A0A093I5V6_STRCA Loading...

Mediator of RNA polymerase II transcription subunit 9

Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.

AlphaFold DB (A0A6I9ZBW0), UniProt , Accession A0A093I5V6, Species STRCA (Struthio camelus australis), Gene MED9, Length 71 aa.

						>A0A093I5V6_STRCA|A0A093I5V6|MED9
MDKDSQDVHQVLNELKNKFQEMRKLISSMPGIGVSPEQQQQQLQNLREQVRTKNELLQKYKSLCMFEIPKE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	57.6	Low	81	Confident	218 Å²	218	121.1 Å²	121.1	100%	1.074	62%	0.62	S	S	*	*				0	23.3	0	-76.8	-85.3	-148.9	0	0	110.2
2	D	66.8	Low	82.2	Confident	118 Å²	118	119.1 Å²	119.1	63%	0.631	61%	0.611	S	S	*	*			trans	-112.8	-7.1	-162.1	-51.1	-91.7	0	0	0	112.5	S5 Q6	D2-S5 PolarHBondContact O-N 3.41Å; D2-Q6 PolarHBondContact O-N 3.12Å; D2-Q6 VanDerWaalsContact O-N 3.12Å
3	K	70.3	Confident	83.3	Confident	172 Å²	172	116.5 Å²	116.5	75%	0.748	60%	0.599	S	S	*	*	H	α-helix	trans	-68.5	-42.3	-178.4	-171	174.9	179.1	177.2	0	111.8	S5 Q6 D7	K3-S5 VanDerWaalsContact C-N 3.29Å; K3-S5 PolarHBondContact O-N 3.05Å; K3-Q6 PolarHBondContact O-N 3.01Å; K3-D7 PolarHBondContact O-N 3.31Å
4	D	74.7	Confident	84.2	Confident	124 Å²	124	114.8 Å²	114.8	66%	0.663	59%	0.587	S	S	*	*	H	α-helix	trans	-67	-33.1	176.8	-61.5	-55.1	0	0	0	111.8	D7 V8	D4-D7 PolarHBondContact O-N 3.45Å; D4-V8 VanDerWaalsContact O-CG2 3.23Å; D4-V8 WeakPolarHBondContact O-CG2 3.23Å; D4-V8 PolarHBondContact O-N 3.4Å
5	S	80.5	Confident	85.1	Confident	65 Å²	65	112.9 Å²	112.9	46%	0.455	58%	0.578	S	S	.	*	H	α-helix	trans	-67.6	-40.8	175.4	-169.6	0	0	0	0	111.9	D2 K3 H9	D2-S5 PolarHBondContact O-N 3.41Å; K3-S5 VanDerWaalsContact C-N 3.29Å; K3-S5 PolarHBondContact O-N 3.05Å; S5-H9 PolarHBondContact O-CD2 2.94Å; S5-H9 PolarHBondContact O-N 3.47Å
6	Q	80.1	Confident	85.8	Confident	139 Å²	139	113.3 Å²	113.3	65%	0.65	57%	0.574	S	S	*	*	H	α-helix	trans	-65.5	-40.9	174.4	-75.2	-178.7	-22.4	0	0	112.5	D2 K3 H9 Q10	D2-Q6 PolarHBondContact O-N 3.12Å; D2-Q6 VanDerWaalsContact O-N 3.12Å; K3-Q6 PolarHBondContact O-N 3.01Å; Q6-H9 PolarHBondContact O-N 3.35Å; Q6-Q10 PolarHBondContact O-N 3.4Å
7	D	88.8	Confident	86.6	Confident	95 Å²	95	110.8 Å²	110.8	51%	0.508	56%	0.563	S	S	.	*	H	α-helix	trans	-62.5	-45.5	177.3	-164.9	-91.1	0	0	0	111.3	K3 D4 H9 Q10 V11	K3-D7 PolarHBondContact O-N 3.31Å; D4-D7 PolarHBondContact O-N 3.45Å; D7-H9 VanDerWaalsContact C-N 3.34Å; D7-H9 PolarHBondContact O-N 3.48Å; D7-Q10 WeakPolarHBondContact O-CB 3.38Å; D7-Q10 PolarHBondContact O-N 3.12Å; D7-Q10 VanDerWaalsContact O-N 3.14Å; D7-V11 WeakPolarHBondContact O-CG2 3.28Å; D7-V11 PolarHBondContact O-N 3.42Å
8	V	90.9	Very high	87.2	Confident	82 Å²	82	111.6 Å²	111.6	50%	0.497	56%	0.562	S	S	.	*	H	α-helix	trans	-60.6	-42.4	174.8	170.8	0	0	0	0	111.7	D4 Q10 V11 L12	D4-V8 VanDerWaalsContact O-CG2 3.23Å; D4-V8 WeakPolarHBondContact O-CG2 3.23Å; D4-V8 PolarHBondContact O-N 3.4Å; V8-Q10 VanDerWaalsContact C-N 3.32Å; V8-Q10 PolarHBondContact O-N 3.01Å; V8-V11 PolarHBondContact O-N 3.04Å; V8-L12 HydrophobicContact CG1-CD1 3.92Å; V8-L12 HydrophobicContact CG1-CG 4.41Å; V8-L12 WeakPolarHBondContact O-CB 3.41Å; V8-L12 VanDerWaalsContact O-CG 3.28Å; V8-L12 WeakPolarHBondContact O-CG 3.44Å; V8-L12 PolarHBondContact O-N 3.39Å
9	H	92.9	Very high	87.7	Confident	122 Å²	122	112.3 Å²	112.3	57%	0.565	56%	0.561	S	S	*	*	H	α-helix	trans	-63.7	-37.4	175.8	-77.5	-30.6	0	0	0	112.9	S5 Q6 D7 N13	S5-H9 PolarHBondContact O-CD2 2.94Å; S5-H9 PolarHBondContact O-N 3.47Å; Q6-H9 PolarHBondContact O-N 3.35Å; D7-H9 VanDerWaalsContact C-N 3.34Å; D7-H9 PolarHBondContact O-N 3.48Å; H9-N13 WeakPolarHBondContact O-CB 3.44Å; H9-N13 PolarHBondContact O-N 3.47Å
10	Q	93.1	Very high	88.2	Confident	116 Å²	116	111.7 Å²	111.7	54%	0.542	56%	0.556	S	S	.	*	H	α-helix	trans	-63.6	-49.8	175.8	-175.4	169.3	3.5	0	0	111.1	Q6 D7 V8 L12 N13 E14	Q6-Q10 PolarHBondContact O-N 3.4Å; D7-Q10 WeakPolarHBondContact O-CB 3.38Å; D7-Q10 PolarHBondContact O-N 3.12Å; D7-Q10 VanDerWaalsContact O-N 3.14Å; V8-Q10 VanDerWaalsContact C-N 3.32Å; V8-Q10 PolarHBondContact O-N 3.01Å; Q10-L12 VanDerWaalsContact C-N 3.33Å; Q10-L12 PolarHBondContact O-N 3.46Å; Q10-N13 PolarHBondContact O-N 3.14Å; Q10-N13 VanDerWaalsContact O-N 3.12Å; Q10-E14 WeakPolarHBondContact O-CG 3.45Å; Q10-E14 PolarHBondContact O-N 3.29Å
