A0A093H2R1_STRCA Loading...

Guanine nucleotide-binding protein subunit gamma

Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

AlphaFold DB (U3IFA5), UniProt , Accession A0A093H2R1, Species STRCA (Struthio camelus australis), Gene n/a, Length 74 aa.

						>A0A093H2R1_STRCA|A0A093H2R1
MKELMSNSTTNISQARKAVEQLKMEAYMDRMKVSKAAADLLAYCDAHIGEDPLIIPVPASENPFREKKLFCTIL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.7	Low	64.4	Low	211 Å²	211	122.8 Å²	122.8	100%	1.039	64%	0.643	S	S	*	*				0	-29.7	0	-94.5	179.5	-167.8	0	0	115.1
2	K	53.8	Low	66.7	Low	202 Å²	202	120.2 Å²	120.2	88%	0.878	63%	0.629	S	S	*	*	H	α-helix	trans	-67.8	-33	-178.4	-82.3	177.4	173.3	176.4	0	115.3
3	E	53.8	Low	68.6	Low	167 Å²	167	116.1 Å²	116.1	78%	0.78	62%	0.616	S	S	*	*	H	α-helix	trans	-69.6	-41.1	178.4	-94.6	-155.8	138.9	0	0	114.3	M5 S6 N7	E3-M5 VanDerWaalsContact C-N 3.25Å; E3-M5 PolarHBondContact O-N 3.44Å; E3-S6 WeakPolarHBondContact O-CB 3.02Å; E3-S6 PolarHBondContact O-N 2.73Å; E3-N7 PolarHBondContact O-N 3.08Å
4	L	56.2	Low	70.4	Confident	135 Å²	135	116.4 Å²	116.4	71%	0.707	61%	0.613	S	S	*	*	H	α-helix	trans	-62.9	-31.9	179.4	-78.1	153.1	0	0	0	112.7	S8	L4-S8 PolarHBondContact O-N 3.26Å; L4-S8 PolarHBondContact O-OG 3.39Å
5	M	55	Low	72	Confident	136 Å²	136	112 Å²	112	67%	0.67	60%	0.599	S	S	*	*	H	α-helix	trans	-70.7	-38.2	178.1	-156.9	80.2	76.5	0	0	112	E3 S8 T9	E3-M5 VanDerWaalsContact C-N 3.25Å; E3-M5 PolarHBondContact O-N 3.44Å; M5-S8 PolarHBondContact O-N 3.44Å; M5-T9 PolarHBondContact O-N 3.27Å; M5-T9 PolarHBondContact O-OG1 3.31Å
6	S	57	Low	73.5	Confident	65 Å²	65	115.8 Å²	115.8	46%	0.455	60%	0.603	S	S	.	*	H	α-helix	trans	-64.4	-41.7	179.3	170.1	0	0	0	0	113.1	E3 T9 T10	E3-S6 WeakPolarHBondContact O-CB 3.02Å; E3-S6 PolarHBondContact O-N 2.73Å; S6-T9 PolarHBondContact O-OG1 3.43Å; S6-T10 PolarHBondContact O-N 3.33Å; S6-T10 PolarHBondContact O-OG1 3.4Å
7	N	62.2	Low	74.9	Confident	116 Å²	116	118.9 Å²	118.9	62%	0.62	61%	0.61	S	S	*	*	H	α-helix	trans	-71.4	-33.8	177.6	-73.9	-3.3	0	0	0	112	E3 T10 N11	E3-N7 PolarHBondContact O-N 3.08Å; N7-T10 PolarHBondContact O-N 3.21Å; N7-N11 WeakPolarHBondContact O-CB 3.31Å; N7-N11 PolarHBondContact O-N 2.88Å
8	S	66.8	Low	76.1	Confident	64 Å²	64	115.1 Å²	115.1	45%	0.448	60%	0.6	S	S	.	*	H	α-helix	trans	-65.4	-43.1	178.6	-59.5	0	0	0	0	111.7	L4 M5 T10 N11 I12	L4-S8 PolarHBondContact O-N 3.26Å; L4-S8 PolarHBondContact O-OG 3.39Å; M5-S8 PolarHBondContact O-N 3.44Å; S8-T10 PolarHBondContact O-N 3.38Å; S8-N11 PolarHBondContact O-N 3.48Å; S8-I12 WeakPolarHBondContact O-CD1 3.5Å; S8-I12 WeakPolarHBondContact O-CG1 3.3Å; S8-I12 PolarHBondContact O-N 3.41Å
9	T	74.8	Confident	77.2	Confident	84 Å²	84	112.8 Å²	112.8	52%	0.515	59%	0.591	S	S	.	*	H	α-helix	trans	-66.8	-35.4	177.2	47.4	0	0	0	0	113.2	M5 S6 S13	M5-T9 PolarHBondContact O-N 3.27Å; M5-T9 PolarHBondContact O-OG1 3.31Å; S6-T9 PolarHBondContact O-OG1 3.43Å; T9-S13 PolarHBondContact O-N 3.35Å
10	T	81.8	Confident	78.2	Confident	64 Å²	64	112.4 Å²	112.4	39%	0.393	59%	0.586	S	S	.	*	H	α-helix	trans	-71.6	-39.3	177.4	-53	0	0	0	0	111.5	S6 N7 S8 I12 S13 Q14	S6-T10 PolarHBondContact O-N 3.33Å; S6-T10 PolarHBondContact O-OG1 3.4Å; N7-T10 PolarHBondContact O-N 3.21Å; S8-T10 PolarHBondContact O-N 3.38Å; T10-I12 VanDerWaalsContact C-N 3.35Å; T10-S13 PolarHBondContact O-N 3.45Å; T10-S13 PolarHBondContact O-OG 2.92Å; T10-Q14 VanDerWaalsContact O-CG 3.31Å; T10-Q14 WeakPolarHBondContact O-CG 3.36Å; T10-Q14 PolarHBondContact O-N 3.37Å
11	N	89.7	Confident	79.2	Confident	107 Å²	107	111.5 Å²	111.5	57%	0.572	58%	0.579	S	S	*	*	H	α-helix	trans	-65.6	-40.2	175	-164.2	-0.1	0	0	0	111.3	N7 S8 S13 Q14 A15	N7-N11 WeakPolarHBondContact O-CB 3.31Å; N7-N11 PolarHBondContact O-N 2.88Å; S8-N11 PolarHBondContact O-N 3.48Å; N11-S13 PolarHBondContact O-N 2.95Å; N11-Q14 PolarHBondContact O-N 3.48Å; N11-A15 WeakPolarHBondContact O-CB 3.45Å; N11-A15 PolarHBondContact O-N 3.07Å
