A0A093I135_STRCA Loading...

U6 snRNA-associated Sm-like protein LSm6

Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA. Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner, facilitating the efficient association of RNA processing factors with their substrates. Component of the cytoplasmic LSM1-LSM7 complex, which is thought to be involved in mRNA degradation by activating the decapping step in the 5'-to-3' mRNA decay pathway.

AlphaFold DB (P62312), UniProt , Accession A0A093I135, Species STRCA (Struthio camelus australis), Gene n/a, Length 80 aa.

						>A0A093I135_STRCA|A0A093I135
MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.1	Very low	78.3	Confident	239 Å²	239	130.7 Å²	130.7	100%	1.177	67%	0.666	S	S	*	*				0	126.5	0	-71.7	-178.7	-169.6	0	0	108.1	L3	M1-L3 PolarHBondContact O-N 2.76Å
2	S	58.4	Low	79.4	Confident	111 Å²	111	122.4 Å²	122.4	78%	0.776	62%	0.624	S	S	*	*			trans	-66.1	121.2	173.6	178.3	0	0	0	0	108.9	R4	S2-R4 VanDerWaalsContact C-N 3.34Å; S2-R4 PolarHBondContact O-N 3.19Å
3	L	67.1	Low	80.3	Confident	169 Å²	169	124.5 Å²	124.5	89%	0.885	63%	0.626	S	S	*	*			trans	-62.3	99.8	167.4	-102.9	96.2	0	0	0	106.9	M1 K5	M1-L3 PolarHBondContact O-N 2.76Å; L3-K5 PolarHBondContact O-N 3.07Å
4	R	70.5	Confident	81.2	Confident	236 Å²	236	123 Å²	123	89%	0.891	62%	0.616	S	S	*	*			trans	-62.9	107	170.3	-79.5	-172.6	172.7	-179	-1.3	107.5	S2 Q6	S2-R4 VanDerWaalsContact C-N 3.34Å; S2-R4 PolarHBondContact O-N 3.19Å; R4-Q6 PolarHBondContact O-N 2.84Å
5	K	80.2	Confident	82.1	Confident	195 Å²	195	114.9 Å²	114.9	85%	0.848	58%	0.575	S	S	*	*	P	Polyproline II helix	trans	-58.7	118.3	169.5	-89.4	-176.1	173.7	-179.7	0	108.1	L3 T7	L3-K5 PolarHBondContact O-N 3.07Å; K5-T7 PolarHBondContact O-N 2.74Å
6	Q	84.3	Confident	83	Confident	127 Å²	127	113.1 Å²	113.1	59%	0.593	57%	0.567	S	S	*	*	P	Polyproline II helix	trans	-64.9	125.7	171.3	-120.4	174.9	-31.6	0	0	108.8	R4 D10 Q14	R4-Q6 PolarHBondContact O-N 2.84Å; Q6-D10 HydrophobicContact CG-CB 4.27Å; Q6-Q14 VanDerWaalsContact NE2-CD 3.31Å
7	T	90.2	Very high	83.8	Confident	62 Å²	62	109.6 Å²	109.6	38%	0.38	57%	0.566	S	S	.	*	P	Polyproline II helix	trans	-85.2	159.3	174.3	68.8	0	0	0	0	110.3	K5 S9 D10 F11	K5-T7 PolarHBondContact O-N 2.74Å; T7-S9 PolarHBondContact O-N 3.29Å; T7-D10 WeakPolarHBondContact CB-OD2 3.25Å; T7-D10 PolarHBondContact N-OD2 3.19Å; T7-D10 WeakPolarHBondContact O-CB 3.42Å; T7-D10 PolarHBondContact O-N 2.97Å; T7-D10 VanDerWaalsContact O-N 3.07Å; T7-D10 PolarHBondContact OG1-N 2.83Å; T7-D10 VanDerWaalsContact OG1-N 3.09Å; T7-D10 PolarHBondContact OG1-OD2 3.12Å; T7-F11 PolarHBondContact O-N 3.13Å; T7-F11 VanDerWaalsContact O-N 3.1Å
8	P	90.2	Very high	84.5	Confident	102 Å²	102	112.2 Å²	112.2	66%	0.662	57%	0.568	S	S	*	*	H	α-helix	trans	-54.1	-39.6	169.7	-26.9	35.7	0	0	0	112.2	D10 F11 L12	P8-D10 VanDerWaalsContact C-N 3.31Å; P8-D10 PolarHBondContact O-N 2.89Å; P8-F11 WeakPolarHBondContact O-CB 3.34Å; P8-F11 PolarHBondContact O-N 2.95Å; P8-L12 VanDerWaalsContact O-CG 3.29Å; P8-L12 WeakPolarHBondContact O-CG 3.48Å; P8-L12 PolarHBondContact O-N 2.89Å
9	S	89.4	Confident	85.2	Confident	73 Å²	73	109.8 Å²	109.8	51%	0.51	56%	0.56	S	S	.	*	H	α-helix	trans	-63.1	-35.6	176.8	-54.5	0	0	0	0	112.9	T7 L12 K13	T7-S9 PolarHBondContact O-N 3.29Å; S9-L12 PolarHBondContact O-N 2.85Å; S9-K13 WeakPolarHBondContact O-CG 3.42Å; S9-K13 PolarHBondContact O-N 3.23Å; S9-K13 VanDerWaalsContact O-N 3.12Å
10	D	92.1	Very high	85.8	Confident	59 Å²	59	104.3 Å²	104.3	32%	0.316	53%	0.532	S	S	.	.	H	α-helix	trans	-67.2	-41	174.4	-60.7	-43.7	0	0	0	111.3	Q6 T7 P8 K13 Q14	Q6-D10 HydrophobicContact CG-CB 4.27Å; T7-D10 WeakPolarHBondContact CB-OD2 3.25Å; T7-D10 PolarHBondContact N-OD2 3.19Å; T7-D10 WeakPolarHBondContact O-CB 3.42Å; T7-D10 PolarHBondContact O-N 2.97Å; T7-D10 VanDerWaalsContact O-N 3.07Å; T7-D10 PolarHBondContact OG1-N 2.83Å; T7-D10 VanDerWaalsContact OG1-N 3.09Å; T7-D10 PolarHBondContact OG1-OD2 3.12Å; P8-D10 VanDerWaalsContact C-N 3.31Å; P8-D10 PolarHBondContact O-N 2.89Å; D10-K13 PolarHBondContact O-N 3.48Å; D10-Q14 VanDerWaalsContact O-CG 3.31Å; D10-Q14 WeakPolarHBondContact O-CG 3.34Å; D10-Q14 PolarHBondContact O-N 2.79Å
11	F	91.7	Very high	86.4	Confident	65 Å²	65	100.1 Å²	100.1	29%	0.285	51%	0.512	S	S	.	.	H	α-helix	trans	-59.9	-47.9	174.5	172.7	-102.6	0	0	0	111.3	T7 P8 K13 Q14 I15 I73 T75	T7-F11 PolarHBondContact O-N 3.13Å; T7-F11 VanDerWaalsContact O-N 3.1Å; P8-F11 WeakPolarHBondContact O-CB 3.34Å; P8-F11 PolarHBondContact O-N 2.95Å; F11-K13 VanDerWaalsContact C-N 3.32Å; F11-K13 PolarHBondContact O-N 3.5Å; F11-Q14 WeakPolarHBondContact O-CB 3.48Å; F11-Q14 PolarHBondContact O-N 2.63Å; F11-I15 HydrophobicContact CD1-CD1 4.32Å; F11-I15 HydrophobicContact CD2-CG2 4.37Å; F11-I15 HydrophobicContact CE1-CD1 3.74Å; F11-I15 HydrophobicContact CE1-CG1 4.49Å; F11-I15 HydrophobicContact CE1-CG2 4.39Å; F11-I15 HydrophobicContact CE2-CG2 3.85Å; F11-I15 HydrophobicContact CZ-CD1 4.13Å; F11-I15 HydrophobicContact CZ-CG2 3.86Å; F11-I15 WeakPolarHBondContact O-CG1 3.29Å; F11-I15 PolarHBondContact O-N 2.97Å; F11-I73 HydrophobicContact CE1-CG2 4.24Å; F11-T75 HydrophobicContact CE2-CG2 4.18Å; F11-T75 HydrophobicContact CZ-CG2 4.41Å
