A0A096MJ36_RAT Loading...

Lymphocyte antigen 6D-like

AlphaFold DB (A0A096MK57), UniProt , Accession A0A096MJ36, Species RAT (Rattus norvegicus, Rat), Gene LOC120093891, Length 88 aa.

						>A0A096MJ36_RAT|A0A096MJ36|LOC120093891
MMRPLLVLLLLAVVCTSLANPGGILVMKSCAPTCPNSTVSSDGRALSVSCCQGSQCNRSAASGLTGSLGAIWASASISLLWALLRAAW
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.5	Low	77.3	Confident	222 Å²	222	131.8 Å²	131.8	100%	1.094	67%	0.667	S	S	*	*				0	13.1	0	-66.5	156.5	172.6	0	0	114	P4	M1-P4 WeakPolarHBondContact O-CD 3.37Å
2	M	68.2	Low	77.8	Confident	163 Å²	163	125.3 Å²	125.3	80%	0.803	65%	0.648	S	S	*	*			trans	-92.8	-18.8	-174.4	-67.5	169.4	163.9	0	0	114.9	P4 L5 L6	M2-P4 VanDerWaalsContact C-CD 3.5Å; M2-L5 PolarHBondContact O-N 3.35Å; M2-L6 PolarHBondContact O-N 3.21Å
3	R	72.7	Confident	78	Confident	219 Å²	219	121.9 Å²	121.9	83%	0.826	64%	0.636	S	S	*	*	H	α-helix	trans	-56.4	-43.2	179.3	-75.8	173.7	125.5	-168.6	-1.9	115	L5 L6 V7	R3-L5 VanDerWaalsContact C-N 3.33Å; R3-L5 PolarHBondContact O-N 2.97Å; R3-L6 PolarHBondContact O-N 3.31Å; R3-V7 WeakPolarHBondContact O-CG2 3.46Å; R3-V7 PolarHBondContact O-N 3.03Å
4	P	74.9	Confident	78.2	Confident	88 Å²	88	117.4 Å²	117.4	57%	0.571	62%	0.616	S	S	*	*	H	α-helix	trans	-68.4	-33.4	-179	26.7	-34.3	0	0	0	112.6	M1 M2 V7 L8	M1-P4 WeakPolarHBondContact O-CD 3.37Å; M2-P4 VanDerWaalsContact C-CD 3.5Å; P4-V7 PolarHBondContact O-N 3.4Å; P4-L8 WeakPolarHBondContact O-CB 3.46Å; P4-L8 PolarHBondContact O-N 2.93Å
5	L	79	Confident	78.2	Confident	123 Å²	123	114.9 Å²	114.9	64%	0.644	61%	0.611	S	S	*	*	H	α-helix	trans	-64.4	-42.2	176.2	-81.2	162.7	0	0	0	111.7	M2 R3 V7 L8 L9	M2-L5 PolarHBondContact O-N 3.35Å; R3-L5 VanDerWaalsContact C-N 3.33Å; R3-L5 PolarHBondContact O-N 2.97Å; L5-V7 PolarHBondContact O-N 3.05Å; L5-L8 PolarHBondContact O-N 3.37Å; L5-L9 WeakPolarHBondContact O-CB 3.33Å; L5-L9 PolarHBondContact O-N 3.17Å
6	L	81.4	Confident	77.9	Confident	111 Å²	111	113.4 Å²	113.4	58%	0.581	61%	0.607	S	S	*	*	H	α-helix	trans	-62.1	-43.6	176.9	-166	83.1	0	0	0	111.5	M2 R3 L9 L10	M2-L6 PolarHBondContact O-N 3.21Å; R3-L6 PolarHBondContact O-N 3.31Å; L6-L9 PolarHBondContact O-N 3.49Å; L6-L10 HydrophobicContact CG-CD1 4.41Å; L6-L10 WeakPolarHBondContact O-CG 3.24Å; L6-L10 PolarHBondContact O-N 3.27Å
7	V	81.9	Confident	77.4	Confident	85 Å²	85	111.5 Å²	111.5	52%	0.515	61%	0.605	S	S	.	*	H	α-helix	trans	-64.3	-42.9	178.6	175.1	0	0	0	0	111.1	R3 P4 L5 L9 L10 L11	R3-V7 WeakPolarHBondContact O-CG2 3.46Å; R3-V7 PolarHBondContact O-N 3.03Å; P4-V7 PolarHBondContact O-N 3.4Å; L5-V7 PolarHBondContact O-N 3.05Å; V7-L9 PolarHBondContact O-N 3.46Å; V7-L10 PolarHBondContact O-N 2.9Å; V7-L11 HydrophobicContact CG1-CD1 4.11Å; V7-L11 PolarHBondContact O-N 3.45Å