12	I	91.7	Very high	81.1	Confident	91 Å²	91	106.5 Å²	106.5	47%	0.467	56%	0.556	S	S	.	*	H	α-helix	trans	-63	-41.4	175	-68.8	162.2	0	0	0	111.6	S8 T10 A15 R16	S8-I12 WeakPolarHBondContact O-CD1 3.5Å; S8-I12 WeakPolarHBondContact O-CG1 3.3Å; S8-I12 PolarHBondContact O-N 3.41Å; T10-I12 VanDerWaalsContact C-N 3.35Å; I12-A15 PolarHBondContact O-N 2.97Å; I12-R16 VanDerWaalsContact O-CG 3.28Å; I12-R16 WeakPolarHBondContact O-CG 3.49Å; I12-R16 PolarHBondContact O-N 3.04Å
13	S	91.1	Very high	83.2	Confident	67 Å²	67	101.6 Å²	101.6	47%	0.469	53%	0.534	S	S	.	.	H	α-helix	trans	-68.5	-38.7	178.9	68.5	0	0	0	0	112.1	T9 T10 N11 R16 K17	T9-S13 PolarHBondContact O-N 3.35Å; T10-S13 PolarHBondContact O-N 3.45Å; T10-S13 PolarHBondContact O-OG 2.92Å; N11-S13 PolarHBondContact O-N 2.95Å; S13-R16 PolarHBondContact O-N 3.39Å; S13-K17 PolarHBondContact O-N 2.97Å
14	Q	94.1	Very high	85.3	Confident	121 Å²	121	99.8 Å²	99.8	57%	0.565	53%	0.528	S	S	*	.	H	α-helix	trans	-62.9	-46.6	172.9	-72.8	174.9	-12.6	0	0	111.8	T10 N11 R16 K17 A18	T10-Q14 VanDerWaalsContact O-CG 3.31Å; T10-Q14 WeakPolarHBondContact O-CG 3.36Å; T10-Q14 PolarHBondContact O-N 3.37Å; N11-Q14 PolarHBondContact O-N 3.48Å; Q14-R16 VanDerWaalsContact C-N 3.31Å; Q14-R16 PolarHBondContact O-N 3.01Å; Q14-K17 PolarHBondContact O-N 3.17Å; Q14-A18 PolarHBondContact O-N 3.02Å
15	A	94.8	Very high	87.2	Confident	50 Å²	50	97.4 Å²	97.4	41%	0.413	51%	0.513	S	S	.	.	H	α-helix	trans	-60	-41.7	177.3	0	0	0	0	0	111.8	N11 I12 A18 V19	N11-A15 WeakPolarHBondContact O-CB 3.45Å; N11-A15 PolarHBondContact O-N 3.07Å; I12-A15 PolarHBondContact O-N 2.97Å; A15-A18 PolarHBondContact O-N 3.18Å; A15-V19 WeakPolarHBondContact O-CG2 3.28Å; A15-V19 PolarHBondContact O-N 3.4Å
16	R	96.2	Very high	89.2	Confident	173 Å²	173	93.7 Å²	93.7	65%	0.653	50%	0.504	S	S	*	.	H	α-helix	trans	-61.3	-46.2	174.3	-73	172.7	-174.1	-83.7	0	111.7	I12 S13 Q14 A18 V19 E20	I12-R16 VanDerWaalsContact O-CG 3.28Å; I12-R16 WeakPolarHBondContact O-CG 3.49Å; I12-R16 PolarHBondContact O-N 3.04Å; S13-R16 PolarHBondContact O-N 3.39Å; Q14-R16 VanDerWaalsContact C-N 3.31Å; Q14-R16 PolarHBondContact O-N 3.01Å; R16-A18 VanDerWaalsContact C-N 3.31Å; R16-A18 PolarHBondContact O-N 3.22Å; R16-V19 PolarHBondContact O-N 3.43Å; R16-E20 WeakPolarHBondContact O-CG 3.34Å; R16-E20 PolarHBondContact O-N 3.33Å
17	K	96.4	Very high	91.1	Very high	168 Å²	168	100 Å²	100	73%	0.73	52%	0.519	S	S	*	.	H	α-helix	trans	-59.5	-42.5	176.9	-172.8	-179.6	178	-177	0	111.7	S13 Q14 E20 Q21	S13-K17 PolarHBondContact O-N 2.97Å; Q14-K17 PolarHBondContact O-N 3.17Å; K17-E20 PolarHBondContact O-N 3.47Å; K17-Q21 PolarHBondContact O-N 3.32Å
18	A	96.9	Very high	92.7	Very high	51 Å²	51	100.3 Å²	100.3	42%	0.421	52%	0.518	S	S	.	.	H	α-helix	trans	-63.3	-41.8	176.8	0	0	0	0	0	112	Q14 A15 R16 Q21 L22	Q14-A18 PolarHBondContact O-N 3.02Å; A15-A18 PolarHBondContact O-N 3.18Å; R16-A18 VanDerWaalsContact C-N 3.31Å; R16-A18 PolarHBondContact O-N 3.22Å; A18-Q21 PolarHBondContact O-N 3.41Å; A18-L22 WeakPolarHBondContact O-CB 3.19Å; A18-L22 VanDerWaalsContact O-CG 3.3Å; A18-L22 WeakPolarHBondContact O-CG 3.47Å; A18-L22 PolarHBondContact O-N 2.93Å
19	V	97.6	Very high	94.2	Very high	71 Å²	71	105.2 Å²	105.2	43%	0.43	54%	0.54	S	S	.	.	H	α-helix	trans	-62.6	-43.6	176.4	168.1	0	0	0	0	111.5	A15 R16 Q21 L22 K23	A15-V19 WeakPolarHBondContact O-CG2 3.28Å; A15-V19 PolarHBondContact O-N 3.4Å; R16-V19 PolarHBondContact O-N 3.43Å; V19-Q21 VanDerWaalsContact C-N 3.33Å; V19-Q21 PolarHBondContact O-N 3.01Å; V19-L22 PolarHBondContact O-N 3.19Å; V19-K23 HydrophobicContact CG1-CD 4.3Å; V19-K23 VanDerWaalsContact O-CG 3.31Å; V19-K23 WeakPolarHBondContact O-CG 3.39Å; V19-K23 PolarHBondContact O-N 3.42Å