12	L	91.9	Very high	88.8	Confident	31 Å²	31	88.8 Å²	88.8	16%	0.162	46%	0.456	C	S	.	.	H	α-helix	trans	-58.9	-43	179.9	-66.7	172.3	0	0	0	111.7	P8 S9 Q14 I15 I16 L37 M41 I73	P8-L12 VanDerWaalsContact O-CG 3.29Å; P8-L12 WeakPolarHBondContact O-CG 3.48Å; P8-L12 PolarHBondContact O-N 2.89Å; S9-L12 PolarHBondContact O-N 2.85Å; L12-Q14 VanDerWaalsContact C-N 3.27Å; L12-Q14 PolarHBondContact O-N 2.86Å; L12-I15 HydrophobicContact CD2-CD1 4.24Å; L12-I15 WeakPolarHBondContact O-CG1 3.48Å; L12-I15 PolarHBondContact O-N 2.82Å; L12-I16 PolarHBondContact O-N 3.25Å; L12-L37 HydrophobicContact CB-CD1 4.4Å; L12-L37 HydrophobicContact CB-CD2 4.17Å; L12-L37 HydrophobicContact CD1-CD1 3.86Å; L12-L37 HydrophobicContact CD2-CD1 4.25Å; L12-L37 HydrophobicContact CD2-CD2 3.77Å; L12-L37 HydrophobicContact CG-CD1 4.38Å; L12-L37 HydrophobicContact CG-CD2 4.4Å; L12-M41 HydrophobicContact CD1-SD 4.21Å; L12-M41 HydrophobicContact CD2-CE 4.27Å; L12-M41 HydrophobicContact CD2-SD 4.38Å; L12-I73 HydrophobicContact CD2-CG2 4.32Å
13	K	91	Very high	90.7	Very high	150 Å²	150	85.4 Å²	85.4	65%	0.652	43%	0.427	S	S	*	.	H	α-helix	trans	-61.5	-33	174.9	-71.8	172	-176.3	175.1	0	113.2	S9 D10 F11 I15	S9-K13 WeakPolarHBondContact O-CG 3.42Å; S9-K13 PolarHBondContact O-N 3.23Å; S9-K13 VanDerWaalsContact O-N 3.12Å; D10-K13 PolarHBondContact O-N 3.48Å; F11-K13 VanDerWaalsContact C-N 3.32Å; F11-K13 PolarHBondContact O-N 3.5Å; K13-I15 VanDerWaalsContact C-N 3.34Å
14	Q	92.7	Very high	92.2	Very high	103 Å²	103	78.4 Å²	78.4	48%	0.481	39%	0.391	S	S	.	.	H	α-helix	trans	-74.3	-25	-178.5	-73.6	173.7	2.3	0	0	113.6	Q6 D10 F11 L12 R18	Q6-Q14 VanDerWaalsContact NE2-CD 3.31Å; D10-Q14 VanDerWaalsContact O-CG 3.31Å; D10-Q14 WeakPolarHBondContact O-CG 3.34Å; D10-Q14 PolarHBondContact O-N 2.79Å; F11-Q14 WeakPolarHBondContact O-CB 3.48Å; F11-Q14 PolarHBondContact O-N 2.63Å; L12-Q14 VanDerWaalsContact C-N 3.27Å; L12-Q14 PolarHBondContact O-N 2.86Å; Q14-R18 VanDerWaalsContact O-CD 3.29Å; Q14-R18 WeakPolarHBondContact O-CD 3.44Å; Q14-R18 PolarHBondContact O-NE 3.04Å
15	I	95.1	Very high	93.5	Very high	2 Å²	2	71.8 Å²	71.8	1%	0.01	37%	0.373	C	S	.	.	H	α-helix	trans	-97	-10.1	-174.9	59.7	163.5	0	0	0	113.8	F11 L12 K13 G17 R18 V20 L34 I73 T75	F11-I15 HydrophobicContact CD1-CD1 4.32Å; F11-I15 HydrophobicContact CD2-CG2 4.37Å; F11-I15 HydrophobicContact CE1-CD1 3.74Å; F11-I15 HydrophobicContact CE1-CG1 4.49Å; F11-I15 HydrophobicContact CE1-CG2 4.39Å; F11-I15 HydrophobicContact CE2-CG2 3.85Å; F11-I15 HydrophobicContact CZ-CD1 4.13Å; F11-I15 HydrophobicContact CZ-CG2 3.86Å; F11-I15 WeakPolarHBondContact O-CG1 3.29Å; F11-I15 PolarHBondContact O-N 2.97Å; L12-I15 HydrophobicContact CD2-CD1 4.24Å; L12-I15 WeakPolarHBondContact O-CG1 3.48Å; L12-I15 PolarHBondContact O-N 2.82Å; K13-I15 VanDerWaalsContact C-N 3.34Å; I15-G17 PolarHBondContact O-N 2.86Å; I15-R18 WeakPolarHBondContact O-CB 3.34Å; I15-R18 PolarHBondContact O-N 3.22Å; I15-V20 HydrophobicContact CB-CG1 4.09Å; I15-V20 HydrophobicContact CD1-CG1 4.19Å; I15-L34 HydrophobicContact CB-CD2 4.19Å; I15-L34 HydrophobicContact CD1-CD2 3.6Å; I15-L34 HydrophobicContact CG1-CD2 3.51Å; I15-I73 HydrophobicContact CD1-CD1 3.53Å; I15-I73 HydrophobicContact CD1-CG1 3.89Å; I15-I73 HydrophobicContact CD1-CG2 4.41Å; I15-T75 HydrophobicContact CG2-CG2 3.6Å
16	I	96.1	Very high	94.3	Very high	86 Å²	86	66.7 Å²	66.7	44%	0.441	36%	0.362	S	S	.	.	T	Hydrogen-bonded Turn	trans	-57.6	135.3	171.1	-66.5	172.2	0	0	0	109.5	L12 R18 L34	L12-I16 PolarHBondContact O-N 3.25Å; I16-R18 PolarHBondContact O-N 2.76Å; I16-L34 HydrophobicContact CG1-CD2 4.27Å
17	G	96.9	Very high	94.9	Very high	54 Å²	54	62.4 Å²	62.4	56%	0.557	35%	0.351	S	S	*	.	T	Hydrogen-bonded Turn	trans	72.4	9.2	-175.4	0	0	0	0	0	114.5	I15 L34	I15-G17 PolarHBondContact O-N 2.86Å; G17-L34 WeakPolarHBondContact CA-O 3.32Å; G17-L34 PolarHBondContact N-O 2.8Å
18	R	96.9	Very high	95.3	Very high	156 Å²	156	60.6 Å²	60.6	59%	0.589	34%	0.34	S	S	*	.	S	Bend	trans	-113.4	154.5	-179.1	-57.9	-168.5	179.5	-127	-4.8	112.4	Q14 I15 I16 V20 L34	Q14-R18 VanDerWaalsContact O-CD 3.29Å; Q14-R18 WeakPolarHBondContact O-CD 3.44Å; Q14-R18 PolarHBondContact O-NE 3.04Å; I15-R18 WeakPolarHBondContact O-CB 3.34Å; I15-R18 PolarHBondContact O-N 3.22Å; I16-R18 PolarHBondContact O-N 2.76Å; R18-V20 PolarHBondContact O-N 2.95Å; R18-L34 PolarHBondContact O-N 2.67Å
19	P	97.3	Very high	95.7	Very high	66 Å²	66	56.7 Å²	56.7	43%	0.429	31%	0.314	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-61.4	126.2	168.1	-23	34.1	0	0	0	112.1	G32 Q76	P19-G32 CarbonylContact C-O 3.55Å; P19-G32 WeakPolarHBondContact CA-O 3.43Å; P19-Q76 HydrophobicContact CB-CB 4.06Å; P19-Q76 VanDerWaalsContact CB-OE1 3.31Å; P19-Q76 PolarHBondContact O-N 3.13Å; P19-Q76 VanDerWaalsContact O-N 3.15Å
20	V	97.7	Very high	96.1	Very high	0 Å²	0	55 Å²	55	0%	0	30%	0.297	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.2	162.9	-179.8	-63.7	0	0	0	0	111	I15 R18 V22 R31 G32 L34 L45 I73 S74	I15-V20 HydrophobicContact CB-CG1 4.09Å; I15-V20 HydrophobicContact CD1-CG1 4.19Å; R18-V20 PolarHBondContact O-N 2.95Å; V20-V22 HydrophobicContact CG2-CG2 4.24Å; V20-R31 WeakPolarHBondContact O-CA 3.22Å; V20-G32 PolarHBondContact N-O 2.84Å; V20-G32 PolarHBondContact O-N 2.78Å; V20-L34 HydrophobicContact CG1-CB 4.07Å; V20-L34 HydrophobicContact CG1-CD2 4.47Å; V20-L34 HydrophobicContact CG2-CB 3.91Å; V20-L45 HydrophobicContact CG2-CD2 3.6Å; V20-I73 HydrophobicContact CB-CD1 4.23Å; V20-I73 HydrophobicContact CB-CG1 4.16Å; V20-I73 HydrophobicContact CG1-CD1 4.28Å; V20-I73 HydrophobicContact CG1-CG1 4.41Å; V20-I73 HydrophobicContact CG2-CD1 4.17Å; V20-S74 CarbonylContact C-O 3.56Å; V20-S74 VanDerWaalsContact CA-O 3.32Å; V20-S74 WeakPolarHBondContact CA-O 3.1Å; V20-S74 WeakPolarHBondContact CB-O 3.35Å