8	L	81.2	Confident	76.8	Confident	117 Å²	117	113.3 Å²	113.3	61%	0.613	61%	0.613	S	S	*	*	H	α-helix	trans	-63.9	-40.9	177.5	-168.3	72.2	0	0	0	111.8	P4 L5 L11 A12	P4-L8 WeakPolarHBondContact O-CB 3.46Å; P4-L8 PolarHBondContact O-N 2.93Å; L5-L8 PolarHBondContact O-N 3.37Å; L8-L11 PolarHBondContact O-N 2.97Å; L8-A12 PolarHBondContact O-N 3.31Å
9	L	82.6	Confident	76.1	Confident	117 Å²	117	111.7 Å²	111.7	61%	0.613	62%	0.617	S	S	*	*	H	α-helix	trans	-62.8	-45.1	176.9	-164.7	87.7	0	0	0	111.3	L5 L6 V7 A12 V13	L5-L9 WeakPolarHBondContact O-CB 3.33Å; L5-L9 PolarHBondContact O-N 3.17Å; L6-L9 PolarHBondContact O-N 3.49Å; V7-L9 PolarHBondContact O-N 3.46Å; L9-A12 PolarHBondContact O-N 2.9Å; L9-V13 WeakPolarHBondContact O-CG2 3.39Å; L9-V13 PolarHBondContact O-N 2.93Å
10	L	84.3	Confident	75.3	Confident	106 Å²	106	112.6 Å²	112.6	56%	0.555	62%	0.621	S	S	*	*	H	α-helix	trans	-62.4	-43.4	177.4	-72.1	168.9	0	0	0	111.7	L6 V7 V13 V14	L6-L10 HydrophobicContact CG-CD1 4.41Å; L6-L10 WeakPolarHBondContact O-CG 3.24Å; L6-L10 PolarHBondContact O-N 3.27Å; V7-L10 PolarHBondContact O-N 2.9Å; L10-V13 PolarHBondContact O-N 2.96Å; L10-V14 VanDerWaalsContact O-CG2 3.31Å; L10-V14 WeakPolarHBondContact O-CG2 3.43Å; L10-V14 PolarHBondContact O-N 2.81Å
11	L	84	Confident	74.4	Confident	99 Å²	99	111.8 Å²	111.8	52%	0.518	62%	0.621	S	S	.	*	H	α-helix	trans	-60.1	-45.3	175.1	-82.6	163.6	0	0	0	111.9	V7 L8 V13 V14 C15	V7-L11 HydrophobicContact CG1-CD1 4.11Å; V7-L11 PolarHBondContact O-N 3.45Å; L8-L11 PolarHBondContact O-N 2.97Å; L11-V13 PolarHBondContact O-N 3.36Å; L11-V14 PolarHBondContact O-N 2.88Å; L11-C15 WeakPolarHBondContact O-CB 3.34Å; L11-C15 PolarHBondContact O-N 3.44Å; L11-C15 PolarHBondContact O-SG 3.38Å
12	A	82.5	Confident	74.5	Confident	54 Å²	54	105.2 Å²	105.2	45%	0.446	61%	0.61	S	S	.	*	H	α-helix	trans	-60.2	-45.3	178.1	0	0	0	0	0	111.9	L8 L9 V14 C15 T16	L8-A12 PolarHBondContact O-N 3.31Å; L9-A12 PolarHBondContact O-N 2.9Å; A12-V14 PolarHBondContact O-N 3Å; A12-C15 PolarHBondContact O-N 3.5Å; A12-T16 WeakPolarHBondContact O-CG2 3.38Å; A12-T16 PolarHBondContact O-N 3Å; A12-T16 PolarHBondContact O-OG1 3.49Å