11	V	94.9	Very high	88.7	Confident	81 Å²	81	112.3 Å²	112.3	49%	0.491	56%	0.558	S	S	.	*	H	α-helix	trans	-61	-41.6	178.6	175.3	0	0	0	0	111.7	D7 V8 N13 E14 L15	D7-V11 WeakPolarHBondContact O-CG2 3.28Å; D7-V11 PolarHBondContact O-N 3.42Å; V8-V11 PolarHBondContact O-N 3.04Å; V11-N13 VanDerWaalsContact C-N 3.32Å; V11-N13 PolarHBondContact O-N 2.97Å; V11-E14 PolarHBondContact O-N 3.43Å; V11-L15 WeakPolarHBondContact O-CB 3.47Å; V11-L15 PolarHBondContact O-N 3Å
12	L	96.3	Very high	90.6	Very high	97 Å²	97	107 Å²	107	51%	0.508	53%	0.531	S	S	.	.	H	α-helix	trans	-62.7	-39.5	175.6	-76.4	170.8	0	0	0	112.2	V8 Q10 L15 K16	V8-L12 HydrophobicContact CG1-CD1 3.92Å; V8-L12 HydrophobicContact CG1-CG 4.41Å; V8-L12 WeakPolarHBondContact O-CB 3.41Å; V8-L12 VanDerWaalsContact O-CG 3.28Å; V8-L12 WeakPolarHBondContact O-CG 3.44Å; V8-L12 PolarHBondContact O-N 3.39Å; Q10-L12 VanDerWaalsContact C-N 3.33Å; Q10-L12 PolarHBondContact O-N 3.46Å; L12-L15 PolarHBondContact O-N 2.96Å; L12-K16 WeakPolarHBondContact O-CB 3.5Å; L12-K16 PolarHBondContact O-N 3.4Å
13	N	96	Very high	92	Very high	86 Å²	86	110.4 Å²	110.4	46%	0.46	54%	0.536	S	S	.	.	H	α-helix	trans	-69.8	-40.3	179.1	-162.5	36.4	0	0	0	111.5	H9 Q10 V11 L15 K16 N17	H9-N13 WeakPolarHBondContact O-CB 3.44Å; H9-N13 PolarHBondContact O-N 3.47Å; Q10-N13 PolarHBondContact O-N 3.14Å; Q10-N13 VanDerWaalsContact O-N 3.12Å; V11-N13 VanDerWaalsContact C-N 3.32Å; V11-N13 PolarHBondContact O-N 2.97Å; N13-L15 VanDerWaalsContact C-N 3.33Å; N13-L15 PolarHBondContact O-N 3.39Å; N13-K16 PolarHBondContact O-N 2.88Å; N13-N17 VanDerWaalsContact O-CG 3.23Å; N13-N17 PolarHBondContact O-N 3.03Å; N13-N17 PolarHBondContact O-ND2 3.41Å
14	E	96.6	Very high	93.3	Very high	92 Å²	92	109.2 Å²	109.2	43%	0.43	53%	0.53	S	S	.	.	H	α-helix	trans	-60	-44.2	172.4	-71.9	178.7	-170	0	0	111.8	Q10 V11 N17 K18	Q10-E14 WeakPolarHBondContact O-CG 3.45Å; Q10-E14 PolarHBondContact O-N 3.29Å; V11-E14 PolarHBondContact O-N 3.43Å; E14-N17 PolarHBondContact O-N 3.3Å; E14-K18 WeakPolarHBondContact O-CG 3.34Å; E14-K18 PolarHBondContact O-N 3.3Å
15	L	97.1	Very high	94.3	Very high	86 Å²	86	108 Å²	108	45%	0.45	52%	0.524	S	S	.	.	H	α-helix	trans	-61.7	-46.5	176.9	-177.4	62	0	0	0	111.5	V11 L12 N13 N17 K18 F19	V11-L15 WeakPolarHBondContact O-CB 3.47Å; V11-L15 PolarHBondContact O-N 3Å; L12-L15 PolarHBondContact O-N 2.96Å; N13-L15 VanDerWaalsContact C-N 3.33Å; N13-L15 PolarHBondContact O-N 3.39Å; L15-N17 VanDerWaalsContact C-N 3.31Å; L15-N17 PolarHBondContact O-N 3.29Å; L15-K18 PolarHBondContact O-N 2.94Å; L15-F19 HydrophobicContact CD1-CD2 4.05Å; L15-F19 HydrophobicContact CD1-CE2 3.55Å; L15-F19 HydrophobicContact CD1-CZ 4.39Å; L15-F19 HydrophobicContact CD2-CE2 4.22Å; L15-F19 HydrophobicContact CG-CD2 3.97Å; L15-F19 HydrophobicContact CG-CE2 3.66Å; L15-F19 WeakPolarHBondContact O-CD2 3.43Å; L15-F19 PolarHBondContact O-N 3.35Å; L15-F19 VanDerWaalsContact O-N 3.07Å
16	K	97	Very high	95	Very high	119 Å²	119	109 Å²	109	52%	0.517	52%	0.523	S	S	.	.	H	α-helix	trans	-56.9	-45.2	175.5	177.9	-174	172.3	-173.4	0	111.4	L12 N13 F19 Q20	L12-K16 WeakPolarHBondContact O-CB 3.5Å; L12-K16 PolarHBondContact O-N 3.4Å; N13-K16 PolarHBondContact O-N 2.88Å; K16-F19 PolarHBondContact O-N 3.03Å; K16-Q20 WeakPolarHBondContact O-CG 3.33Å; K16-Q20 PolarHBondContact O-N 3Å
17	N	97.9	Very high	95.7	Very high	72 Å²	72	106.3 Å²	106.3	39%	0.385	52%	0.519	S	S	.	.	H	α-helix	trans	-62	-46.4	179.2	-71.2	-20	0	0	0	111.2	N13 E14 L15 F19 Q20 E21	N13-N17 VanDerWaalsContact O-CG 3.23Å; N13-N17 PolarHBondContact O-N 3.03Å; N13-N17 PolarHBondContact O-ND2 3.41Å; E14-N17 PolarHBondContact O-N 3.3Å; L15-N17 VanDerWaalsContact C-N 3.31Å; L15-N17 PolarHBondContact O-N 3.29Å; N17-F19 VanDerWaalsContact C-N 3.3Å; N17-F19 PolarHBondContact O-N 2.94Å; N17-Q20 WeakPolarHBondContact O-CB 3.42Å; N17-Q20 PolarHBondContact O-N 3.28Å; N17-E21 WeakPolarHBondContact O-CG 3.44Å; N17-E21 PolarHBondContact O-N 2.95Å
18	K	97.8	Very high	96	Very high	124 Å²	124	105.8 Å²	105.8	54%	0.539	52%	0.523	S	S	.	.	H	α-helix	trans	-56.4	-42.7	175.9	-73.1	176.5	-179	176.8	0	112.3	E14 L15 E21 M22	E14-K18 WeakPolarHBondContact O-CG 3.34Å; E14-K18 PolarHBondContact O-N 3.3Å; L15-K18 PolarHBondContact O-N 2.94Å; K18-E21 PolarHBondContact O-N 2.95Å; K18-M22 WeakPolarHBondContact O-CG 3.43Å; K18-M22 PolarHBondContact O-N 3.29Å