21	V	97.9	Very high	96.4	Very high	17 Å²	17	55.2 Å²	55.2	10%	0.103	29%	0.293	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.3	124.7	165.6	-175.5	0	0	0	0	107.9	D29 Y30 R31 I73 S74 Q76	V21-D29 HydrophobicContact CG1-CB 4.16Å; V21-Y30 CarbonylContact C-O 3.57Å; V21-Y30 WeakPolarHBondContact CA-O 3.29Å; V21-R31 HydrophobicContact CG1-CG 4.33Å; V21-R31 HydrophobicContact CG2-CG 4.11Å; V21-I73 CarbonylContact O-C 3.57Å; V21-I73 WeakPolarHBondContact O-CA 3.42Å; V21-S74 PolarHBondContact N-O 3.38Å; V21-S74 PolarHBondContact O-N 3.19Å; V21-Q76 HydrophobicContact CG2-CB 4.38Å; V21-Q76 HydrophobicContact CG2-CG 4.27Å
22	V	97.9	Very high	96.7	Very high	0 Å²	0	52.5 Å²	52.5	0%	0	28%	0.283	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.8	109	173.9	-177.1	0	0	0	0	107.5	V20 L24 Y30 I43 L45 I65 V70 I73	V20-V22 HydrophobicContact CG2-CG2 4.24Å; V22-L24 HydrophobicContact CG1-CD2 4.28Å; V22-Y30 PolarHBondContact N-O 3.03Å; V22-Y30 PolarHBondContact O-N 2.82Å; V22-I43 HydrophobicContact CG1-CD1 3.81Å; V22-I43 HydrophobicContact CG2-CD1 3.94Å; V22-L45 HydrophobicContact CG2-CD1 4.1Å; V22-L45 HydrophobicContact CG2-CD2 4.43Å; V22-I65 HydrophobicContact CB-CD1 4.3Å; V22-I65 HydrophobicContact CG1-CD1 4.1Å; V22-V70 HydrophobicContact CG1-CG1 3.96Å; V22-V70 HydrophobicContact CG1-CG2 4Å; V22-I73 HydrophobicContact CG2-CD1 4.14Å; V22-I73 HydrophobicContact CG2-CG1 4.21Å
23	K	98.1	Very high	97	Very high	40 Å²	40	52.2 Å²	52.2	17%	0.174	28%	0.283	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.8	129.8	174.5	-177.3	170.8	-71.3	-68.5	0	109	G27 D29 L71 Y72	K23-G27 PolarHBondContact NZ-O 3.43Å; K23-D29 WeakPolarHBondContact CB-OD1 3.47Å; K23-D29 WeakPolarHBondContact CE-OD1 3.47Å; K23-D29 WeakPolarHBondContact CG-OD1 3.37Å; K23-D29 IonicContact NZ-OD1 2.61Å; K23-D29 PolarHBondContact NZ-OD1 3Å; K23-D29 IonicContact NZ-OD2 3.18Å; K23-D29 PolarHBondContact NZ-OD2 2.84Å; K23-L71 HydrophobicContact CD-CD2 4.04Å; K23-L71 HydrophobicContact CG-CD2 4.28Å; K23-L71 WeakPolarHBondContact O-CB 3.41Å; K23-L71 PolarHBondContact O-N 3.09Å; K23-Y72 HydrophobicContact CB-CD1 4.09Å; K23-Y72 HydrophobicContact CB-CD2 4.19Å; K23-Y72 HydrophobicContact CB-CE1 3.75Å; K23-Y72 HydrophobicContact CB-CE2 3.81Å; K23-Y72 HydrophobicContact CB-CG 4.31Å; K23-Y72 HydrophobicContact CD-CD1 4.43Å; K23-Y72 HydrophobicContact CD-CE1 3.59Å; K23-Y72 WeakPolarHBondContact CE-OH 3.47Å; K23-Y72 HydrophobicContact CG-CE1 4.18Å; K23-Y72 PolarHBondContact N-O 3.29Å; K23-Y72 PolarHBondContact O-N 3.07Å
24	L	98.3	Very high	97.3	Very high	23 Å²	23	45.1 Å²	45.1	12%	0.12	25%	0.252	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.8	162.1	172.5	-57.8	-163.3	0	0	0	111.7	V22 S26 G27 V28 Y30 I65 N69 V70	V22-L24 HydrophobicContact CG1-CD2 4.28Å; L24-S26 PolarHBondContact O-N 2.75Å; L24-S26 VanDerWaalsContact O-N 3.11Å; L24-G27 PolarHBondContact O-N 3.44Å; L24-V28 PolarHBondContact N-O 3.37Å; L24-Y30 HydrophobicContact CD1-CD2 4.04Å; L24-Y30 HydrophobicContact CD1-CE2 3.48Å; L24-Y30 VanDerWaalsContact CD1-CE2 3.48Å; L24-Y30 HydrophobicContact CD2-CD2 4.36Å; L24-Y30 HydrophobicContact CG-CD2 3.92Å; L24-Y30 HydrophobicContact CG-CE2 3.84Å; L24-I65 HydrophobicContact CD2-CG2 3.76Å; L24-N69 CarbonylContact C-O 3.52Å; L24-N69 VanDerWaalsContact CA-O 3.25Å; L24-N69 WeakPolarHBondContact CA-O 3.34Å; L24-N69 HydrophobicContact CD2-CB 4.47Å; L24-V70 HydrophobicContact CD2-CG2 4.34Å
25	N	97.9	Very high	97.6	Very high	97 Å²	97	41.9 Å²	41.9	52%	0.519	24%	0.243	S	C	.	.	T	Hydrogen-bonded Turn	trans	-57.2	-23.4	173.1	-67.8	-33.5	0	0	0	113.3	G27 N68 N69	N25-G27 PolarHBondContact O-N 3.15Å; N25-N68 PolarHBondContact ND2-O 3.42Å; N25-N69 PolarHBondContact N-O 3.1Å; N25-N69 PolarHBondContact ND2-O 3.39Å
26	S	97.3	Very high	97.6	Very high	88 Å²	88	45.2 Å²	45.2	62%	0.615	27%	0.265	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.5	-10.1	173.5	58.5	0	0	0	0	114	L24 V28	L24-S26 PolarHBondContact O-N 2.75Å; L24-S26 VanDerWaalsContact O-N 3.11Å; S26-V28 VanDerWaalsContact C-N 3.31Å; S26-V28 WeakPolarHBondContact OG-CG2 3.35Å
27	G	97.5	Very high	97.5	Very high	36 Å²	36	43.1 Å²	43.1	37%	0.371	26%	0.255	S	S	.	.	S	Bend	trans	87.7	-8.7	-173.2	0	0	0	0	0	114.5	K23 L24 N25	K23-G27 PolarHBondContact NZ-O 3.43Å; L24-G27 PolarHBondContact O-N 3.44Å; N25-G27 PolarHBondContact O-N 3.15Å
28	V	98.4	Very high	97.3	Very high	24 Å²	24	43.5 Å²	43.5	15%	0.145	24%	0.244	C	C	.	.			trans	-67.3	138.1	174.8	179.8	0	0	0	0	110.3	L24 S26 Y30 E50 V52	L24-V28 PolarHBondContact N-O 3.37Å; S26-V28 VanDerWaalsContact C-N 3.31Å; S26-V28 WeakPolarHBondContact OG-CG2 3.35Å; V28-Y30 HydrophobicContact CB-CE2 4.47Å; V28-Y30 HydrophobicContact CG1-CD2 4.3Å; V28-Y30 HydrophobicContact CG1-CE2 3.73Å; V28-E50 HydrophobicContact CG1-CG 3.77Å; V28-V52 HydrophobicContact CG1-CG2 4.38Å; V28-V52 HydrophobicContact CG2-CG2 4.3Å