20	E	97.5	Very high	95.2	Very high	105 Å²	105	110 Å²	110	49%	0.491	55%	0.548	S	S	.	.	H	α-helix	trans	-64.2	-38.7	177.1	-64.7	-48	126.8	0	0	112	R16 K17 K23 M24	R16-E20 WeakPolarHBondContact O-CG 3.34Å; R16-E20 PolarHBondContact O-N 3.33Å; K17-E20 PolarHBondContact O-N 3.47Å; E20-K23 PolarHBondContact O-N 3.08Å; E20-K23 IonicContact OE1-NZ 2.73Å; E20-K23 PolarHBondContact OE1-NZ 3.3Å; E20-K23 IonicContact OE2-NZ 3.63Å; E20-M24 WeakPolarHBondContact O-CG 3.3Å; E20-M24 PolarHBondContact O-N 2.91Å
21	Q	97.8	Very high	95.9	Very high	93 Å²	93	111.9 Å²	111.9	44%	0.435	55%	0.554	S	S	.	*	H	α-helix	trans	-61.5	-50	173.5	-178.5	62.4	25.3	0	0	111.9	K17 A18 V19 K23 M24 E25	K17-Q21 PolarHBondContact O-N 3.32Å; A18-Q21 PolarHBondContact O-N 3.41Å; V19-Q21 VanDerWaalsContact C-N 3.33Å; V19-Q21 PolarHBondContact O-N 3.01Å; Q21-K23 VanDerWaalsContact C-N 3.28Å; Q21-K23 PolarHBondContact O-N 2.77Å; Q21-M24 PolarHBondContact O-N 2.89Å; Q21-M24 VanDerWaalsContact O-N 3.07Å; Q21-E25 WeakPolarHBondContact CG-OE1 3.36Å; Q21-E25 PolarHBondContact NE2-OE1 3.06Å; Q21-E25 PolarHBondContact O-N 3.02Å
22	L	98.1	Very high	96.3	Very high	106 Å²	106	114.5 Å²	114.5	56%	0.555	56%	0.56	S	S	*	*	H	α-helix	trans	-62.7	-35.5	-179.6	-71.6	171.5	0	0	0	112.3	A18 V19 E25 A26	A18-L22 WeakPolarHBondContact O-CB 3.19Å; A18-L22 VanDerWaalsContact O-CG 3.3Å; A18-L22 WeakPolarHBondContact O-CG 3.47Å; A18-L22 PolarHBondContact O-N 2.93Å; V19-L22 PolarHBondContact O-N 3.19Å; L22-E25 PolarHBondContact O-N 3.47Å; L22-A26 VanDerWaalsContact O-CB 3.3Å; L22-A26 WeakPolarHBondContact O-CB 3.36Å; L22-A26 PolarHBondContact O-N 3.03Å
23	K	97.8	Very high	96.7	Very high	100 Å²	100	116.1 Å²	116.1	44%	0.435	57%	0.574	S	S	.	*	H	α-helix	trans	-59.8	-47.9	172.3	-75	171.9	-176.9	169.9	0	110.5	V19 E20 Q21 E25 A26 Y27	V19-K23 HydrophobicContact CG1-CD 4.3Å; V19-K23 VanDerWaalsContact O-CG 3.31Å; V19-K23 WeakPolarHBondContact O-CG 3.39Å; V19-K23 PolarHBondContact O-N 3.42Å; E20-K23 PolarHBondContact O-N 3.08Å; E20-K23 IonicContact OE1-NZ 2.73Å; E20-K23 PolarHBondContact OE1-NZ 3.3Å; E20-K23 IonicContact OE2-NZ 3.63Å; Q21-K23 VanDerWaalsContact C-N 3.28Å; Q21-K23 PolarHBondContact O-N 2.77Å; K23-E25 PolarHBondContact O-N 3.35Å; K23-A26 PolarHBondContact O-N 2.96Å; K23-Y27 WeakPolarHBondContact O-CD2 3.47Å; K23-Y27 PolarHBondContact O-N 3.49Å
24	M	97.3	Very high	97	Very high	129 Å²	129	117.1 Å²	117.1	64%	0.635	58%	0.581	S	S	*	*	H	α-helix	trans	-61.2	-44.5	177.8	-63.8	-140.1	-61.5	0	0	112.1	E20 Q21 A26 Y27 M28	E20-M24 WeakPolarHBondContact O-CG 3.3Å; E20-M24 PolarHBondContact O-N 2.91Å; Q21-M24 PolarHBondContact O-N 2.89Å; Q21-M24 VanDerWaalsContact O-N 3.07Å; M24-A26 VanDerWaalsContact C-N 3.32Å; M24-A26 PolarHBondContact O-N 3.39Å; M24-Y27 PolarHBondContact O-N 3.37Å; M24-M28 PolarHBondContact O-N 2.83Å
25	E	96.7	Very high	97.2	Very high	84 Å²	84	117 Å²	117	39%	0.393	58%	0.579	S	S	.	*	H	α-helix	trans	-66.7	-31.3	178.6	-70.2	175.4	-169.3	0	0	113.5	Q21 L22 K23 Y27 M28 R30	Q21-E25 WeakPolarHBondContact CG-OE1 3.36Å; Q21-E25 PolarHBondContact NE2-OE1 3.06Å; Q21-E25 PolarHBondContact O-N 3.02Å; L22-E25 PolarHBondContact O-N 3.47Å; K23-E25 PolarHBondContact O-N 3.35Å; E25-Y27 VanDerWaalsContact C-N 3.32Å; E25-M28 HydrophobicContact CG-SD 4.41Å; E25-M28 PolarHBondContact O-N 2.88Å; E25-R30 PolarHBondContact O-NH2 3.23Å; E25-R30 VanDerWaalsContact O-NH2 3.08Å
26	A	97.3	Very high	97.3	Very high	59 Å²	59	116.4 Å²	116.4	49%	0.488	57%	0.574	S	S	.	*	H	α-helix	trans	-64.5	-40.1	175.6	0	0	0	0	0	111.4	L22 K23 M24 M28 R30	L22-A26 VanDerWaalsContact O-CB 3.3Å; L22-A26 WeakPolarHBondContact O-CB 3.36Å; L22-A26 PolarHBondContact O-N 3.03Å; K23-A26 PolarHBondContact O-N 2.96Å; M24-A26 VanDerWaalsContact C-N 3.32Å; M24-A26 PolarHBondContact O-N 3.39Å; A26-M28 VanDerWaalsContact C-N 3.29Å; A26-M28 PolarHBondContact O-N 3.44Å; A26-R30 PolarHBondContact O-NH1 2.9Å