19	F	97.9	Very high	96.2	Very high	126 Å²	126	106.1 Å²	106.1	55%	0.553	52%	0.52	S	S	*	.	H	α-helix	trans	-64	-40.5	175.4	-81.5	-65.7	0	0	0	112.8	L15 K16 N17 M22 R23	L15-F19 HydrophobicContact CD1-CD2 4.05Å; L15-F19 HydrophobicContact CD1-CE2 3.55Å; L15-F19 HydrophobicContact CD1-CZ 4.39Å; L15-F19 HydrophobicContact CD2-CE2 4.22Å; L15-F19 HydrophobicContact CG-CD2 3.97Å; L15-F19 HydrophobicContact CG-CE2 3.66Å; L15-F19 WeakPolarHBondContact O-CD2 3.43Å; L15-F19 PolarHBondContact O-N 3.35Å; L15-F19 VanDerWaalsContact O-N 3.07Å; K16-F19 PolarHBondContact O-N 3.03Å; N17-F19 VanDerWaalsContact C-N 3.3Å; N17-F19 PolarHBondContact O-N 2.94Å; F19-M22 HydrophobicContact CD1-CE 4.26Å; F19-M22 HydrophobicContact CE1-CE 4.42Å; F19-R23 WeakPolarHBondContact O-CB 3.46Å; F19-R23 PolarHBondContact O-N 3.35Å
20	Q	97.6	Very high	96.1	Very high	99 Å²	99	106.6 Å²	106.6	46%	0.463	53%	0.534	S	S	.	.	H	α-helix	trans	-65.6	-41.1	176.9	-70.7	-158.8	-15.9	0	0	112.1	K16 N17 R23 K24	K16-Q20 WeakPolarHBondContact O-CG 3.33Å; K16-Q20 PolarHBondContact O-N 3Å; N17-Q20 WeakPolarHBondContact O-CB 3.42Å; N17-Q20 PolarHBondContact O-N 3.28Å; Q20-R23 PolarHBondContact O-N 2.7Å; Q20-K24 WeakPolarHBondContact O-CG 3.4Å; Q20-K24 PolarHBondContact O-N 2.88Å
21	E	97.4	Very high	95.9	Very high	125 Å²	125	102.4 Å²	102.4	58%	0.584	52%	0.523	S	S	*	.	H	α-helix	trans	-63.5	-47.7	176	-70.4	-178.8	115.8	0	0	111.6	N17 K18 R23 K24 L25	N17-E21 WeakPolarHBondContact O-CG 3.44Å; N17-E21 PolarHBondContact O-N 2.95Å; K18-E21 PolarHBondContact O-N 2.95Å; E21-R23 VanDerWaalsContact C-N 3.31Å; E21-R23 PolarHBondContact O-N 2.98Å; E21-K24 WeakPolarHBondContact O-CB 3.35Å; E21-K24 PolarHBondContact O-N 3.19Å; E21-L25 PolarHBondContact O-N 2.96Å
22	M	97.4	Very high	95.8	Very high	106 Å²	106	103.5 Å²	103.5	52%	0.522	53%	0.525	S	S	.	.	H	α-helix	trans	-60.9	-40.4	176.6	-73.7	-154.8	-70.4	0	0	112.1	K18 F19 K24 L25 I26	K18-M22 WeakPolarHBondContact O-CG 3.43Å; K18-M22 PolarHBondContact O-N 3.29Å; F19-M22 HydrophobicContact CD1-CE 4.26Å; F19-M22 HydrophobicContact CE1-CE 4.42Å; M22-K24 PolarHBondContact O-N 2.99Å; M22-L25 WeakPolarHBondContact O-CB 3.21Å; M22-L25 PolarHBondContact O-N 2.94Å; M22-I26 VanDerWaalsContact O-CG1 3.32Å; M22-I26 WeakPolarHBondContact O-CG1 3.47Å; M22-I26 PolarHBondContact O-N 3.07Å
23	R	97	Very high	95.6	Very high	191 Å²	191	102.7 Å²	102.7	72%	0.721	54%	0.539	S	S	*	.	H	α-helix	trans	-63.3	-42.2	176.4	-171.7	176.2	-174.5	155.1	2.2	111.9	F19 Q20 E21 S27	F19-R23 WeakPolarHBondContact O-CB 3.46Å; F19-R23 PolarHBondContact O-N 3.35Å; Q20-R23 PolarHBondContact O-N 2.7Å; E21-R23 VanDerWaalsContact C-N 3.31Å; E21-R23 PolarHBondContact O-N 2.98Å; R23-S27 WeakPolarHBondContact O-CB 3.32Å; R23-S27 PolarHBondContact O-N 3.29Å; R23-S27 PolarHBondContact O-OG 3.21Å
24	K	96.6	Very high	95.5	Very high	146 Å²	146	101.2 Å²	101.2	64%	0.635	53%	0.533	S	S	*	.	H	α-helix	trans	-61.6	-45.5	174.8	-74.1	174.1	-177.1	177.5	0	110.8	Q20 E21 M22 S27 S28	Q20-K24 WeakPolarHBondContact O-CG 3.4Å; Q20-K24 PolarHBondContact O-N 2.88Å; E21-K24 WeakPolarHBondContact O-CB 3.35Å; E21-K24 PolarHBondContact O-N 3.19Å; M22-K24 PolarHBondContact O-N 2.99Å; K24-S27 PolarHBondContact O-N 3.49Å; K24-S28 WeakPolarHBondContact O-CB 3.49Å; K24-S28 PolarHBondContact O-N 3.37Å; K24-S28 PolarHBondContact O-OG 3.41Å
25	L	96.5	Very high	95.5	Very high	100 Å²	100	99.2 Å²	99.2	52%	0.524	53%	0.529	S	S	.	.	H	α-helix	trans	-57.5	-53.7	177.9	179	64.4	0	0	0	111.3	E21 M22 S27 S28 M29	E21-L25 PolarHBondContact O-N 2.96Å; M22-L25 WeakPolarHBondContact O-CB 3.21Å; M22-L25 PolarHBondContact O-N 2.94Å; L25-S27 VanDerWaalsContact C-N 3.3Å; L25-S27 PolarHBondContact O-N 3.1Å; L25-S28 PolarHBondContact O-N 3.32Å; L25-S28 VanDerWaalsContact O-N 3.1Å; L25-S28 PolarHBondContact O-OG 3.36Å; L25-M29 HydrophobicContact CD2-CE 4.38Å; L25-M29 HydrophobicContact CG-CE 4.05Å; L25-M29 WeakPolarHBondContact O-CG 3.24Å; L25-M29 PolarHBondContact O-N 2.72Å