29	D	98.1	Very high	97.1	Very high	21 Å²	21	40 Å²	40	11%	0.112	26%	0.257	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	124	176.9	-67.9	-30.5	0	0	0	110.3	V21 K23 Y51	V21-D29 HydrophobicContact CG1-CB 4.16Å; K23-D29 WeakPolarHBondContact CB-OD1 3.47Å; K23-D29 WeakPolarHBondContact CE-OD1 3.47Å; K23-D29 WeakPolarHBondContact CG-OD1 3.37Å; K23-D29 IonicContact NZ-OD1 2.61Å; K23-D29 PolarHBondContact NZ-OD1 3Å; K23-D29 IonicContact NZ-OD2 3.18Å; K23-D29 PolarHBondContact NZ-OD2 2.84Å; D29-Y51 PolarHBondContact N-O 3.27Å; D29-Y51 PolarHBondContact O-N 3.31Å
30	Y	98.3	Very high	96.9	Very high	38 Å²	38	46 Å²	46	15%	0.149	27%	0.272	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.6	133	164.6	-68.5	-87.3	0	0	0	109.4	V21 V22 L24 V28 T48 E49 E50 Y60 I65	V21-Y30 CarbonylContact C-O 3.57Å; V21-Y30 WeakPolarHBondContact CA-O 3.29Å; V22-Y30 PolarHBondContact N-O 3.03Å; V22-Y30 PolarHBondContact O-N 2.82Å; L24-Y30 HydrophobicContact CD1-CD2 4.04Å; L24-Y30 HydrophobicContact CD1-CE2 3.48Å; L24-Y30 VanDerWaalsContact CD1-CE2 3.48Å; L24-Y30 HydrophobicContact CD2-CD2 4.36Å; L24-Y30 HydrophobicContact CG-CD2 3.92Å; L24-Y30 HydrophobicContact CG-CE2 3.84Å; V28-Y30 HydrophobicContact CB-CE2 4.47Å; V28-Y30 HydrophobicContact CG1-CD2 4.3Å; V28-Y30 HydrophobicContact CG1-CE2 3.73Å; Y30-T48 HydrophobicContact CD1-CG2 3.76Å; Y30-T48 HydrophobicContact CG-CG2 4.47Å; Y30-E49 CarbonylContact C-O 3.54Å; Y30-E49 WeakPolarHBondContact CA-O 3.02Å; Y30-E50 HydrophobicContact CD1-CB 4.1Å; Y30-E50 HydrophobicContact CE1-CB 3.73Å; Y30-E50 HydrophobicContact CE1-CG 4.01Å; Y30-E50 PolarHBondContact OH-OE1 3.29Å; Y30-Y60 HydrophobicContact CE1-CD2 4.11Å; Y30-Y60 AromaticContact CE1-CE2 3.82Å; Y30-Y60 HydrophobicContact CE1-CE2 3.82Å; Y30-I65 HydrophobicContact CD2-CD1 4Å; Y30-I65 HydrophobicContact CG-CD1 3.86Å
31	R	98	Very high	96.7	Very high	63 Å²	63	48.8 Å²	48.8	24%	0.238	29%	0.286	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	134.4	177	-52	-172.3	-172.7	163	0.2	108.3	V20 V21 T48 E49 Y51	V20-R31 WeakPolarHBondContact O-CA 3.22Å; V21-R31 HydrophobicContact CG1-CG 4.33Å; V21-R31 HydrophobicContact CG2-CG 4.11Å; R31-T48 CarbonylContact O-C 3.6Å; R31-T48 VanDerWaalsContact O-CA 3.32Å; R31-T48 WeakPolarHBondContact O-CA 3.32Å; R31-E49 PolarHBondContact N-O 3.01Å; R31-E49 PolarHBondContact O-N 3.23Å; R31-Y51 HydrophobicContact CB-CD2 4.41Å; R31-Y51 HydrophobicContact CB-CE2 4.16Å; R31-Y51 VanDerWaalsContact CD-CE2 3.44Å; R31-Y51 HydrophobicContact CG-CD2 3.76Å; R31-Y51 HydrophobicContact CG-CE2 3.84Å; R31-Y51 VanDerWaalsContact NH1-CE1 3.29Å
32	G	97.8	Very high	96.7	Very high	8 Å²	8	49.6 Å²	49.6	8%	0.082	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-177.6	-179.2	-177.6	0	0	0	0	0	111.1	P19 V20 E46	P19-G32 CarbonylContact C-O 3.55Å; P19-G32 WeakPolarHBondContact CA-O 3.43Å; V20-G32 PolarHBondContact N-O 2.84Å; V20-G32 PolarHBondContact O-N 2.78Å; G32-E46 CarbonylContact C-O 3.6Å; G32-E46 VanDerWaalsContact CA-O 3.29Å; G32-E46 WeakPolarHBondContact CA-O 3.45Å
33	V	97.8	Very high	96.7	Very high	25 Å²	25	49.6 Å²	49.6	15%	0.152	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.1	125.8	172.7	-179.7	0	0	0	0	108.4	A35 L45 E46	V33-A35 PolarHBondContact O-N 3.25Å; V33-A35 VanDerWaalsContact O-N 3.13Å; V33-L45 CarbonylContact O-C 3.5Å; V33-L45 WeakPolarHBondContact O-CA 3.41Å; V33-E46 HydrophobicContact CB-CB 4.31Å; V33-E46 PolarHBondContact N-O 3.28Å; V33-E46 PolarHBondContact O-N 2.95Å
34	L	98	Very high	96.7	Very high	0 Å²	0	48.8 Å²	48.8	0%	0	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.3	105.4	178.1	177.2	61.8	0	0	0	110.7	I15 I16 G17 R18 V20 C36 L37 I43 I73	I15-L34 HydrophobicContact CB-CD2 4.19Å; I15-L34 HydrophobicContact CD1-CD2 3.6Å; I15-L34 HydrophobicContact CG1-CD2 3.51Å; I16-L34 HydrophobicContact CG1-CD2 4.27Å; G17-L34 WeakPolarHBondContact CA-O 3.32Å; G17-L34 PolarHBondContact N-O 2.8Å; R18-L34 PolarHBondContact O-N 2.67Å; V20-L34 HydrophobicContact CG1-CB 4.07Å; V20-L34 HydrophobicContact CG1-CD2 4.47Å; V20-L34 HydrophobicContact CG2-CB 3.91Å; L34-C36 WeakPolarHBondContact CD1-O 3.38Å; L34-L37 HydrophobicContact CD1-CD2 4.19Å; L34-L37 HydrophobicContact CD2-CD2 3.76Å; L34-L37 HydrophobicContact CG-CD2 4.46Å; L34-I43 HydrophobicContact CD1-CG2 3.59Å; L34-I73 HydrophobicContact CD1-CD1 4.49Å; L34-I73 HydrophobicContact CD2-CD1 4.11Å
35	A	97.8	Very high	96.7	Very high	36 Å²	36	47.9 Å²	47.9	30%	0.298	29%	0.286	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.2	-52.3	176.9	0	0	0	0	0	111.1	V33 A44 E46	V33-A35 PolarHBondContact O-N 3.25Å; V33-A35 VanDerWaalsContact O-N 3.13Å; A35-A44 HydrophobicContact CB-CB 4.14Å; A35-A44 PolarHBondContact N-O 2.99Å; A35-E46 HydrophobicContact CB-CG 4.15Å
36	C	95.8	Very high	96.7	Very high	71 Å²	71	47.5 Å²	47.5	48%	0.48	28%	0.281	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-158.7	167.3	176.3	67.1	0	0	0	0	112.1	L34 A44	L34-C36 WeakPolarHBondContact CD1-O 3.38Å; C36-A44 PolarHBondContact O-N 2.78Å; C36-A44 VanDerWaalsContact SG-CB 3.54Å
37	L	94.8	Very high	96.8	Very high	42 Å²	42	50.2 Å²	50.2	22%	0.22	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.5	162.1	170.1	67.4	100.1	0	0	0	111.1	L12 L34 M41 N42 I43	L12-L37 HydrophobicContact CB-CD1 4.4Å; L12-L37 HydrophobicContact CB-CD2 4.17Å; L12-L37 HydrophobicContact CD1-CD1 3.86Å; L12-L37 HydrophobicContact CD2-CD1 4.25Å; L12-L37 HydrophobicContact CD2-CD2 3.77Å; L12-L37 HydrophobicContact CG-CD1 4.38Å; L12-L37 HydrophobicContact CG-CD2 4.4Å; L34-L37 HydrophobicContact CD1-CD2 4.19Å; L34-L37 HydrophobicContact CD2-CD2 3.76Å; L34-L37 HydrophobicContact CG-CD2 4.46Å; L37-M41 HydrophobicContact CD1-SD 4.43Å; L37-N42 WeakPolarHBondContact CA-O 3.46Å; L37-N42 WeakPolarHBondContact CB-O 3.34Å; L37-I43 HydrophobicContact CB-CG1 4.27Å