27	Y	96.8	Very high	97.5	Very high	198 Å²	198	110.3 Å²	110.3	78%	0.776	56%	0.56	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.5	1.1	179.6	-69.1	-64.4	0	0	0	114.6	K23 M24 E25 D29	K23-Y27 WeakPolarHBondContact O-CD2 3.47Å; K23-Y27 PolarHBondContact O-N 3.49Å; M24-Y27 PolarHBondContact O-N 3.37Å; E25-Y27 VanDerWaalsContact C-N 3.32Å; Y27-D29 PolarHBondContact O-N 3.36Å
28	M	96.5	Very high	97.5	Very high	122 Å²	122	104.7 Å²	104.7	60%	0.601	55%	0.545	S	S	*	.	S	Bend	trans	-66.9	131.1	174.1	-69.9	-179	67.4	0	0	111.3	M24 E25 A26 R30	M24-M28 PolarHBondContact O-N 2.83Å; E25-M28 HydrophobicContact CG-SD 4.41Å; E25-M28 PolarHBondContact O-N 2.88Å; A26-M28 VanDerWaalsContact C-N 3.29Å; A26-M28 PolarHBondContact O-N 3.44Å; M28-R30 PolarHBondContact O-N 3.32Å; M28-R30 PolarHBondContact O-NH1 3.31Å
29	D	96.9	Very high	97.6	Very high	167 Å²	167	106.2 Å²	106.2	89%	0.893	55%	0.546	S	S	*	.			trans	-65.7	127.2	173.3	-72.5	-39.7	0	0	0	110.6	Y27	Y27-D29 PolarHBondContact O-N 3.36Å
30	R	96.6	Very high	97.6	Very high	183 Å²	183	108.5 Å²	108.5	69%	0.691	56%	0.555	S	S	*	*			trans	-106.5	137.7	-179.6	-65.8	176.3	-177.6	76.6	3.4	110.3	E25 A26 M28	E25-R30 PolarHBondContact O-NH2 3.23Å; E25-R30 VanDerWaalsContact O-NH2 3.08Å; A26-R30 PolarHBondContact O-NH1 2.9Å; M28-R30 PolarHBondContact O-N 3.32Å; M28-R30 PolarHBondContact O-NH1 3.31Å
31	M	96.9	Very high	97.7	Very high	105 Å²	105	108.7 Å²	108.7	52%	0.517	56%	0.559	S	S	.	*			trans	-79.8	148.1	168.2	174.5	179.5	-71.6	0	0	110.4	V33 K35 A36	M31-V33 PolarHBondContact O-N 3.24Å; M31-K35 HydrophobicContact CE-CD 4.19Å; M31-K35 HydrophobicContact CE-CG 4.43Å; M31-K35 HydrophobicContact CG-CB 4.1Å; M31-K35 HydrophobicContact CG-CD 4.36Å; M31-K35 HydrophobicContact CG-CG 4.28Å; M31-K35 HydrophobicContact SD-CB 4.23Å; M31-K35 HydrophobicContact SD-CD 4.24Å; M31-K35 HydrophobicContact SD-CG 3.93Å; M31-A36 HydrophobicContact CG-CB 4.4Å; M31-A36 HydrophobicContact SD-CB 3.78Å
32	K	98.2	Very high	97.7	Very high	162 Å²	162	107.1 Å²	107.1	70%	0.704	56%	0.562	S	S	*	*			trans	-61.9	132.2	169.6	-68.8	-168	179	-177.5	0	110.4	S34 K35 A36	K32-S34 PolarHBondContact O-N 3.17Å; K32-K35 HydrophobicContact CB-CB 4.41Å; K32-K35 WeakPolarHBondContact O-CB 3.35Å; K32-K35 PolarHBondContact O-N 3.08Å; K32-A36 PolarHBondContact O-N 2.92Å; K32-A36 VanDerWaalsContact O-N 3.08Å
33	V	98.3	Very high	97.7	Very high	124 Å²	124	109 Å²	109	75%	0.752	56%	0.563	S	S	*	*	H	α-helix	trans	-54.9	-39	177.2	178.6	0	0	0	0	111.6	M31 K35 A36 A37	M31-V33 PolarHBondContact O-N 3.24Å; V33-K35 VanDerWaalsContact C-N 3.28Å; V33-K35 PolarHBondContact O-N 3.41Å; V33-A36 PolarHBondContact O-N 3.3Å; V33-A37 WeakPolarHBondContact O-CB 3.37Å; V33-A37 PolarHBondContact O-N 2.97Å
34	S	98.2	Very high	97.7	Very high	89 Å²	89	107.8 Å²	107.8	62%	0.622	57%	0.566	S	S	*	*	H	α-helix	trans	-60.6	-35.6	177.1	61.4	0	0	0	0	113.2	K32 A38	K32-S34 PolarHBondContact O-N 3.17Å; S34-A38 WeakPolarHBondContact O-CB 3.31Å; S34-A38 PolarHBondContact O-N 3.42Å; S34-A38 VanDerWaalsContact O-N 3.17Å
35	K	98.1	Very high	97.7	Very high	119 Å²	119	107.2 Å²	107.2	52%	0.517	57%	0.565	S	S	.	*	H	α-helix	trans	-73	-49.1	176.4	178.1	170.6	177.8	165.6	0	110.6	M31 K32 V33 A37 A38 D39	M31-K35 HydrophobicContact CE-CD 4.19Å; M31-K35 HydrophobicContact CE-CG 4.43Å; M31-K35 HydrophobicContact CG-CB 4.1Å; M31-K35 HydrophobicContact CG-CD 4.36Å; M31-K35 HydrophobicContact CG-CG 4.28Å; M31-K35 HydrophobicContact SD-CB 4.23Å; M31-K35 HydrophobicContact SD-CD 4.24Å; M31-K35 HydrophobicContact SD-CG 3.93Å; K32-K35 HydrophobicContact CB-CB 4.41Å; K32-K35 WeakPolarHBondContact O-CB 3.35Å; K32-K35 PolarHBondContact O-N 3.08Å; V33-K35 VanDerWaalsContact C-N 3.28Å; V33-K35 PolarHBondContact O-N 3.41Å; K35-A37 PolarHBondContact O-N 3.28Å; K35-A38 PolarHBondContact O-N 2.91Å; K35-A38 VanDerWaalsContact O-N 3.08Å; K35-D39 VanDerWaalsContact O-CG 3.3Å; K35-D39 PolarHBondContact O-N 3Å