26	I	95.6	Very high	95.4	Very high	85 Å²	85	99.6 Å²	99.6	44%	0.436	54%	0.537	S	S	.	.	H	α-helix	trans	-58.9	-43.4	179.1	-66.9	166.4	0	0	0	110.8	M22 S28 M29 I32	M22-I26 VanDerWaalsContact O-CG1 3.32Å; M22-I26 WeakPolarHBondContact O-CG1 3.47Å; M22-I26 PolarHBondContact O-N 3.07Å; I26-S28 PolarHBondContact O-N 3.1Å; I26-M29 WeakPolarHBondContact O-CB 3.39Å; I26-M29 PolarHBondContact O-N 2.93Å; I26-M29 VanDerWaalsContact O-N 3.1Å; I26-I32 HydrophobicContact CG2-CD1 4.11Å; I26-I32 HydrophobicContact CG2-CG1 4.14Å
27	S	94.7	Very high	95.4	Very high	82 Å²	82	99.9 Å²	99.9	57%	0.573	54%	0.54	S	S	*	.	H	α-helix	trans	-66.4	-27.8	-179.9	-54.6	0	0	0	0	112.8	R23 K24 L25 M29	R23-S27 WeakPolarHBondContact O-CB 3.32Å; R23-S27 PolarHBondContact O-N 3.29Å; R23-S27 PolarHBondContact O-OG 3.21Å; K24-S27 PolarHBondContact O-N 3.49Å; L25-S27 VanDerWaalsContact C-N 3.3Å; L25-S27 PolarHBondContact O-N 3.1Å; S27-M29 VanDerWaalsContact C-N 3.34Å
28	S	95.3	Very high	95.3	Very high	85 Å²	85	101.7 Å²	101.7	59%	0.594	55%	0.546	S	S	*	.	H	α-helix	trans	-83.2	-8.7	176	71.1	0	0	0	0	113.8	K24 L25 I26	K24-S28 WeakPolarHBondContact O-CB 3.49Å; K24-S28 PolarHBondContact O-N 3.37Å; K24-S28 PolarHBondContact O-OG 3.41Å; L25-S28 PolarHBondContact O-N 3.32Å; L25-S28 VanDerWaalsContact O-N 3.1Å; L25-S28 PolarHBondContact O-OG 3.36Å; I26-S28 PolarHBondContact O-N 3.1Å
29	M	94.6	Very high	95.2	Very high	89 Å²	89	100 Å²	100	44%	0.438	54%	0.54	S	S	.	.	S	Bend	trans	-67.2	126.5	-179	-72.2	-172.7	-173.8	0	0	110.5	L25 I26 S27 G31 I32	L25-M29 HydrophobicContact CD2-CE 4.38Å; L25-M29 HydrophobicContact CG-CE 4.05Å; L25-M29 WeakPolarHBondContact O-CG 3.24Å; L25-M29 PolarHBondContact O-N 2.72Å; I26-M29 WeakPolarHBondContact O-CB 3.39Å; I26-M29 PolarHBondContact O-N 2.93Å; I26-M29 VanDerWaalsContact O-N 3.1Å; S27-M29 VanDerWaalsContact C-N 3.34Å; M29-G31 PolarHBondContact O-N 3.05Å; M29-I32 HydrophobicContact CB-CB 4.4Å; M29-I32 WeakPolarHBondContact O-CB 3.08Å; M29-I32 VanDerWaalsContact O-CG2 3.24Å; M29-I32 WeakPolarHBondContact O-CG2 3.43Å; M29-I32 PolarHBondContact O-N 3.27Å
30	P	90.3	Very high	95.1	Very high	131 Å²	131	99.7 Å²	99.7	85%	0.851	54%	0.541	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.9	138.4	176.7	26.8	-33.1	0	0	0	109.5	I32	P30-I32 VanDerWaalsContact C-N 3.32Å; P30-I32 PolarHBondContact O-N 3.46Å
31	G	89.9	Confident	95.1	Very high	29 Å²	29	99.3 Å²	99.3	30%	0.299	54%	0.539	S	S	.	.	T	Hydrogen-bonded Turn	trans	86.5	-10.6	-179.9	0	0	0	0	0	115.2	M29 G33 V34 Q39	M29-G31 PolarHBondContact O-N 3.05Å; G31-G33 PolarHBondContact O-N 2.76Å; G31-V34 WeakPolarHBondContact O-CG2 3.49Å; G31-V34 PolarHBondContact O-N 3.44Å; G31-Q39 VanDerWaalsContact C-NE2 3.3Å; G31-Q39 PolarHBondContact O-NE2 3.06Å
32	I	92.6	Very high	95	Very high	104 Å²	104	98.2 Å²	98.2	53%	0.533	53%	0.534	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59.9	-25.1	-176.5	-163.4	62	0	0	0	113.8	I26 M29 P30	I26-I32 HydrophobicContact CG2-CD1 4.11Å; I26-I32 HydrophobicContact CG2-CG1 4.14Å; M29-I32 HydrophobicContact CB-CB 4.4Å; M29-I32 WeakPolarHBondContact O-CB 3.08Å; M29-I32 VanDerWaalsContact O-CG2 3.24Å; M29-I32 WeakPolarHBondContact O-CG2 3.43Å; M29-I32 PolarHBondContact O-N 3.27Å; P30-I32 VanDerWaalsContact C-N 3.32Å; P30-I32 PolarHBondContact O-N 3.46Å
33	G	92.6	Very high	95	Very high	79 Å²	79	97 Å²	97	81%	0.814	53%	0.529	S	S	*	.	T	Hydrogen-bonded Turn	trans	-94	4.6	179.4	0	0	0	0	0	115.5	G31	G31-G33 PolarHBondContact O-N 2.76Å
34	V	93.8	Very high	95	Very high	56 Å²	56	92.6 Å²	92.6	34%	0.339	52%	0.516	S	S	.	.	S	Bend	trans	-122.9	149.5	-177.6	-68.6	0	0	0	0	111.2	G31 Q38 Q39	G31-V34 WeakPolarHBondContact O-CG2 3.49Å; G31-V34 PolarHBondContact O-N 3.44Å; V34-Q38 HydrophobicContact CB-CB 4.21Å; V34-Q39 HydrophobicContact CB-CG 4.42Å; V34-Q39 HydrophobicContact CG2-CG 3.37Å
35	S	95.6	Very high	95.1	Very high	49 Å²	49	88.9 Å²	88.9	34%	0.343	50%	0.504	S	S	.	.			trans	-67.7	155.1	178.3	86.3	0	0	0	0	111.3	E37 Q38 Q39	S35-E37 WeakPolarHBondContact CB-OE2 3.5Å; S35-E37 PolarHBondContact O-N 3.36Å; S35-E37 PolarHBondContact OG-OE2 3.34Å; S35-Q38 WeakPolarHBondContact O-CB 3.22Å; S35-Q38 PolarHBondContact O-N 3.07Å; S35-Q38 VanDerWaalsContact O-N 3.07Å; S35-Q38 PolarHBondContact OG-N 3Å; S35-Q39 PolarHBondContact O-N 2.7Å
36	P	95	Very high	95.2	Very high	95 Å²	95	88.8 Å²	88.8	62%	0.617	50%	0.503	S	S	*	.	H	α-helix	trans	-53.1	-38.8	177.2	-26.9	35.7	0	0	0	113.4	Q39 Q40	P36-Q39 PolarHBondContact O-N 2.9Å; P36-Q40 WeakPolarHBondContact O-CB 3.27Å; P36-Q40 PolarHBondContact O-N 3.3Å