38	D	92.8	Very high	96.8	Very high	63 Å²	63	48.5 Å²	48.5	34%	0.337	27%	0.266	S	S	.	.			trans	-116.1	-179.5	177.5	71.5	13.1	0	0	0	113.5	Y40 M41 N42	D38-Y40 PolarHBondContact O-N 3.18Å; D38-Y40 WeakPolarHBondContact OD1-CA 3.14Å; D38-Y40 WeakPolarHBondContact OD1-CB 3.42Å; D38-Y40 PolarHBondContact OD1-N 3.05Å; D38-M41 PolarHBondContact O-N 2.79Å; D38-M41 PolarHBondContact OD1-N 2.87Å; D38-N42 PolarHBondContact N-O 2.91Å; D38-N42 PolarHBondContact OD1-N 2.89Å; D38-N42 WeakPolarHBondContact OD2-CB 3.47Å; D38-N42 PolarHBondContact OD2-ND2 3.34Å
39	G	91	Very high	96.8	Very high	82 Å²	82	49.5 Å²	49.5	85%	0.845	27%	0.269	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.8	-9.7	178.5	0	0	0	0	0	115
40	Y	94.4	Very high	96.8	Very high	193 Å²	193	49.6 Å²	49.6	76%	0.757	27%	0.269	S	S	*	.	T	Hydrogen-bonded Turn	trans	-101.3	6.2	174.4	-58.8	-73.5	0	0	0	112.3	D38 N42 G67	D38-Y40 PolarHBondContact O-N 3.18Å; D38-Y40 WeakPolarHBondContact OD1-CA 3.14Å; D38-Y40 WeakPolarHBondContact OD1-CB 3.42Å; D38-Y40 PolarHBondContact OD1-N 3.05Å; Y40-N42 PolarHBondContact O-N 2.87Å; Y40-G67 WeakPolarHBondContact O-CA 3.35Å
41	M	93.9	Very high	96.8	Very high	57 Å²	57	49.4 Å²	49.4	28%	0.281	27%	0.268	S	S	.	.			trans	61.5	25.9	-175.6	-59.2	-70.1	-65.8	0	0	113.3	L12 L37 D38 I43 G67 I73	L12-M41 HydrophobicContact CD1-SD 4.21Å; L12-M41 HydrophobicContact CD2-CE 4.27Å; L12-M41 HydrophobicContact CD2-SD 4.38Å; L37-M41 HydrophobicContact CD1-SD 4.43Å; D38-M41 PolarHBondContact O-N 2.79Å; D38-M41 PolarHBondContact OD1-N 2.87Å; M41-I43 WeakPolarHBondContact O-CG1 3.38Å; M41-G67 WeakPolarHBondContact O-CA 3.34Å; M41-I73 HydrophobicContact CE-CG2 3.97Å
42	N	96.9	Very high	96.8	Very high	34 Å²	34	49 Å²	49	18%	0.182	27%	0.273	C	S	.	.			trans	-66.6	137.4	161.6	-61.1	-54	0	0	0	108.3	L37 D38 Y40 F64 I65 R66 G67	L37-N42 WeakPolarHBondContact CA-O 3.46Å; L37-N42 WeakPolarHBondContact CB-O 3.34Å; D38-N42 PolarHBondContact N-O 2.91Å; D38-N42 PolarHBondContact OD1-N 2.89Å; D38-N42 WeakPolarHBondContact OD2-CB 3.47Å; D38-N42 PolarHBondContact OD2-ND2 3.34Å; Y40-N42 PolarHBondContact O-N 2.87Å; N42-F64 HydrophobicContact CB-CE2 3.96Å; N42-F64 HydrophobicContact CB-CZ 3.61Å; N42-I65 WeakPolarHBondContact CA-O 3.03Å; N42-R66 WeakPolarHBondContact OD1-CA 2.97Å; N42-G67 PolarHBondContact OD1-N 3.35Å
43	I	97.9	Very high	96.8	Very high	0 Å²	0	56.1 Å²	56.1	0%	0	31%	0.309	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	129.7	-169.2	-64.1	162	0	0	0	109.3	V22 L34 L37 M41 L45 F64 I65 V70 I73	V22-I43 HydrophobicContact CG1-CD1 3.81Å; V22-I43 HydrophobicContact CG2-CD1 3.94Å; L34-I43 HydrophobicContact CD1-CG2 3.59Å; L37-I43 HydrophobicContact CB-CG1 4.27Å; M41-I43 WeakPolarHBondContact O-CG1 3.38Å; I43-L45 HydrophobicContact CG2-CD2 3.96Å; I43-L45 HydrophobicContact CG2-CG 3.83Å; I43-F64 WeakPolarHBondContact O-CA 3.49Å; I43-I65 HydrophobicContact CB-CB 4.37Å; I43-I65 PolarHBondContact N-O 3.11Å; I43-I65 PolarHBondContact O-N 2.89Å; I43-V70 HydrophobicContact CD1-CG1 4.38Å; I43-V70 HydrophobicContact CD1-CG2 3.93Å; I43-I73 HydrophobicContact CD1-CD1 4.41Å
44	A	98.2	Very high	96.6	Very high	24 Å²	24	57.3 Å²	57.3	20%	0.198	33%	0.326	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.7	125.2	162.2	0	0	0	0	0	109.4	A35 C36	A35-A44 HydrophobicContact CB-CB 4.14Å; A35-A44 PolarHBondContact N-O 2.99Å; C36-A44 PolarHBondContact O-N 2.78Å; C36-A44 VanDerWaalsContact SG-CB 3.54Å
45	L	98.4	Very high	96.6	Very high	3 Å²	3	64.4 Å²	64.4	2%	0.016	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.6	138.8	174.3	-70.3	176.7	0	0	0	110.1	V20 V22 V33 I43 T48 D62 A63 I65	V20-L45 HydrophobicContact CG2-CD2 3.6Å; V22-L45 HydrophobicContact CG2-CD1 4.1Å; V22-L45 HydrophobicContact CG2-CD2 4.43Å; V33-L45 CarbonylContact O-C 3.5Å; V33-L45 WeakPolarHBondContact O-CA 3.41Å; I43-L45 HydrophobicContact CG2-CD2 3.96Å; I43-L45 HydrophobicContact CG2-CG 3.83Å; L45-T48 HydrophobicContact CB-CG2 4.39Å; L45-T48 WeakPolarHBondContact CB-OG1 3.44Å; L45-T48 HydrophobicContact CD1-CG2 4.1Å; L45-T48 PolarHBondContact O-OG1 3.33Å; L45-D62 CarbonylContact O-C 3.58Å; L45-D62 WeakPolarHBondContact O-CA 3.39Å; L45-A63 PolarHBondContact N-O 3.37Å; L45-A63 PolarHBondContact O-N 2.88Å; L45-I65 HydrophobicContact CD1-CD1 3.7Å
46	E	98.5	Very high	96.6	Very high	90 Å²	90	66.7 Å²	66.7	42%	0.421	37%	0.366	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.8	157.8	165.9	-67.2	169.6	-166.8	0	0	109.6	G32 V33 A35 T48 G61	G32-E46 CarbonylContact C-O 3.6Å; G32-E46 VanDerWaalsContact CA-O 3.29Å; G32-E46 WeakPolarHBondContact CA-O 3.45Å; V33-E46 HydrophobicContact CB-CB 4.31Å; V33-E46 PolarHBondContact N-O 3.28Å; V33-E46 PolarHBondContact O-N 2.95Å; A35-E46 HydrophobicContact CB-CG 4.15Å; E46-T48 PolarHBondContact O-N 3.16Å; E46-G61 CarbonylContact C-O 3.57Å
47	Q	97.7	Very high	96.8	Very high	144 Å²	144	70.5 Å²	70.5	67%	0.673	37%	0.374	S	S	*	.	E	Extended strand (participates in β ladder)	trans	52.7	38.6	177.8	-56	179.3	-20.1	0	0	113.1	E49 G61	Q47-E49 PolarHBondContact O-N 3.16Å; Q47-G61 PolarHBondContact N-O 3.13Å; Q47-G61 VanDerWaalsContact N-O 3.07Å