36	A	98.3	Very high	97.7	Very high	37 Å²	37	106.5 Å²	106.5	31%	0.306	57%	0.574	S	S	.	*	H	α-helix	trans	-56.7	-41.4	177.7	0	0	0	0	0	111.8	M31 K32 V33 D39 L40	M31-A36 HydrophobicContact CG-CB 4.4Å; M31-A36 HydrophobicContact SD-CB 3.78Å; K32-A36 PolarHBondContact O-N 2.92Å; K32-A36 VanDerWaalsContact O-N 3.08Å; V33-A36 PolarHBondContact O-N 3.3Å; A36-D39 PolarHBondContact O-N 3.41Å; A36-L40 VanDerWaalsContact O-CG 3.29Å; A36-L40 WeakPolarHBondContact O-CG 3.32Å; A36-L40 PolarHBondContact O-N 3.38Å
37	A	98.4	Very high	97.7	Very high	44 Å²	44	107.4 Å²	107.4	36%	0.364	57%	0.568	S	S	.	*	H	α-helix	trans	-64.5	-42.1	176.3	0	0	0	0	0	112.5	V33 K35 L40 L41	V33-A37 WeakPolarHBondContact O-CB 3.37Å; V33-A37 PolarHBondContact O-N 2.97Å; K35-A37 PolarHBondContact O-N 3.28Å; A37-L40 PolarHBondContact O-N 2.87Å; A37-L41 WeakPolarHBondContact O-CG 3.29Å; A37-L41 PolarHBondContact O-N 3.32Å
38	A	98.4	Very high	97.6	Very high	51 Å²	51	101.8 Å²	101.8	42%	0.421	55%	0.55	S	S	.	*	H	α-helix	trans	-64.1	-41.7	176.4	0	0	0	0	0	111.9	S34 K35 L40 L41 A42	S34-A38 WeakPolarHBondContact O-CB 3.31Å; S34-A38 PolarHBondContact O-N 3.42Å; S34-A38 VanDerWaalsContact O-N 3.17Å; K35-A38 PolarHBondContact O-N 2.91Å; K35-A38 VanDerWaalsContact O-N 3.08Å; A38-L40 VanDerWaalsContact C-N 3.35Å; A38-L41 PolarHBondContact O-N 2.9Å; A38-A42 WeakPolarHBondContact O-CB 3.47Å; A38-A42 PolarHBondContact O-N 3.33Å
39	D	98.2	Very high	97.5	Very high	83 Å²	83	98.4 Å²	98.4	44%	0.444	55%	0.546	S	S	.	.	H	α-helix	trans	-64	-41	177.9	-64.9	-17.2	0	0	0	110.9	K35 A36 Y43	K35-D39 VanDerWaalsContact O-CG 3.3Å; K35-D39 PolarHBondContact O-N 3Å; A36-D39 PolarHBondContact O-N 3.41Å; D39-Y43 PolarHBondContact O-N 3.32Å
40	L	98.4	Very high	97.3	Very high	119 Å²	119	97.7 Å²	97.7	62%	0.623	54%	0.538	S	S	*	.	H	α-helix	trans	-63.6	-45	174.6	-72.9	171.9	0	0	0	112.2	A36 A37 A38 Y43 C44	A36-L40 VanDerWaalsContact O-CG 3.29Å; A36-L40 WeakPolarHBondContact O-CG 3.32Å; A36-L40 PolarHBondContact O-N 3.38Å; A37-L40 PolarHBondContact O-N 2.87Å; A38-L40 VanDerWaalsContact C-N 3.35Å; L40-Y43 PolarHBondContact O-N 3.34Å; L40-C44 PolarHBondContact O-N 2.81Å; L40-C44 PolarHBondContact O-SG 3.07Å; L40-C44 VanDerWaalsContact O-SG 3.35Å
41	L	98	Very high	97.3	Very high	109 Å²	109	92 Å²	92	57%	0.571	52%	0.521	S	S	*	.	H	α-helix	trans	-62	-47.2	177.2	-75.1	169.4	0	0	0	111.3	A37 A38 Y43 C44 D45	A37-L41 WeakPolarHBondContact O-CG 3.29Å; A37-L41 PolarHBondContact O-N 3.32Å; A38-L41 PolarHBondContact O-N 2.9Å; L41-Y43 VanDerWaalsContact C-N 3.26Å; L41-Y43 PolarHBondContact O-N 3.03Å; L41-C44 PolarHBondContact O-N 3.31Å; L41-C44 VanDerWaalsContact O-N 3.13Å; L41-D45 PolarHBondContact O-N 3.13Å
42	A	98.3	Very high	97.1	Very high	59 Å²	59	90.5 Å²	90.5	49%	0.488	52%	0.519	S	S	.	.	H	α-helix	trans	-59.3	-39.3	178	0	0	0	0	0	112	A38 A46	A38-A42 WeakPolarHBondContact O-CB 3.47Å; A38-A42 PolarHBondContact O-N 3.33Å; A42-A46 WeakPolarHBondContact O-CB 3.34Å; A42-A46 PolarHBondContact O-N 3.02Å; A42-A46 VanDerWaalsContact O-N 3.07Å
43	Y	98.3	Very high	96.9	Very high	147 Å²	147	90.3 Å²	90.3	58%	0.576	53%	0.525	S	S	*	.	H	α-helix	trans	-63.3	-47.6	174.5	-179.1	-91.4	0	0	0	111.9	D39 L40 L41 A46 H47	D39-Y43 PolarHBondContact O-N 3.32Å; L40-Y43 PolarHBondContact O-N 3.34Å; L41-Y43 VanDerWaalsContact C-N 3.26Å; L41-Y43 PolarHBondContact O-N 3.03Å; Y43-A46 PolarHBondContact O-N 3.13Å; Y43-H47 AromaticContact CD2-CE1 3.65Å; Y43-H47 AromaticContact CD2-ND1 3.77Å; Y43-H47 AromaticContact CE2-CE1 3.4Å; Y43-H47 VanDerWaalsContact CE2-CE1 3.4Å; Y43-H47 WeakPolarHBondContact CE2-CE1 3.45Å; Y43-H47 AromaticContact CE2-ND1 3.68Å; Y43-H47 AromaticContact CZ-CE1 3.94Å; Y43-H47 AromaticContact CZ-ND1 3.87Å; Y43-H47 PolarHBondContact O-N 2.85Å; Y43-H47 PolarHBondContact O-ND1 3.35Å