37	E	97	Very high	95.3	Very high	124 Å²	124	92.7 Å²	92.7	58%	0.579	51%	0.512	S	S	*	.	H	α-helix	trans	-66.8	-41.3	178.9	-54	79.2	-174.2	0	0	111.4	S35 Q40 Q41	S35-E37 WeakPolarHBondContact CB-OE2 3.5Å; S35-E37 PolarHBondContact O-N 3.36Å; S35-E37 PolarHBondContact OG-OE2 3.34Å; E37-Q40 PolarHBondContact O-N 2.89Å; E37-Q41 WeakPolarHBondContact O-CB 3.33Å; E37-Q41 PolarHBondContact O-N 3.26Å
38	Q	96	Very high	95.5	Very high	111 Å²	111	94.7 Å²	94.7	52%	0.519	51%	0.513	S	S	.	.	H	α-helix	trans	-64.6	-40.9	175.7	-70.9	-67.5	-61	0	0	111.4	V34 S35 Q40 Q41 Q42	V34-Q38 HydrophobicContact CB-CB 4.21Å; S35-Q38 WeakPolarHBondContact O-CB 3.22Å; S35-Q38 PolarHBondContact O-N 3.07Å; S35-Q38 VanDerWaalsContact O-N 3.07Å; S35-Q38 PolarHBondContact OG-N 3Å; Q38-Q40 VanDerWaalsContact C-N 3.34Å; Q38-Q40 PolarHBondContact O-N 3.21Å; Q38-Q41 PolarHBondContact O-N 3.37Å; Q38-Q42 WeakPolarHBondContact O-CG 3.37Å; Q38-Q42 PolarHBondContact O-N 3.38Å
39	Q	95.8	Very high	95.6	Very high	88 Å²	88	95.2 Å²	95.2	41%	0.411	51%	0.506	S	S	.	.	H	α-helix	trans	-61.1	-44.4	174	-66	-176.2	1.4	0	0	111.5	G31 V34 S35 P36 Q42 L43	G31-Q39 VanDerWaalsContact C-NE2 3.3Å; G31-Q39 PolarHBondContact O-NE2 3.06Å; V34-Q39 HydrophobicContact CB-CG 4.42Å; V34-Q39 HydrophobicContact CG2-CG 3.37Å; S35-Q39 PolarHBondContact O-N 2.7Å; P36-Q39 PolarHBondContact O-N 2.9Å; Q39-Q42 PolarHBondContact O-N 2.96Å; Q39-L43 WeakPolarHBondContact O-CB 3.35Å; Q39-L43 PolarHBondContact O-N 3.44Å
40	Q	96.6	Very high	95.8	Very high	120 Å²	120	95 Å²	95	56%	0.561	51%	0.51	S	S	*	.	H	α-helix	trans	-64.3	-42	179.5	-170.4	176	10.6	0	0	111.6	P36 E37 Q38 L43 Q44	P36-Q40 WeakPolarHBondContact O-CB 3.27Å; P36-Q40 PolarHBondContact O-N 3.3Å; E37-Q40 PolarHBondContact O-N 2.89Å; Q38-Q40 VanDerWaalsContact C-N 3.34Å; Q38-Q40 PolarHBondContact O-N 3.21Å; Q40-L43 PolarHBondContact O-N 2.95Å; Q40-Q44 WeakPolarHBondContact O-CG 3.49Å; Q40-Q44 PolarHBondContact O-N 2.96Å
41	Q	97.1	Very high	96.2	Very high	90 Å²	90	96.9 Å²	96.9	42%	0.421	50%	0.5	S	S	.	.	H	α-helix	trans	-62.5	-45.3	175.8	-175.1	63.3	67.3	0	0	111.6	E37 Q38 L43 Q44 N45	E37-Q41 WeakPolarHBondContact O-CB 3.33Å; E37-Q41 PolarHBondContact O-N 3.26Å; Q38-Q41 PolarHBondContact O-N 3.37Å; Q41-L43 VanDerWaalsContact C-N 3.31Å; Q41-L43 PolarHBondContact O-N 3.35Å; Q41-Q44 PolarHBondContact O-N 3.25Å; Q41-N45 PolarHBondContact NE2-OD1 3.4Å; Q41-N45 PolarHBondContact O-N 3.41Å; Q41-N45 PolarHBondContact O-OD1 2.99Å
42	Q	95.8	Very high	96.5	Very high	103 Å²	103	99.1 Å²	99.1	48%	0.481	51%	0.508	S	S	.	.	H	α-helix	trans	-59.6	-42.6	175.9	-74.1	178.8	-3.3	0	0	111.6	Q38 Q39 N45 L46	Q38-Q42 WeakPolarHBondContact O-CG 3.37Å; Q38-Q42 PolarHBondContact O-N 3.38Å; Q39-Q42 PolarHBondContact O-N 2.96Å; Q42-N45 PolarHBondContact O-N 3.31Å; Q42-L46 WeakPolarHBondContact O-CG 3.45Å; Q42-L46 PolarHBondContact O-N 3.49Å
43	L	96.5	Very high	96.7	Very high	81 Å²	81	100.2 Å²	100.2	42%	0.424	51%	0.509	S	S	.	.	H	α-helix	trans	-62.9	-42.8	176.6	179.7	62.2	0	0	0	112.1	Q39 Q40 Q41 L46 R47	Q39-L43 WeakPolarHBondContact O-CB 3.35Å; Q39-L43 PolarHBondContact O-N 3.44Å; Q40-L43 PolarHBondContact O-N 2.95Å; Q41-L43 VanDerWaalsContact C-N 3.31Å; Q41-L43 PolarHBondContact O-N 3.35Å; L43-L46 PolarHBondContact O-N 2.95Å; L43-R47 WeakPolarHBondContact O-CG 3.4Å; L43-R47 PolarHBondContact O-N 3.37Å
44	Q	98.2	Very high	96.8	Very high	97 Å²	97	100.6 Å²	100.6	45%	0.453	49%	0.492	S	S	.	.	H	α-helix	trans	-60.9	-46.7	175.4	-74.2	-177.8	4.8	0	0	111.3	Q40 Q41 L46 R47 E48	Q40-Q44 WeakPolarHBondContact O-CG 3.49Å; Q40-Q44 PolarHBondContact O-N 2.96Å; Q41-Q44 PolarHBondContact O-N 3.25Å; Q44-L46 VanDerWaalsContact C-N 3.31Å; Q44-L46 PolarHBondContact O-N 3.36Å; Q44-R47 WeakPolarHBondContact O-CB 3.48Å; Q44-R47 PolarHBondContact O-N 2.93Å; Q44-E48 PolarHBondContact O-N 2.99Å
45	N	98	Very high	96.9	Very high	69 Å²	69	101.8 Å²	101.8	37%	0.369	49%	0.494	S	S	.	.	H	α-helix	trans	-60.4	-41	178	-65.7	-4.8	0	0	0	111.8	Q41 Q42 E48 Q49	Q41-N45 PolarHBondContact NE2-OD1 3.4Å; Q41-N45 PolarHBondContact O-N 3.41Å; Q41-N45 PolarHBondContact O-OD1 2.99Å; Q42-N45 PolarHBondContact O-N 3.31Å; N45-E48 PolarHBondContact O-N 2.95Å; N45-Q49 WeakPolarHBondContact O-CG 3.32Å; N45-Q49 PolarHBondContact O-N 3.36Å