48	T	98.5	Very high	96.9	Very high	1 Å²	1	72 Å²	72	1%	0.006	38%	0.382	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-73.2	127.9	-168.9	-53	0	0	0	0	111.9	Y30 R31 L45 E46 K59 Y60 G61 A63	Y30-T48 HydrophobicContact CD1-CG2 3.76Å; Y30-T48 HydrophobicContact CG-CG2 4.47Å; R31-T48 CarbonylContact O-C 3.6Å; R31-T48 VanDerWaalsContact O-CA 3.32Å; R31-T48 WeakPolarHBondContact O-CA 3.32Å; L45-T48 HydrophobicContact CB-CG2 4.39Å; L45-T48 WeakPolarHBondContact CB-OG1 3.44Å; L45-T48 HydrophobicContact CD1-CG2 4.1Å; L45-T48 PolarHBondContact O-OG1 3.33Å; E46-T48 PolarHBondContact O-N 3.16Å; T48-K59 WeakPolarHBondContact O-CA 3.35Å; T48-Y60 PolarHBondContact O-N 2.97Å; T48-G61 VanDerWaalsContact CB-O 3.25Å; T48-G61 WeakPolarHBondContact CB-O 3.49Å; T48-G61 PolarHBondContact N-O 3.17Å; T48-G61 PolarHBondContact OG1-O 3.36Å; T48-A63 HydrophobicContact CG2-CB 3.82Å; T48-A63 WeakPolarHBondContact OG1-CB 3.16Å
49	E	98.5	Very high	97.2	Very high	44 Å²	44	75.2 Å²	75.2	21%	0.206	39%	0.393	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.8	137.9	172.8	-64.1	-171.3	154.1	0	0	110.1	Y30 R31 Q47 Y51 L56 N58 K59	Y30-E49 CarbonylContact C-O 3.54Å; Y30-E49 WeakPolarHBondContact CA-O 3.02Å; R31-E49 PolarHBondContact N-O 3.01Å; R31-E49 PolarHBondContact O-N 3.23Å; Q47-E49 PolarHBondContact O-N 3.16Å; E49-Y51 HydrophobicContact CB-CD2 4.21Å; E49-Y51 HydrophobicContact CB-CE2 3.56Å; E49-Y51 WeakPolarHBondContact OE2-CE2 3.13Å; E49-Y51 PolarHBondContact OE2-OH 3.12Å; E49-L56 HydrophobicContact CB-CD1 3.77Å; E49-L56 HydrophobicContact CG-CD1 4.11Å; E49-N58 WeakPolarHBondContact CA-O 3.41Å; E49-K59 HydrophobicContact CG-CD 4.4Å; E49-K59 HydrophobicContact CG-CG 4.22Å; E49-K59 WeakPolarHBondContact OE1-CE 3.29Å; E49-K59 IonicContact OE1-NZ 2.74Å; E49-K59 PolarHBondContact OE1-NZ 3.18Å
50	E	98.5	Very high	97.5	Very high	24 Å²	24	76.5 Å²	76.5	11%	0.112	37%	0.374	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.9	130.6	175.2	172.1	-178.8	-105.2	0	0	110.7	V28 Y30 V52 K57 N58 Y60	V28-E50 HydrophobicContact CG1-CG 3.77Å; Y30-E50 HydrophobicContact CD1-CB 4.1Å; Y30-E50 HydrophobicContact CE1-CB 3.73Å; Y30-E50 HydrophobicContact CE1-CG 4.01Å; Y30-E50 PolarHBondContact OH-OE1 3.29Å; E50-V52 HydrophobicContact CG-CG2 4.3Å; E50-K57 HydrophobicContact CG-CB 4.46Å; E50-K57 PolarHBondContact O-N 3.06Å; E50-N58 HydrophobicContact CB-CB 4.28Å; E50-N58 PolarHBondContact N-O 2.61Å; E50-N58 PolarHBondContact O-N 2.97Å; E50-Y60 HydrophobicContact CB-CD2 4.39Å; E50-Y60 HydrophobicContact CB-CE2 3.73Å; E50-Y60 HydrophobicContact CG-CE2 4.49Å; E50-Y60 PolarHBondContact OE2-OH 3.1Å
51	Y	98.5	Very high	97.6	Very high	34 Å²	34	68.9 Å²	68.9	13%	0.133	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.1	122.7	177.4	-70.9	-103.1	0	0	0	110.1	D29 R31 E49 Q55 L56	D29-Y51 PolarHBondContact N-O 3.27Å; D29-Y51 PolarHBondContact O-N 3.31Å; R31-Y51 HydrophobicContact CB-CD2 4.41Å; R31-Y51 HydrophobicContact CB-CE2 4.16Å; R31-Y51 VanDerWaalsContact CD-CE2 3.44Å; R31-Y51 HydrophobicContact CG-CD2 3.76Å; R31-Y51 HydrophobicContact CG-CE2 3.84Å; R31-Y51 VanDerWaalsContact NH1-CE1 3.29Å; E49-Y51 HydrophobicContact CB-CD2 4.21Å; E49-Y51 HydrophobicContact CB-CE2 3.56Å; E49-Y51 WeakPolarHBondContact OE2-CE2 3.13Å; E49-Y51 PolarHBondContact OE2-OH 3.12Å; Y51-Q55 CarbonylContact C-O 3.52Å; Y51-Q55 VanDerWaalsContact CA-O 3.22Å; Y51-Q55 WeakPolarHBondContact CA-O 3.31Å; Y51-L56 HydrophobicContact CD1-CB 4.33Å; Y51-L56 HydrophobicContact CE1-CB 3.92Å; Y51-L56 HydrophobicContact CE2-CD1 4.02Å
52	V	98.2	Very high	97.8	Very high	55 Å²	55	72.4 Å²	72.4	33%	0.333	37%	0.374	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.8	122.7	174	-175.7	0	0	0	0	107.5	V28 E50 G54 Q55 K57	V28-V52 HydrophobicContact CG1-CG2 4.38Å; V28-V52 HydrophobicContact CG2-CG2 4.3Å; E50-V52 HydrophobicContact CG-CG2 4.3Å; V52-G54 PolarHBondContact O-N 3.36Å; V52-Q55 PolarHBondContact N-O 2.87Å; V52-Q55 PolarHBondContact O-N 3.48Å; V52-K57 HydrophobicContact CG2-CB 4.04Å; V52-K57 HydrophobicContact CG2-CG 4.33Å
53	N	96.1	Very high	97.9	Very high	157 Å²	157	72 Å²	72	84%	0.84	37%	0.374	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.1	38	-175.2	-58.2	-33.5	0	0	0	113.1	Q55	N53-Q55 PolarHBondContact O-N 2.95Å
54	G	95	Very high	97.8	Very high	49 Å²	49	79 Å²	79	51%	0.505	41%	0.405	S	S	.	.	T	Hydrogen-bonded Turn	trans	75.6	-1.2	-179.4	0	0	0	0	0	115.4	V52	V52-G54 PolarHBondContact O-N 3.36Å
55	Q	97.9	Very high	97.8	Very high	149 Å²	149	78.5 Å²	78.5	70%	0.696	40%	0.399	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-98.2	134.3	176.2	-64.3	-170.6	-7.9	0	0	111.1	Y51 V52 N53 K57	Y51-Q55 CarbonylContact C-O 3.52Å; Y51-Q55 VanDerWaalsContact CA-O 3.22Å; Y51-Q55 WeakPolarHBondContact CA-O 3.31Å; V52-Q55 PolarHBondContact N-O 2.87Å; V52-Q55 PolarHBondContact O-N 3.48Å; N53-Q55 PolarHBondContact O-N 2.95Å; Q55-K57 PolarHBondContact O-N 3.17Å
56	L	98	Very high	97.8	Very high	84 Å²	84	86.3 Å²	86.3	44%	0.44	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-61.7	120	173.4	176.6	67.3	0	0	0	109	E49 Y51 K59	E49-L56 HydrophobicContact CB-CD1 3.77Å; E49-L56 HydrophobicContact CG-CD1 4.11Å; Y51-L56 HydrophobicContact CD1-CB 4.33Å; Y51-L56 HydrophobicContact CE1-CB 3.92Å; Y51-L56 HydrophobicContact CE2-CD1 4.02Å; L56-K59 HydrophobicContact CD1-CG 4.42Å