44	C	97.8	Very high	96.7	Very high	74 Å²	74	89.3 Å²	89.3	50%	0.5	51%	0.514	S	S	.	.	H	α-helix	trans	-60.7	-48.1	177.5	-68.7	0	0	0	0	111.5	L40 L41 A46 H47 I48	L40-C44 PolarHBondContact O-N 2.81Å; L40-C44 PolarHBondContact O-SG 3.07Å; L40-C44 VanDerWaalsContact O-SG 3.35Å; L41-C44 PolarHBondContact O-N 3.31Å; L41-C44 VanDerWaalsContact O-N 3.13Å; C44-A46 VanDerWaalsContact C-N 3.27Å; C44-A46 PolarHBondContact O-N 2.83Å; C44-H47 PolarHBondContact O-N 3.39Å; C44-H47 VanDerWaalsContact O-N 3.13Å; C44-I48 WeakPolarHBondContact O-CB 3.4Å; C44-I48 PolarHBondContact O-N 3.25Å
45	D	96.5	Very high	96.5	Very high	116 Å²	116	89 Å²	89	62%	0.62	51%	0.505	S	S	*	.	H	α-helix	trans	-61.8	-34.8	-179.3	-71.1	-19.7	0	0	0	112.4	L41 I48	L41-D45 PolarHBondContact O-N 3.13Å; D45-I48 WeakPolarHBondContact O-CG2 3.33Å
46	A	97.4	Very high	96.2	Very high	69 Å²	69	88.6 Å²	88.6	57%	0.57	51%	0.514	S	S	*	.	H	α-helix	trans	-70.2	-31.1	177.1	0	0	0	0	0	113.3	A42 Y43 C44	A42-A46 WeakPolarHBondContact O-CB 3.34Å; A42-A46 PolarHBondContact O-N 3.02Å; A42-A46 VanDerWaalsContact O-N 3.07Å; Y43-A46 PolarHBondContact O-N 3.13Å; C44-A46 VanDerWaalsContact C-N 3.27Å; C44-A46 PolarHBondContact O-N 2.83Å
47	H	96.9	Very high	95.8	Very high	78 Å²	78	89.6 Å²	89.6	36%	0.361	52%	0.516	S	S	.	.	H	α-helix	trans	-110.3	-8.7	-172.2	-61.4	83.7	0	0	0	114.2	Y43 C44 G49 E50 D51	Y43-H47 AromaticContact CD2-CE1 3.65Å; Y43-H47 AromaticContact CD2-ND1 3.77Å; Y43-H47 AromaticContact CE2-CE1 3.4Å; Y43-H47 VanDerWaalsContact CE2-CE1 3.4Å; Y43-H47 WeakPolarHBondContact CE2-CE1 3.45Å; Y43-H47 AromaticContact CE2-ND1 3.68Å; Y43-H47 AromaticContact CZ-CE1 3.94Å; Y43-H47 AromaticContact CZ-ND1 3.87Å; Y43-H47 PolarHBondContact O-N 2.85Å; Y43-H47 PolarHBondContact O-ND1 3.35Å; C44-H47 PolarHBondContact O-N 3.39Å; C44-H47 VanDerWaalsContact O-N 3.13Å; H47-G49 PolarHBondContact O-N 3.35Å; H47-G49 VanDerWaalsContact O-N 3.11Å; H47-E50 PolarHBondContact O-N 3.39Å; H47-D51 PolarHBondContact O-N 2.95Å
48	I	95.3	Very high	95.5	Very high	81 Å²	81	90.8 Å²	90.8	42%	0.415	52%	0.521	S	S	.	.	G	3₁₀ helix	trans	-57	-29.7	179.1	-165.2	169.8	0	0	0	112.3	C44 D45 E50 D51 I54 I55	C44-I48 WeakPolarHBondContact O-CB 3.4Å; C44-I48 PolarHBondContact O-N 3.25Å; D45-I48 WeakPolarHBondContact O-CG2 3.33Å; I48-E50 PolarHBondContact O-N 3.11Å; I48-D51 PolarHBondContact O-N 3.48Å; I48-I54 HydrophobicContact CD1-CG2 3.95Å; I48-I54 HydrophobicContact CG1-CB 4.31Å; I48-I54 HydrophobicContact CG1-CG2 3.65Å; I48-I55 WeakPolarHBondContact O-CD1 3.49Å
49	G	93.3	Very high	95	Very high	50 Å²	50	90.6 Å²	90.6	52%	0.515	52%	0.519	S	S	.	.	G	3₁₀ helix	trans	-60.3	-30.8	175.4	0	0	0	0	0	114.1	H47	H47-G49 PolarHBondContact O-N 3.35Å; H47-G49 VanDerWaalsContact O-N 3.11Å
50	E	93.8	Very high	94.6	Very high	153 Å²	153	91.1 Å²	91.1	72%	0.715	53%	0.529	S	S	*	.	G	3₁₀ helix	trans	-101.6	-8.3	-172.1	-59.9	-178.2	176.6	0	0	112.4	H47 I48 P52	H47-E50 PolarHBondContact O-N 3.39Å; I48-E50 PolarHBondContact O-N 3.11Å; E50-P52 WeakPolarHBondContact O-CD 3.44Å
51	D	96	Very high	94.1	Very high	64 Å²	64	91.8 Å²	91.8	34%	0.342	53%	0.529	S	S	.	.			trans	-78.3	108.9	-179.5	-171.7	-27.9	0	0	0	110.7	H47 I48 L53 I54 I55	H47-D51 PolarHBondContact O-N 2.95Å; I48-D51 PolarHBondContact O-N 3.48Å; D51-L53 PolarHBondContact O-N 3.25Å; D51-L53 VanDerWaalsContact O-N 3.14Å; D51-L53 WeakPolarHBondContact OD1-CA 3.13Å; D51-L53 VanDerWaalsContact OD1-CB 3.31Å; D51-L53 WeakPolarHBondContact OD1-CB 3.33Å; D51-L53 PolarHBondContact OD1-N 3.14Å; D51-I54 HydrophobicContact CB-CB 4.17Å; D51-I54 HydrophobicContact CB-CG1 4.09Å; D51-I54 PolarHBondContact O-N 2.86Å; D51-I54 VanDerWaalsContact O-N 3.17Å; D51-I54 PolarHBondContact OD1-N 3.17Å; D51-I55 PolarHBondContact O-N 3.45Å