46	L	97.7	Very high	96.8	Very high	98 Å²	98	103.5 Å²	103.5	51%	0.513	50%	0.499	S	S	.	.	H	α-helix	trans	-64.8	-41.8	176.7	-75.3	170.7	0	0	0	111.9	Q42 L43 Q44 E48 Q49 V50	Q42-L46 WeakPolarHBondContact O-CG 3.45Å; Q42-L46 PolarHBondContact O-N 3.49Å; L43-L46 PolarHBondContact O-N 2.95Å; Q44-L46 VanDerWaalsContact C-N 3.31Å; Q44-L46 PolarHBondContact O-N 3.36Å; L46-E48 VanDerWaalsContact C-N 3.35Å; L46-Q49 PolarHBondContact O-N 3.09Å; L46-V50 WeakPolarHBondContact O-CG2 3.34Å; L46-V50 PolarHBondContact O-N 3.35Å
47	R	98.3	Very high	96.6	Very high	166 Å²	166	103.1 Å²	103.1	63%	0.626	49%	0.491	S	S	*	.	H	α-helix	trans	-62.4	-43.1	176.3	-73.7	173	177.5	-177.6	-0.1	111.6	L43 Q44 V50 R51	L43-R47 WeakPolarHBondContact O-CG 3.4Å; L43-R47 PolarHBondContact O-N 3.37Å; Q44-R47 WeakPolarHBondContact O-CB 3.48Å; Q44-R47 PolarHBondContact O-N 2.93Å; R47-V50 PolarHBondContact O-N 2.86Å; R47-R51 PolarHBondContact O-N 3.35Å
48	E	98.5	Very high	96.2	Very high	125 Å²	125	102.3 Å²	102.3	58%	0.584	49%	0.487	S	S	*	.	H	α-helix	trans	-62.9	-45.7	176	-172.7	171.3	-147.8	0	0	111.3	Q44 N45 L46 V50 R51 T52	Q44-E48 PolarHBondContact O-N 2.99Å; N45-E48 PolarHBondContact O-N 2.95Å; L46-E48 VanDerWaalsContact C-N 3.35Å; E48-V50 VanDerWaalsContact C-N 3.34Å; E48-V50 PolarHBondContact O-N 3.43Å; E48-R51 WeakPolarHBondContact O-CB 3.26Å; E48-R51 PolarHBondContact O-N 2.9Å; E48-R51 VanDerWaalsContact O-N 3.12Å; E48-T52 PolarHBondContact O-N 3.02Å; E48-T52 PolarHBondContact O-OG1 3.17Å; E48-T52 VanDerWaalsContact O-OG1 3.11Å
49	Q	98.3	Very high	95.8	Very high	95 Å²	95	103.4 Å²	103.4	44%	0.444	49%	0.49	S	S	.	.	H	α-helix	trans	-57	-44.8	175.1	-77.1	178.9	61.7	0	0	112.8	N45 L46 R51 T52 K53	N45-Q49 WeakPolarHBondContact O-CG 3.32Å; N45-Q49 PolarHBondContact O-N 3.36Å; L46-Q49 PolarHBondContact O-N 3.09Å; Q49-R51 VanDerWaalsContact C-N 3.33Å; Q49-T52 PolarHBondContact O-N 3.06Å; Q49-K53 WeakPolarHBondContact O-CB 3.49Å; Q49-K53 VanDerWaalsContact O-CG 3.26Å; Q49-K53 WeakPolarHBondContact O-CG 3.38Å; Q49-K53 PolarHBondContact O-N 3.11Å
50	V	98.2	Very high	95.4	Very high	86 Å²	86	105 Å²	105	52%	0.521	49%	0.493	S	S	.	.	H	α-helix	trans	-61.4	-44.5	176.9	168.7	0	0	0	0	110.5	L46 R47 E48 K53 N54	L46-V50 WeakPolarHBondContact O-CG2 3.34Å; L46-V50 PolarHBondContact O-N 3.35Å; R47-V50 PolarHBondContact O-N 2.86Å; E48-V50 VanDerWaalsContact C-N 3.34Å; E48-V50 PolarHBondContact O-N 3.43Å; V50-K53 PolarHBondContact O-N 3.38Å; V50-N54 WeakPolarHBondContact O-CB 3.39Å; V50-N54 VanDerWaalsContact O-CG 3.29Å; V50-N54 PolarHBondContact O-N 2.98Å; V50-N54 PolarHBondContact O-ND2 3.12Å
51	R	98.1	Very high	94.7	Very high	169 Å²	169	104.4 Å²	104.4	64%	0.638	49%	0.489	S	S	*	.	H	α-helix	trans	-58.2	-53.7	176	179.7	-173.4	168.6	-176.9	-0.7	111.2	R47 E48 Q49 K53 N54 E55	R47-R51 PolarHBondContact O-N 3.35Å; E48-R51 WeakPolarHBondContact O-CB 3.26Å; E48-R51 PolarHBondContact O-N 2.9Å; E48-R51 VanDerWaalsContact O-N 3.12Å; Q49-R51 VanDerWaalsContact C-N 3.33Å; R51-K53 VanDerWaalsContact C-N 3.35Å; R51-K53 PolarHBondContact O-N 3.37Å; R51-N54 PolarHBondContact O-N 3.29Å; R51-E55 IonicContact CZ-OE1 3.55Å; R51-E55 IonicContact NE-OE1 3.38Å; R51-E55 PolarHBondContact NE-OE1 2.92Å; R51-E55 IonicContact NH2-OE1 2.84Å; R51-E55 PolarHBondContact NH2-OE1 2.96Å; R51-E55 WeakPolarHBondContact O-CG 3.39Å; R51-E55 PolarHBondContact O-N 3.39Å
52	T	97.3	Very high	94	Very high	76 Å²	76	104.9 Å²	104.9	47%	0.466	50%	0.502	S	S	.	.	H	α-helix	trans	-60.9	-42.9	-178.8	-55	0	0	0	0	111.8	E48 Q49 N54 E55 L56	E48-T52 PolarHBondContact O-N 3.02Å; E48-T52 PolarHBondContact O-OG1 3.17Å; E48-T52 VanDerWaalsContact O-OG1 3.11Å; Q49-T52 PolarHBondContact O-N 3.06Å; T52-N54 VanDerWaalsContact C-N 3.34Å; T52-N54 PolarHBondContact O-N 2.91Å; T52-E55 PolarHBondContact O-N 3.4Å; T52-L56 WeakPolarHBondContact O-CB 3.48Å; T52-L56 PolarHBondContact O-N 3.35Å
