB 3.17Å; A56-R62 WeakPolarHBondContact O-CD 3.39Å
57	S	88.5	Confident	87.5	Confident	82 Å²	82	119.7 Å²	119.7	57%	0.573	61%	0.614	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.2	-23.4	175.3	50.6	0	0	0	0	114.4	P55 R62	P55-S57 PolarHBondContact O-N 3.05Å; S57-R62 PolarHBondContact O-NH1 3.2Å
58	E	89.3	Confident	85.8	Confident	126 Å²	126	117.9 Å²	117.9	59%	0.589	62%	0.616	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.5	-22.6	-179.8	-69.8	169.3	-136.1	0	0	111.4	V54 P55 A56 P60	V54-E58 HydrophobicContact CB-CB 4.33Å; V54-E58 HydrophobicContact CG2-CB 4.43Å; P55-E58 PolarHBondContact O-N 3.13Å; A56-E58 VanDerWaalsContact C-N 3.26Å; A56-E58 PolarHBondContact O-N 3.48Å; E58-P60 WeakPolarHBondContact O-CD 2.85Å
59	N	92.8	Very high	84.2	Confident	58 Å²	58	120.1 Å²	120.1	31%	0.31	63%	0.632	S	S	.	*			trans	-69	113.7	175.9	-173.1	-9.5	0	0	0	111.6	V54 P55 A56 F61 R62	V54-N59 HydrophobicContact CG2-CB 4.26Å; P55-N59 PolarHBondContact O-N 2.89Å; P55-N59 VanDerWaalsContact O-N 3.13Å; A56-N59 PolarHBondContact O-N 3.38Å; N59-F61 PolarHBondContact O-N 2.62Å; N59-F61 WeakPolarHBondContact OD1-CA 3.42Å; N59-F61 WeakPolarHBondContact OD1-CB 3.48Å; N59-F61 PolarHBondContact OD1-N 3.18Å; N59-R62 WeakPolarHBondContact O-CB 3.4Å; N59-R62 WeakPolarHBondContact O-CG 3.48Å; N59-R62 PolarHBondContact O-N 2.87Å
60	P	91.1	Very high	82.5	Confident	115 Å²	115	124 Å²	124	75%	0.747	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.6	-21.6	177.6	-20.2	34.5	0	0	0	113.5	E58 R62	E58-P60 WeakPolarHBondContact O-CD 2.85Å; P60-R62 VanDerWaalsContact C-N 3.34Å
61	F	90.6	Very high	80.6	Confident	187 Å²	187	126.8 Å²	126.8	82%	0.82	66%	0.662	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.1	10.3	-180	-55.3	-78.1	0	0	0	113.3	N59	N59-F61 PolarHBondContact O-N 2.62Å; N59-F61 WeakPolarHBondContact OD1-CA 3.42Å; N59-F61 WeakPolarHBondContact OD1-CB 3.48Å; N59-F61 PolarHBondContact OD1-N 3.18Å
62	R	86.4	Confident	79.9	Confident	133 Å²	133	127.5 Å²	127.5	50%	0.502	67%	0.665	S	S	.	*	S	Bend	trans	-60.9	148.9	174.7	77.3	-168.4	-170.6	-153.6	1.2	111.6	A56 S57 N59 P60 K64	A56-R62 WeakPolarHBondContact O-CB 3.17Å; A56-R62 WeakPolarHBondContact O-CD 3.39Å; S57-R62 PolarHBondContact O-NH1 3.2Å; N59-R62 WeakPolarHBondContact O-CB 3.4Å; N59-R62 WeakPolarHBondContact O-CG 3.48Å; N59-R62 PolarHBondContact O-N 2.87Å; P60-R62 VanDerWaalsContact C-N 3.34Å; R62-K64 PolarHBondContact O-N 3.39Å
63	E	84.1	Confident	79.2	Confident	176 Å²	176	130.9 Å²	130.9	82%	0.822	68%	0.68	S	S	*	*			trans	-62.5	131.1	169.7	-67.9	-174.9	176.1	0	0	111	K65	E63-K65 PolarHBondContact O-N 3.22Å
64	K	79.1	Confident	78.6	Confident	167 Å²	167	131.9 Å²	131.9	73%	0.726	68%	0.677	S	S	*	*			trans	-77.2	105.1	173.8	-68.4	179.5	177.9	174.6	0	108.8	R62 F66	R62-K64 PolarHBondContact O-N 3.39Å; K64-F66 HydrophobicContact CB-CE2 4.17Å; K64-F66 HydrophobicContact CB-CZ 4.33Å; K64-F66 HydrophobicContact CD-CZ 4.49Å; K64-F66 PolarHBondContact O-N 3.35Å
65	K	70.8	Confident	77.8	Confident	171 Å²	171	136.4 Å²	136.4	74%	0.743	70%	0.697	S	S	*	*			trans	-72.8	105.6	165.1	-68	-169.4	177.7	-176.8	0	108.6	E63 F67	E63-K65 PolarHBondContact O-N 3.22Å; K65-F67 HydrophobicContact CB-CE2 4.03Å; K65-F67 HydrophobicContact CB-CZ 4.4Å; K65-F67 PolarHBondContact O-N 3.19Å
66	F	70.4	Confident	76.9	Confident	183 Å²	183	140.6 Å²	140.6	80%	0.803	71%	0.713	S	S	*	*			trans	-76.3	109.1	168.7	-65.1	-81.8	0	0	0	108.3	K64 C68	K64-F66 HydrophobicContact CB-CE2 4.17Å; K64-F66 HydrophobicContact CB-CZ 4.33Å; K64-F66 HydrophobicContact CD-CZ 4.49Å; K64-F66 PolarHBondContact O-N 3.35Å; F66-C68 PolarHBondContact O-N 3.38Å
67	F	64.9	Low	76.1	Confident	177 Å²	177	145.3 Å²	145.3	78%	0.776	72%	0.721	S	S	*	*			trans	-83.5	102.9	167	-67.8	-82.2	0	0	0	107.7	K65 V69	K65-F67 HydrophobicContact CB-CE2 4.03Å; K65-F67 HydrophobicContact CB-CZ 4.4Å; K65-F67 PolarHBondContact O-N 3.19Å; F67-V69 PolarHBondContact O-N 3.4Å
68	C	57.8	Low	75.3	Confident	109 Å²	109	149.8 Å²	149.8	74%	0.736	73%	0.732	S	S	*	*			trans	-75	111.4	164.5	-174.6	0	0	0	0	107.5	F66	F66-C68 PolarHBondContact O-N 3.38Å
69	V	61.8	Low	74.2	Confident	116 Å²	116	151.6 Å²	151.6	70%	0.703	74%	0.743	S	S	*	*			trans	-97.1	105.8	165.7	-162.4	0	0	0	0	105.6	F67 L71	F67-V69 PolarHBondContact O-N 3.4Å; V69-L71 PolarHBondContact O-N 3.38Å
70	I	59.3	Low	72.6	Confident	153 Å²	153	159.4 Å²	159.4	79%	0.785	78%	0.779	S	S	*	*			trans	-77.7	111.9	166	-57.7	-179	0	0	0	105.3
71	L	55.3	Low	71	Confident	226 Å²	226	163.5 Å²	163.5	100%	1.183	78%	0.782	S	S	*	*			trans	-77.8	0	170.6	-75.9	168.8	0	0	0	110.5	V69	V69-L71 PolarHBondContact O-N 3.38Å

Retrieved 71 of 71 residues in 15.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).