52	P	93.6	Very high	93.9	Very high	73 Å²	73	89.4 Å²	89.4	47%	0.474	52%	0.517	S	S	.	.	T	Hydrogen-bonded Turn	trans	-66.8	-16.2	-177.2	-21.1	36.7	0	0	0	114.1	E50 I55 V57	E50-P52 WeakPolarHBondContact O-CD 3.44Å; P52-I55 CarbonylContact C-O 3.46Å; P52-I55 WeakPolarHBondContact CA-O 3.31Å; P52-V57 HydrophobicContact CB-CG1 3.82Å; P52-V57 HydrophobicContact CB-CG2 4.4Å; P52-V57 HydrophobicContact CG-CG1 4.27Å
53	L	93	Very high	93.5	Very high	158 Å²	158	91.8 Å²	91.8	83%	0.827	53%	0.527	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86.9	-27	179.2	-58.5	178.6	0	0	0	111.8	D51	D51-L53 PolarHBondContact O-N 3.25Å; D51-L53 VanDerWaalsContact O-N 3.14Å; D51-L53 WeakPolarHBondContact OD1-CA 3.13Å; D51-L53 VanDerWaalsContact OD1-CB 3.31Å; D51-L53 WeakPolarHBondContact OD1-CB 3.33Å; D51-L53 PolarHBondContact OD1-N 3.14Å
54	I	94.5	Very high	93.1	Very high	102 Å²	102	93.5 Å²	93.5	52%	0.523	54%	0.538	S	S	.	.	T	Hydrogen-bonded Turn	trans	-91.2	-45.6	175.5	-56.4	-62.3	0	0	0	110.6	I48 D51 P56	I48-I54 HydrophobicContact CD1-CG2 3.95Å; I48-I54 HydrophobicContact CG1-CB 4.31Å; I48-I54 HydrophobicContact CG1-CG2 3.65Å; D51-I54 HydrophobicContact CB-CB 4.17Å; D51-I54 HydrophobicContact CB-CG1 4.09Å; D51-I54 PolarHBondContact O-N 2.86Å; D51-I54 VanDerWaalsContact O-N 3.17Å; D51-I54 PolarHBondContact OD1-N 3.17Å; I54-P56 WeakPolarHBondContact O-CD 3.49Å
55	I	94	Very high	92.5	Very high	84 Å²	84	96.4 Å²	96.4	43%	0.431	54%	0.539	S	S	.	.	T	Hydrogen-bonded Turn	trans	-109.4	103.4	173.9	-57.8	-174.3	0	0	0	108	I48 D51 P52 V57	I48-I55 WeakPolarHBondContact O-CD1 3.49Å; D51-I55 PolarHBondContact O-N 3.45Å; P52-I55 CarbonylContact C-O 3.46Å; P52-I55 WeakPolarHBondContact CA-O 3.31Å; I55-V57 PolarHBondContact O-N 2.87Å
56	P	91.1	Very high	91.8	Very high	110 Å²	110	99.4 Å²	99.4	71%	0.714	55%	0.549	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.6	127.2	-177.4	-24.4	34.1	0	0	0	111.9	I54	I54-P56 WeakPolarHBondContact O-CD 3.49Å
57	V	91.7	Very high	90.7	Very high	57 Å²	57	104 Å²	104	35%	0.345	56%	0.556	S	S	.	*	P	Polyproline II helix	trans	-75.1	153.6	174.2	-65.2	0	0	0	0	111.4	P52 I55 E61 N62	P52-V57 HydrophobicContact CB-CG1 3.82Å; P52-V57 HydrophobicContact CB-CG2 4.4Å; P52-V57 HydrophobicContact CG-CG1 4.27Å; I55-V57 PolarHBondContact O-N 2.87Å; V57-E61 HydrophobicContact CB-CB 4.37Å; V57-N62 HydrophobicContact CG2-CB 4.17Å
58	P	91.6	Very high	89.3	Confident	70 Å²	70	109.3 Å²	109.3	46%	0.455	58%	0.578	S	S	.	*	P	Polyproline II helix	trans	-54.9	148.8	173.5	-25.2	34.7	0	0	0	112.3	S60 E61 N62	P58-S60 PolarHBondContact O-N 2.93Å; P58-E61 PolarHBondContact O-N 3.05Å; P58-N62 PolarHBondContact O-N 3.12Å; P58-N62 VanDerWaalsContact O-N 3.12Å
59	A	87.9	Confident	87.8	Confident	47 Å²	47	112.3 Å²	112.3	39%	0.388	59%	0.594	S	S	.	*	T	Hydrogen-bonded Turn	trans	-55.6	-29.5	-179.6	0	0	0	0	0	113.4	E61 R65	A59-E61 VanDerWaalsContact C-N 3.34Å; A59-R65 HydrophobicContact CB-CG 3.92Å; A59-R65 VanDerWaalsContact O-CB 3.23Å; A59-R65 WeakPolarHBondContact O-CB 3.2Å; A59-R65 WeakPolarHBondContact O-CD 3.1Å; A59-R65 VanDerWaalsContact O-CG 3.29Å; A59-R65 WeakPolarHBondContact O-CG 3.29Å
60	S	89	Confident	86.1	Confident	94 Å²	94	118.9 Å²	118.9	66%	0.657	61%	0.609	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.3	-31	175.6	44	0	0	0	0	114.2	P58	P58-S60 PolarHBondContact O-N 2.93Å
61	E	89.3	Confident	84.1	Confident	132 Å²	132	116.9 Å²	116.9	62%	0.617	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.2	-21.1	-178.8	-68.6	170.6	-140.9	0	0	111.6	V57 P58 A59 P63	V57-E61 HydrophobicContact CB-CB 4.37Å; P58-E61 PolarHBondContact O-N 3.05Å; A59-E61 VanDerWaalsContact C-N 3.34Å; E61-P63 WeakPolarHBondContact O-CD 3.29Å