57	K	98.3	Very high	97.8	Very high	152 Å²	152	82.3 Å²	82.3	66%	0.661	41%	0.412	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-107.5	-38.4	-179.3	-171.2	52.1	175.3	173.5	0	112.8	E50 V52 Q55	E50-K57 HydrophobicContact CG-CB 4.46Å; E50-K57 PolarHBondContact O-N 3.06Å; V52-K57 HydrophobicContact CG2-CB 4.04Å; V52-K57 HydrophobicContact CG2-CG 4.33Å; Q55-K57 PolarHBondContact O-N 3.17Å
58	N	98.2	Very high	97.7	Very high	73 Å²	73	80.1 Å²	80.1	39%	0.39	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-152.7	163.2	-177.8	-146.5	-7.8	0	0	0	112.8	E49 E50 Y60	E49-N58 WeakPolarHBondContact CA-O 3.41Å; E50-N58 HydrophobicContact CB-CB 4.28Å; E50-N58 PolarHBondContact N-O 2.61Å; E50-N58 PolarHBondContact O-N 2.97Å; N58-Y60 HydrophobicContact CB-CE1 4.48Å; N58-Y60 HydrophobicContact CB-CE2 3.93Å; N58-Y60 WeakPolarHBondContact ND2-CE1 3.22Å; N58-Y60 PolarHBondContact ND2-OH 3.02Å; N58-Y60 VanDerWaalsContact ND2-OH 3.12Å
59	K	98.4	Very high	97.7	Very high	130 Å²	130	83.5 Å²	83.5	57%	0.565	42%	0.423	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-127.8	126.1	171.1	-56.3	-161.6	-176.5	-144.7	0	109.2	T48 E49 L56	T48-K59 WeakPolarHBondContact O-CA 3.35Å; E49-K59 HydrophobicContact CG-CD 4.4Å; E49-K59 HydrophobicContact CG-CG 4.22Å; E49-K59 WeakPolarHBondContact OE1-CE 3.29Å; E49-K59 IonicContact OE1-NZ 2.74Å; E49-K59 PolarHBondContact OE1-NZ 3.18Å; L56-K59 HydrophobicContact CD1-CG 4.42Å
60	Y	97.6	Very high	97.6	Very high	110 Å²	110	82.6 Å²	82.6	43%	0.431	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	-18.9	-175.5	-64.3	-70.3	0	0	0	113.5	Y30 T48 E50 N58 D62	Y30-Y60 HydrophobicContact CE1-CD2 4.11Å; Y30-Y60 AromaticContact CE1-CE2 3.82Å; Y30-Y60 HydrophobicContact CE1-CE2 3.82Å; T48-Y60 PolarHBondContact O-N 2.97Å; E50-Y60 HydrophobicContact CB-CD2 4.39Å; E50-Y60 HydrophobicContact CB-CE2 3.73Å; E50-Y60 HydrophobicContact CG-CE2 4.49Å; E50-Y60 PolarHBondContact OE2-OH 3.1Å; N58-Y60 HydrophobicContact CB-CE1 4.48Å; N58-Y60 HydrophobicContact CB-CE2 3.93Å; N58-Y60 WeakPolarHBondContact ND2-CE1 3.22Å; N58-Y60 PolarHBondContact ND2-OH 3.02Å; N58-Y60 VanDerWaalsContact ND2-OH 3.12Å; Y60-D62 PolarHBondContact O-N 2.82Å
61	G	97	Very high	97.6	Very high	32 Å²	32	86.2 Å²	86.2	33%	0.33	44%	0.44	S	S	.	.	E	Extended strand (participates in β ladder)	trans	71.4	-113	-169.4	0	0	0	0	0	109.6	E46 Q47 T48	E46-G61 CarbonylContact C-O 3.57Å; Q47-G61 PolarHBondContact N-O 3.13Å; Q47-G61 VanDerWaalsContact N-O 3.07Å; T48-G61 VanDerWaalsContact CB-O 3.25Å; T48-G61 WeakPolarHBondContact CB-O 3.49Å; T48-G61 PolarHBondContact N-O 3.17Å; T48-G61 PolarHBondContact OG1-O 3.36Å
62	D	97.7	Very high	97.5	Very high	132 Å²	132	89.5 Å²	89.5	71%	0.706	45%	0.453	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.9	127.8	177.7	-60.6	-13.5	0	0	0	110.2	L45 Y60	L45-D62 CarbonylContact O-C 3.58Å; L45-D62 WeakPolarHBondContact O-CA 3.39Å; Y60-D62 PolarHBondContact O-N 2.82Å
63	A	97.9	Very high	97.4	Very high	24 Å²	24	88 Å²	88	20%	0.198	44%	0.442	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.8	144.3	-177.1	0	0	0	0	0	111.7	L45 T48	L45-A63 PolarHBondContact N-O 3.37Å; L45-A63 PolarHBondContact O-N 2.88Å; T48-A63 HydrophobicContact CG2-CB 3.82Å; T48-A63 WeakPolarHBondContact OG1-CB 3.16Å
64	F	97.8	Very high	97.4	Very high	148 Å²	148	82.3 Å²	82.3	65%	0.649	42%	0.415	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-114	123.3	172.3	-177	-99.6	0	0	0	110.1	N42 I43	N42-F64 HydrophobicContact CB-CE2 3.96Å; N42-F64 HydrophobicContact CB-CZ 3.61Å; I43-F64 WeakPolarHBondContact O-CA 3.49Å
65	I	98	Very high	97.4	Very high	14 Å²	14	83.6 Å²	83.6	7%	0.072	41%	0.413	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.9	127.8	-180	-61.2	175.7	0	0	0	108.9	V22 L24 Y30 N42 I43 L45 V70	V22-I65 HydrophobicContact CB-CD1 4.3Å; V22-I65 HydrophobicContact CG1-CD1 4.1Å; L24-I65 HydrophobicContact CD2-CG2 3.76Å; Y30-I65 HydrophobicContact CD2-CD1 4Å; Y30-I65 HydrophobicContact CG-CD1 3.86Å; N42-I65 WeakPolarHBondContact CA-O 3.03Å; I43-I65 HydrophobicContact CB-CB 4.37Å; I43-I65 PolarHBondContact N-O 3.11Å; I43-I65 PolarHBondContact O-N 2.89Å; L45-I65 HydrophobicContact CD1-CD1 3.7Å; I65-V70 HydrophobicContact CG2-CG2 3.83Å
66	R	98	Very high	96.9	Very high	166 Å²	166	80.4 Å²	80.4	63%	0.626	40%	0.398	S	S	*	.			trans	-75.3	127.4	175.6	-163.8	-174.8	169.1	157.9	-1.4	111	N42 N68 N69	N42-R66 WeakPolarHBondContact OD1-CA 2.97Å; R66-N68 WeakPolarHBondContact CD-OD1 3.25Å; R66-N68 WeakPolarHBondContact CG-OD1 3.4Å; R66-N68 PolarHBondContact NE-OD1 3.18Å; R66-N68 PolarHBondContact O-N 3.42Å; R66-N69 PolarHBondContact O-N 2.87Å; R66-N69 VanDerWaalsContact O-N 3.13Å
67	G	97.4	Very high	95.9	Very high	7 Å²	7	85.8 Å²	85.8	7%	0.072	42%	0.418	C	S	.	.	G	3₁₀ helix	trans	-65.1	-29.6	-167.3	0	0	0	0	0	116.3	Y40 M41 N42 N69 V70	Y40-G67 WeakPolarHBondContact O-CA 3.35Å; M41-G67 WeakPolarHBondContact O-CA 3.34Å; N42-G67 PolarHBondContact OD1-N 3.35Å; G67-N69 PolarHBondContact O-N 2.97Å; G67-N69 VanDerWaalsContact O-N 3.1Å; G67-V70 WeakPolarHBondContact O-CB 3.39Å; G67-V70 PolarHBondContact O-N 2.68Å
68	N	97.3	Very high	94.4	Very high	98 Å²	98	89.8 Å²	89.8	52%	0.524	43%	0.429	S	S	.	.	G	3₁₀ helix	trans	-67.9	-10.6	177.4	70.3	-82.6	0	0	0	113.8	N25 R66	N25-N68 PolarHBondContact ND2-O 3.42Å; R66-N68 WeakPolarHBondContact CD-OD1 3.25Å; R66-N68 WeakPolarHBondContact CG-OD1 3.4Å; R66-N68 PolarHBondContact NE-OD1 3.18Å; R66-N68 PolarHBondContact O-N 3.42Å