53	K	96.3	Very high	92.9	Very high	128 Å²	128	105.2 Å²	105.2	56%	0.557	51%	0.507	S	S	*	.	H	α-helix	trans	-62.9	-41.1	176.7	-75	177.7	179.7	177.9	0	111.6	Q49 V50 R51 L56 L57	Q49-K53 WeakPolarHBondContact O-CB 3.49Å; Q49-K53 VanDerWaalsContact O-CG 3.26Å; Q49-K53 WeakPolarHBondContact O-CG 3.38Å; Q49-K53 PolarHBondContact O-N 3.11Å; V50-K53 PolarHBondContact O-N 3.38Å; R51-K53 VanDerWaalsContact C-N 3.35Å; R51-K53 PolarHBondContact O-N 3.37Å; K53-L56 PolarHBondContact O-N 2.9Å; K53-L57 WeakPolarHBondContact O-CB 3.18Å; K53-L57 WeakPolarHBondContact O-CG 3.5Å; K53-L57 PolarHBondContact O-N 2.94Å
54	N	95.5	Very high	91.3	Very high	87 Å²	87	107.2 Å²	107.2	47%	0.465	53%	0.526	S	S	.	.	H	α-helix	trans	-65.1	-44.9	175.8	-77.7	-28.9	0	0	0	112	V50 R51 T52 L56 L57 Q58	V50-N54 WeakPolarHBondContact O-CB 3.39Å; V50-N54 VanDerWaalsContact O-CG 3.29Å; V50-N54 PolarHBondContact O-N 2.98Å; V50-N54 PolarHBondContact O-ND2 3.12Å; R51-N54 PolarHBondContact O-N 3.29Å; T52-N54 VanDerWaalsContact C-N 3.34Å; T52-N54 PolarHBondContact O-N 2.91Å; N54-L56 VanDerWaalsContact C-N 3.28Å; N54-L56 PolarHBondContact O-N 2.88Å; N54-L57 PolarHBondContact O-N 3.41Å; N54-Q58 VanDerWaalsContact O-CG 3.31Å; N54-Q58 WeakPolarHBondContact O-CG 3.31Å; N54-Q58 PolarHBondContact O-N 3.22Å
55	E	94.7	Very high	89.3	Confident	80 Å²	80	109.9 Å²	109.9	37%	0.374	54%	0.54	S	S	.	.	H	α-helix	trans	-58.7	-42.1	175.3	-72.2	175.7	-172.3	0	0	111.4	R51 T52 Q58 K59	R51-E55 IonicContact CZ-OE1 3.55Å; R51-E55 IonicContact NE-OE1 3.38Å; R51-E55 PolarHBondContact NE-OE1 2.92Å; R51-E55 IonicContact NH2-OE1 2.84Å; R51-E55 PolarHBondContact NH2-OE1 2.96Å; R51-E55 WeakPolarHBondContact O-CG 3.39Å; R51-E55 PolarHBondContact O-N 3.39Å; T52-E55 PolarHBondContact O-N 3.4Å; E55-Q58 PolarHBondContact O-N 3.38Å; E55-K59 WeakPolarHBondContact O-CG 3.43Å; E55-K59 PolarHBondContact O-N 3.47Å
56	L	93.5	Very high	87.4	Confident	85 Å²	85	112.6 Å²	112.6	45%	0.445	55%	0.549	S	S	.	.	H	α-helix	trans	-63.7	-47.8	176.7	-175.4	62.7	0	0	0	111.7	T52 K53 N54 Q58 K59 Y60	T52-L56 WeakPolarHBondContact O-CB 3.48Å; T52-L56 PolarHBondContact O-N 3.35Å; K53-L56 PolarHBondContact O-N 2.9Å; N54-L56 VanDerWaalsContact C-N 3.28Å; N54-L56 PolarHBondContact O-N 2.88Å; L56-Q58 VanDerWaalsContact C-N 3.3Å; L56-Q58 PolarHBondContact O-N 3.48Å; L56-K59 WeakPolarHBondContact O-CB 3.32Å; L56-K59 PolarHBondContact O-N 3.18Å; L56-Y60 HydrophobicContact CD1-CD2 3.97Å; L56-Y60 HydrophobicContact CD1-CE2 3.43Å; L56-Y60 VanDerWaalsContact CD1-CE2 3.43Å; L56-Y60 HydrophobicContact CD2-CE2 4.06Å; L56-Y60 HydrophobicContact CG-CD2 3.82Å; L56-Y60 HydrophobicContact CG-CE2 3.51Å; L56-Y60 WeakPolarHBondContact O-CD2 3.36Å; L56-Y60 PolarHBondContact O-N 2.93Å
57	L	90.6	Very high	85.5	Confident	88 Å²	88	117.1 Å²	117.1	46%	0.461	57%	0.567	S	S	.	*	H	α-helix	trans	-58.9	-41.3	175.6	-74.6	172.3	0	0	0	111.7	K53 N54 Y60 K61	K53-L57 WeakPolarHBondContact O-CB 3.18Å; K53-L57 WeakPolarHBondContact O-CG 3.5Å; K53-L57 PolarHBondContact O-N 2.94Å; N54-L57 PolarHBondContact O-N 3.41Å; L57-Y60 PolarHBondContact O-N 3.48Å; L57-K61 VanDerWaalsContact O-CG 3.3Å; L57-K61 WeakPolarHBondContact O-CG 3.3Å; L57-K61 PolarHBondContact O-N 3.36Å
58	Q	89.1	Confident	83.6	Confident	107 Å²	107	114.2 Å²	114.2	50%	0.5	56%	0.563	S	S	.	*	H	α-helix	trans	-63.6	-45	176.2	-71.2	-60	-28.7	0	0	111.6	N54 E55 L56 Y60 K61 S62	N54-Q58 VanDerWaalsContact O-CG 3.31Å; N54-Q58 WeakPolarHBondContact O-CG 3.31Å; N54-Q58 PolarHBondContact O-N 3.22Å; E55-Q58 PolarHBondContact O-N 3.38Å; L56-Q58 VanDerWaalsContact C-N 3.3Å; L56-Q58 PolarHBondContact O-N 3.48Å; Q58-Y60 VanDerWaalsContact C-N 3.32Å; Q58-Y60 PolarHBondContact O-N 3.15Å; Q58-K61 PolarHBondContact O-N 3.46Å; Q58-K61 VanDerWaalsContact O-N 3.15Å; Q58-S62 PolarHBondContact O-N 2.95Å; Q58-S62 PolarHBondContact O-OG 3.37Å; Q58-S62 VanDerWaalsContact O-OG 3.13Å
59	K	88.1	Confident	81.8	Confident	133 Å²	133	113.9 Å²	113.9	58%	0.578	57%	0.572	S	S	*	*	H	α-helix	trans	-56.3	-46.6	174.5	-73	174.4	-177.1	179.3	0	111.4	E55 L56 K61 S62 L63	E55-K59 WeakPolarHBondContact O-CG 3.43Å; E55-K59 PolarHBondContact O-N 3.47Å; L56-K59 WeakPolarHBondContact O-CB 3.32Å; L56-K59 PolarHBondContact O-N 3.18Å; K59-K61 PolarHBondContact O-N 2.99Å; K59-S62 PolarHBondContact O-N 3.23Å; K59-L63 WeakPolarHBondContact O-CB 3.37Å; K59-L63 WeakPolarHBondContact O-CD1 3.39Å; K59-L63 WeakPolarHBondContact O-CG 3.4Å; K59-L63 PolarHBondContact O-N 3.15Å