62	N	92.4	Very high	82.4	Confident	60 Å²	60	119 Å²	119	32%	0.321	63%	0.626	S	S	.	*			trans	-71.4	112.2	175.8	-175.4	-6.5	0	0	0	111.2	V57 P58 F64 R65	V57-N62 HydrophobicContact CG2-CB 4.17Å; P58-N62 PolarHBondContact O-N 3.12Å; P58-N62 VanDerWaalsContact O-N 3.12Å; N62-F64 PolarHBondContact O-N 3.07Å; N62-F64 WeakPolarHBondContact OD1-CA 3.39Å; N62-F64 WeakPolarHBondContact OD1-CB 3.43Å; N62-F64 PolarHBondContact OD1-N 2.86Å; N62-R65 HydrophobicContact CB-CB 4.41Å; N62-R65 VanDerWaalsContact O-CB 3.29Å; N62-R65 WeakPolarHBondContact O-CB 3.23Å; N62-R65 PolarHBondContact O-N 3.18Å
63	P	90.3	Very high	80.8	Confident	108 Å²	108	122.9 Å²	122.9	70%	0.701	64%	0.641	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66.1	-19.7	178.6	28.2	-34.6	0	0	0	113.1	E61	E61-P63 WeakPolarHBondContact O-CD 3.29Å
64	F	89.6	Confident	78.8	Confident	183 Å²	183	126 Å²	126	80%	0.803	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.2	9.5	176.8	-55.3	-76.7	0	0	0	113.3	N62	N62-F64 PolarHBondContact O-N 3.07Å; N62-F64 WeakPolarHBondContact OD1-CA 3.39Å; N62-F64 WeakPolarHBondContact OD1-CB 3.43Å; N62-F64 PolarHBondContact OD1-N 2.86Å
65	R	85.7	Confident	78.1	Confident	136 Å²	136	127.3 Å²	127.3	51%	0.513	66%	0.664	S	S	.	*	S	Bend	trans	-57.3	141.9	173.9	-169.3	-150.6	-170.2	143.6	-4.1	110.3	A59 N62 K67	A59-R65 HydrophobicContact CB-CG 3.92Å; A59-R65 VanDerWaalsContact O-CB 3.23Å; A59-R65 WeakPolarHBondContact O-CB 3.2Å; A59-R65 WeakPolarHBondContact O-CD 3.1Å; A59-R65 VanDerWaalsContact O-CG 3.29Å; A59-R65 WeakPolarHBondContact O-CG 3.29Å; N62-R65 HydrophobicContact CB-CB 4.41Å; N62-R65 VanDerWaalsContact O-CB 3.29Å; N62-R65 WeakPolarHBondContact O-CB 3.23Å; N62-R65 PolarHBondContact O-N 3.18Å; R65-K67 PolarHBondContact O-N 3.5Å
66	E	81.3	Confident	77.2	Confident	178 Å²	178	129.5 Å²	129.5	83%	0.832	68%	0.677	S	S	*	*			trans	-50.6	112.2	162.8	-70.2	-176.3	-179.8	0	0	110.2	K68	E66-K68 PolarHBondContact O-N 2.97Å
67	K	75.1	Confident	76.5	Confident	166 Å²	166	130.6 Å²	130.6	72%	0.722	67%	0.674	S	S	*	*			trans	-71.7	128.2	165.2	-64.4	-179.9	-177.7	177.4	0	105.6	R65 L69	R65-K67 PolarHBondContact O-N 3.5Å; K67-L69 HydrophobicContact CB-CD1 4.34Å; K67-L69 HydrophobicContact CB-CG 4.01Å; K67-L69 PolarHBondContact O-N 2.69Å
68	K	67.5	Low	75.6	Confident	190 Å²	190	134.9 Å²	134.9	83%	0.826	69%	0.694	S	S	*	*			trans	-66.3	70.2	163.5	-72	-164.8	177.3	-172.6	0	108.5	E66 F70	E66-K68 PolarHBondContact O-N 2.97Å; K68-F70 PolarHBondContact O-N 3.37Å
69	L	63.2	Low	74.6	Confident	144 Å²	144	139 Å²	139	75%	0.754	71%	0.709	S	S	*	*			trans	-76.1	109.2	162.1	-70.9	167.4	0	0	0	104.3	K67 C71	K67-L69 HydrophobicContact CB-CD1 4.34Å; K67-L69 HydrophobicContact CB-CG 4.01Å; K67-L69 PolarHBondContact O-N 2.69Å; L69-C71 VanDerWaalsContact C-N 3.26Å; L69-C71 PolarHBondContact O-N 2.86Å
70	F	57.6	Low	73.7	Confident	187 Å²	187	145.1 Å²	145.1	82%	0.82	73%	0.73	S	S	*	*			trans	-61.3	97.2	167.3	-60.6	-85.4	0	0	0	106.8	K68 T72	K68-F70 PolarHBondContact O-N 3.37Å; F70-T72 PolarHBondContact O-N 3.12Å; F70-T72 VanDerWaalsContact O-N 3.12Å
71	C	52.1	Low	72.6	Confident	111 Å²	111	148.8 Å²	148.8	75%	0.75	74%	0.735	S	S	*	*			trans	-73	98.1	167.9	-173.2	0	0	0	0	106.8	L69	L69-C71 VanDerWaalsContact C-N 3.26Å; L69-C71 PolarHBondContact O-N 2.86Å
72	T	60.1	Low	71.3	Confident	109 Å²	109	150.1 Å²	150.1	67%	0.669	74%	0.744	S	S	*	*			trans	-79.2	111.9	155.2	-61.2	0	0	0	0	106.1	F70 L74	F70-T72 PolarHBondContact O-N 3.12Å; F70-T72 VanDerWaalsContact O-N 3.12Å; T72-L74 HydrophobicContact CG2-CD2 4.43Å; T72-L74 HydrophobicContact CG2-CG 4.38Å; T72-L74 PolarHBondContact O-N 3.23Å
73	I	59.5	Low	69.5	Low	154 Å²	154	157.6 Å²	157.6	79%	0.79	78%	0.78	S	S	*	*			trans	-68.9	111.5	161.8	-57.2	179.8	0	0	0	105.5
74	L	52.4	Low	67.6	Low	225 Å²	225	162.1 Å²	162.1	100%	1.178	79%	0.787	S	S	*	*			trans	-83.1	0	168	-77.7	168.4	0	0	0	109.9	T72	T72-L74 HydrophobicContact CG2-CD2 4.43Å; T72-L74 HydrophobicContact CG2-CG 4.38Å; T72-L74 PolarHBondContact O-N 3.23Å

Retrieved 74 of 74 residues in 65.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).