69	N	97.2	Very high	92.7	Very high	72 Å²	72	98.3 Å²	98.3	39%	0.385	46%	0.456	S	S	.	.	G	3₁₀ helix	trans	-94.6	-9.2	174.5	-63.7	-46.3	0	0	0	112.7	L24 N25 R66 G67	L24-N69 CarbonylContact C-O 3.52Å; L24-N69 VanDerWaalsContact CA-O 3.25Å; L24-N69 WeakPolarHBondContact CA-O 3.34Å; L24-N69 HydrophobicContact CD2-CB 4.47Å; N25-N69 PolarHBondContact N-O 3.1Å; N25-N69 PolarHBondContact ND2-O 3.39Å; R66-N69 PolarHBondContact O-N 2.87Å; R66-N69 VanDerWaalsContact O-N 3.13Å; G67-N69 PolarHBondContact O-N 2.97Å; G67-N69 VanDerWaalsContact O-N 3.1Å
70	V	97.6	Very high	90.2	Very high	24 Å²	24	104.2 Å²	104.2	15%	0.145	49%	0.488	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.3	125.9	-175.3	178.9	0	0	0	0	109.6	V22 L24 I43 I65 G67	V22-V70 HydrophobicContact CG1-CG1 3.96Å; V22-V70 HydrophobicContact CG1-CG2 4Å; L24-V70 HydrophobicContact CD2-CG2 4.34Å; I43-V70 HydrophobicContact CD1-CG1 4.38Å; I43-V70 HydrophobicContact CD1-CG2 3.93Å; I65-V70 HydrophobicContact CG2-CG2 3.83Å; G67-V70 WeakPolarHBondContact O-CB 3.39Å; G67-V70 PolarHBondContact O-N 2.68Å
71	L	97.7	Very high	89.8	Confident	101 Å²	101	104 Å²	104	53%	0.529	49%	0.491	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.5	-49.3	172.3	-179.7	62.5	0	0	0	110.8	K23	K23-L71 HydrophobicContact CD-CD2 4.04Å; K23-L71 HydrophobicContact CG-CD2 4.28Å; K23-L71 WeakPolarHBondContact O-CB 3.41Å; K23-L71 PolarHBondContact O-N 3.09Å
72	Y	96.3	Very high	89.5	Confident	103 Å²	103	107.7 Å²	107.7	40%	0.404	50%	0.5	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-156.1	163.2	172.1	66.5	-108.6	0	0	0	112.2	K23	K23-Y72 HydrophobicContact CB-CD1 4.09Å; K23-Y72 HydrophobicContact CB-CD2 4.19Å; K23-Y72 HydrophobicContact CB-CE1 3.75Å; K23-Y72 HydrophobicContact CB-CE2 3.81Å; K23-Y72 HydrophobicContact CB-CG 4.31Å; K23-Y72 HydrophobicContact CD-CD1 4.43Å; K23-Y72 HydrophobicContact CD-CE1 3.59Å; K23-Y72 WeakPolarHBondContact CE-OH 3.47Å; K23-Y72 HydrophobicContact CG-CE1 4.18Å; K23-Y72 PolarHBondContact N-O 3.29Å; K23-Y72 PolarHBondContact O-N 3.07Å
73	I	96.3	Very high	89	Confident	22 Å²	22	106.4 Å²	106.4	11%	0.113	49%	0.488	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.9	138.8	165.1	-175.3	163.4	0	0	0	109.5	F11 L12 I15 V20 V21 V22 L34 M41 I43	F11-I73 HydrophobicContact CE1-CG2 4.24Å; L12-I73 HydrophobicContact CD2-CG2 4.32Å; I15-I73 HydrophobicContact CD1-CD1 3.53Å; I15-I73 HydrophobicContact CD1-CG1 3.89Å; I15-I73 HydrophobicContact CD1-CG2 4.41Å; V20-I73 HydrophobicContact CB-CD1 4.23Å; V20-I73 HydrophobicContact CB-CG1 4.16Å; V20-I73 HydrophobicContact CG1-CD1 4.28Å; V20-I73 HydrophobicContact CG1-CG1 4.41Å; V20-I73 HydrophobicContact CG2-CD1 4.17Å; V21-I73 CarbonylContact O-C 3.57Å; V21-I73 WeakPolarHBondContact O-CA 3.42Å; V22-I73 HydrophobicContact CG2-CD1 4.14Å; V22-I73 HydrophobicContact CG2-CG1 4.21Å; L34-I73 HydrophobicContact CD1-CD1 4.49Å; L34-I73 HydrophobicContact CD2-CD1 4.11Å; M41-I73 HydrophobicContact CE-CG2 3.97Å; I43-I73 HydrophobicContact CD1-CD1 4.41Å
74	S	95.8	Very high	88.5	Confident	39 Å²	39	111.2 Å²	111.2	27%	0.273	51%	0.505	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.2	154.6	176.3	65.2	0	0	0	0	111.4	V20 V21	V20-S74 CarbonylContact C-O 3.56Å; V20-S74 VanDerWaalsContact CA-O 3.32Å; V20-S74 WeakPolarHBondContact CA-O 3.1Å; V20-S74 WeakPolarHBondContact CB-O 3.35Å; V21-S74 PolarHBondContact N-O 3.38Å; V21-S74 PolarHBondContact O-N 3.19Å
75	T	94.7	Very high	87.9	Confident	76 Å²	76	108.9 Å²	108.9	47%	0.466	50%	0.496	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.6	136.4	171.2	54.1	0	0	0	0	109.9	F11 I15 K77	F11-T75 HydrophobicContact CE2-CG2 4.18Å; F11-T75 HydrophobicContact CZ-CG2 4.41Å; I15-T75 HydrophobicContact CG2-CG2 3.6Å; T75-K77 PolarHBondContact O-N 3.39Å
76	Q	87.7	Confident	87.2	Confident	82 Å²	82	115.3 Å²	115.3	38%	0.383	53%	0.525	S	S	.	.	P	Polyproline II helix	trans	-66.3	124.7	172.4	-161.4	177.1	41	0	0	109.3	P19 V21 R78	P19-Q76 HydrophobicContact CB-CB 4.06Å; P19-Q76 VanDerWaalsContact CB-OE1 3.31Å; P19-Q76 PolarHBondContact O-N 3.13Å; P19-Q76 VanDerWaalsContact O-N 3.15Å; V21-Q76 HydrophobicContact CG2-CB 4.38Å; V21-Q76 HydrophobicContact CG2-CG 4.27Å; Q76-R78 PolarHBondContact O-N 2.92Å; Q76-R78 VanDerWaalsContact O-N 3.16Å
77	K	77.9	Confident	86.4	Confident	196 Å²	196	111.6 Å²	111.6	85%	0.852	52%	0.517	S	S	*	.	P	Polyproline II helix	trans	-58.8	122.1	174.1	-87.4	-174.5	176.2	179.3	0	108.6	T75 R79	T75-K77 PolarHBondContact O-N 3.39Å; K77-R79 PolarHBondContact O-N 3.33Å; K77-R79 VanDerWaalsContact O-N 3.13Å
78	R	65.3	Low	85.6	Confident	237 Å²	237	119.7 Å²	119.7	89%	0.894	55%	0.552	S	S	*	*	P	Polyproline II helix	trans	-58	119	165.8	-77	177.3	89.7	177.5	6.1	107	Q76 M80	Q76-R78 PolarHBondContact O-N 2.92Å; Q76-R78 VanDerWaalsContact O-N 3.16Å; R78-M80 PolarHBondContact O-N 2.96Å; R78-M80 VanDerWaalsContact O-N 3.16Å
79	R	64	Low	84.6	Confident	251 Å²	251	121.5 Å²	121.5	95%	0.947	55%	0.554	S	S	*	*			trans	-66.1	109	158.6	-87.9	179.5	147.6	167.7	-7	105.9	K77	K77-R79 PolarHBondContact O-N 3.33Å; K77-R79 VanDerWaalsContact O-N 3.13Å
80	M	45.2	Very low	83.5	Confident	255 Å²	255	126 Å²	126	100%	1.256	57%	0.569	S	S	*	*			trans	-73.3	0	159.5	-77.5	-169.3	173.4	0	0	109	R78	R78-M80 PolarHBondContact O-N 2.96Å; R78-M80 VanDerWaalsContact O-N 3.16Å

Retrieved 80 of 80 residues in 177 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).