60	Y	87	Confident	79.7	Confident	121 Å²	121	119.1 Å²	119.1	48%	0.475	59%	0.593	S	S	.	*	H	α-helix	trans	-63.1	-38.7	177	-78.4	-63.6	0	0	0	113.2	L56 L57 Q58 L63	L56-Y60 HydrophobicContact CD1-CD2 3.97Å; L56-Y60 HydrophobicContact CD1-CE2 3.43Å; L56-Y60 VanDerWaalsContact CD1-CE2 3.43Å; L56-Y60 HydrophobicContact CD2-CE2 4.06Å; L56-Y60 HydrophobicContact CG-CD2 3.82Å; L56-Y60 HydrophobicContact CG-CE2 3.51Å; L56-Y60 WeakPolarHBondContact O-CD2 3.36Å; L56-Y60 PolarHBondContact O-N 2.93Å; L57-Y60 PolarHBondContact O-N 3.48Å; Q58-Y60 VanDerWaalsContact C-N 3.32Å; Q58-Y60 PolarHBondContact O-N 3.15Å; Y60-L63 PolarHBondContact O-N 3.04Å
61	K	83	Confident	77.4	Confident	109 Å²	109	127.8 Å²	127.8	47%	0.474	63%	0.628	S	S	.	*	H	α-helix	trans	-64.6	-46.5	174.5	-73.9	175	-179.5	-176	0	112.1	L57 Q58 K59 L63 C64	L57-K61 VanDerWaalsContact O-CG 3.3Å; L57-K61 WeakPolarHBondContact O-CG 3.3Å; L57-K61 PolarHBondContact O-N 3.36Å; Q58-K61 PolarHBondContact O-N 3.46Å; Q58-K61 VanDerWaalsContact O-N 3.15Å; K59-K61 PolarHBondContact O-N 2.99Å; K61-L63 PolarHBondContact O-N 2.84Å; K61-C64 PolarHBondContact O-N 3.29Å
62	S	81.4	Confident	76.4	Confident	100 Å²	100	125.7 Å²	125.7	70%	0.699	63%	0.628	S	S	*	*	H	α-helix	trans	-66	-26.4	179.4	-60.6	0	0	0	0	113.2	Q58 K59 C64	Q58-S62 PolarHBondContact O-N 2.95Å; Q58-S62 PolarHBondContact O-OG 3.37Å; Q58-S62 VanDerWaalsContact O-OG 3.13Å; K59-S62 PolarHBondContact O-N 3.23Å; S62-C64 VanDerWaalsContact C-N 3.27Å; S62-C64 PolarHBondContact O-N 3.35Å
63	L	73.1	Confident	75.3	Confident	110 Å²	110	128.3 Å²	128.3	58%	0.576	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.1	2.1	178.4	-81.9	158.3	0	0	0	114.2	K59 Y60 K61 M65	K59-L63 WeakPolarHBondContact O-CB 3.37Å; K59-L63 WeakPolarHBondContact O-CD1 3.39Å; K59-L63 WeakPolarHBondContact O-CG 3.4Å; K59-L63 PolarHBondContact O-N 3.15Å; Y60-L63 PolarHBondContact O-N 3.04Å; K61-L63 PolarHBondContact O-N 2.84Å; L63-M65 VanDerWaalsContact C-N 3.25Å; L63-M65 PolarHBondContact O-N 3.42Å; L63-M65 VanDerWaalsContact O-N 3.15Å
64	C	62.3	Low	74.1	Confident	122 Å²	122	128.3 Å²	128.3	82%	0.824	64%	0.64	S	S	*	*	T	Hydrogen-bonded Turn	trans	46.1	44	178.3	-92.9	0	0	0	0	114.3	K61 S62	K61-C64 PolarHBondContact O-N 3.29Å; S62-C64 VanDerWaalsContact C-N 3.27Å; S62-C64 PolarHBondContact O-N 3.35Å
65	M	56.6	Low	72.8	Confident	154 Å²	154	130.8 Å²	130.8	76%	0.759	65%	0.651	S	S	*	*			trans	-119.8	4.2	168.3	-73	-168.2	-98.3	0	0	113.1	L63	L63-M65 VanDerWaalsContact C-N 3.25Å; L63-M65 PolarHBondContact O-N 3.42Å; L63-M65 VanDerWaalsContact O-N 3.15Å
66	F	57	Low	71.5	Confident	126 Å²	126	133.9 Å²	133.9	55%	0.553	67%	0.668	S	S	*	*			trans	-127.9	68.6	-176.4	-133.1	-91.2	0	0	0	110.3	I68	F66-I68 VanDerWaalsContact C-N 3.33Å; F66-I68 HydrophobicContact CD1-CD1 4.42Å; F66-I68 HydrophobicContact CD1-CG1 3.61Å; F66-I68 HydrophobicContact CE1-CG1 3.98Å; F66-I68 PolarHBondContact O-N 3.13Å; F66-I68 VanDerWaalsContact O-N 3.09Å
67	E	58.7	Low	70	Confident	192 Å²	192	137.2 Å²	137.2	90%	0.897	68%	0.683	S	S	*	*			trans	-67.7	101.1	154.7	-69.3	-163.1	101.7	0	0	106.6	P69	E67-P69 VanDerWaalsContact O-CD 3.27Å; E67-P69 WeakPolarHBondContact O-CD 3.36Å
68	I	58.8	Low	68.5	Low	105 Å²	105	140.7 Å²	140.7	54%	0.538	70%	0.699	S	S	.	*			trans	-64.9	117.1	168.4	-58.2	173.5	0	0	0	105.3	F66 K70	F66-I68 VanDerWaalsContact C-N 3.33Å; F66-I68 HydrophobicContact CD1-CD1 4.42Å; F66-I68 HydrophobicContact CD1-CG1 3.61Å; F66-I68 HydrophobicContact CE1-CG1 3.98Å; F66-I68 PolarHBondContact O-N 3.13Å; F66-I68 VanDerWaalsContact O-N 3.09Å; I68-K70 PolarHBondContact O-N 2.85Å
69	P	59.5	Low	67	Low	118 Å²	118	143.3 Å²	143.3	77%	0.766	71%	0.714	S	S	*	*			trans	-56.3	120.3	173.1	-18.3	30.6	0	0	0	107.4	E67 E71	E67-P69 VanDerWaalsContact O-CD 3.27Å; E67-P69 WeakPolarHBondContact O-CD 3.36Å; P69-E71 PolarHBondContact O-N 3.38Å
70	K	55.8	Low	65.2	Low	205 Å²	205	144.2 Å²	144.2	89%	0.891	73%	0.725	S	S	*	*			trans	-76.5	114.2	174.3	-65.7	-177.8	179.6	179.6	0	107.2	I68	I68-K70 PolarHBondContact O-N 2.85Å
71	E	49.2	Very low	63.2	Low	268 Å²	268	146.3 Å²	146.3	100%	1.252	75%	0.748	S	S	*	*			trans	-78.1	0	153.7	-85.8	176.7	80.9	0	0	109.9	P69	P69-E71 PolarHBondContact O-N 3.38Å

Retrieved 71 of 71 residues in 73.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).