13	V	81.3	Confident	74.2	Confident	81 Å²	81	100.1 Å²	100.1	49%	0.491	60%	0.599	S	S	.	*	H	α-helix	trans	-60.3	-47.3	177.2	173.5	0	0	0	0	110.8	L9 L10 L11 C15 T16 S17	L9-V13 WeakPolarHBondContact O-CG2 3.39Å; L9-V13 PolarHBondContact O-N 2.93Å; L10-V13 PolarHBondContact O-N 2.96Å; L11-V13 PolarHBondContact O-N 3.36Å; V13-C15 VanDerWaalsContact C-N 3.35Å; V13-C15 PolarHBondContact O-N 3Å; V13-T16 WeakPolarHBondContact CA-OG1 3.38Å; V13-T16 PolarHBondContact O-N 2.96Å; V13-T16 PolarHBondContact O-OG1 3.38Å; V13-S17 PolarHBondContact O-N 3.22Å; V13-S17 PolarHBondContact O-OG 3.48Å
14	V	80.2	Confident	73.8	Confident	59 Å²	59	97 Å²	97	36%	0.358	60%	0.597	S	S	.	*	H	α-helix	trans	-59.5	-45.3	177.5	172	0	0	0	0	111.4	L10 L11 A12 T16 S17 L18 W72	L10-V14 VanDerWaalsContact O-CG2 3.31Å; L10-V14 WeakPolarHBondContact O-CG2 3.43Å; L10-V14 PolarHBondContact O-N 2.81Å; L11-V14 PolarHBondContact O-N 2.88Å; A12-V14 PolarHBondContact O-N 3Å; V14-T16 VanDerWaalsContact C-N 3.33Å; V14-T16 PolarHBondContact O-N 3.33Å; V14-S17 PolarHBondContact O-N 3.38Å; V14-L18 PolarHBondContact O-N 3.37Å; V14-W72 HydrophobicContact CG1-CH2 4.22Å; V14-W72 HydrophobicContact CG1-CZ3 3.93Å; V14-W72 HydrophobicContact CG2-CH2 4.2Å; V14-W72 HydrophobicContact CG2-CZ3 4.41Å
15	C	78.9	Confident	73.4	Confident	79 Å²	79	101 Å²	101	53%	0.534	61%	0.613	S	S	.	*	H	α-helix	trans	-60.5	-41.6	177	-70.6	0	0	0	0	111.9	L11 A12 V13 L18 A19	L11-C15 WeakPolarHBondContact O-CB 3.34Å; L11-C15 PolarHBondContact O-N 3.44Å; L11-C15 PolarHBondContact O-SG 3.38Å; A12-C15 PolarHBondContact O-N 3.5Å; V13-C15 VanDerWaalsContact C-N 3.35Å; V13-C15 PolarHBondContact O-N 3Å; C15-L18 PolarHBondContact O-N 3.27Å; C15-A19 VanDerWaalsContact O-CB 3.31Å; C15-A19 WeakPolarHBondContact O-CB 3.43Å; C15-A19 PolarHBondContact O-N 3.33Å
16	T	72.8	Confident	73	Confident	91 Å²	91	99.5 Å²	99.5	56%	0.558	61%	0.609	S	S	*	*	H	α-helix	trans	-65.5	-38	177.2	56.2	0	0	0	0	113	A12 V13 V14 L18 A19 N20	A12-T16 WeakPolarHBondContact O-CG2 3.38Å; A12-T16 PolarHBondContact O-N 3Å; A12-T16 PolarHBondContact O-OG1 3.49Å; V13-T16 WeakPolarHBondContact CA-OG1 3.38Å; V13-T16 PolarHBondContact O-N 2.96Å; V13-T16 PolarHBondContact O-OG1 3.38Å; V14-T16 VanDerWaalsContact C-N 3.33Å; V14-T16 PolarHBondContact O-N 3.33Å; T16-L18 VanDerWaalsContact C-N 3.32Å; T16-A19 PolarHBondContact O-N 2.72Å; T16-N20 PolarHBondContact O-N 3.44Å
17	S	69	Low	72.7	Confident	82 Å²	82	103.1 Å²	103.1	57%	0.573	63%	0.625	S	S	*	*	H	α-helix	trans	-67.7	-34.2	176	-62.4	0	0	0	0	112.2	V13 V14	V13-S17 PolarHBondContact O-N 3.22Å; V13-S17 PolarHBondContact O-OG 3.48Å; V14-S17 PolarHBondContact O-N 3.38Å
18	L	67.4	Low	72.6	Confident	143 Å²	143	104 Å²	104	75%	0.749	62%	0.622	S	S	*	*	H	α-helix	trans	-77.5	-32.7	178.2	-160.3	67.4	0	0	0	112.4	V14 C15 T16 N20	V14-L18 PolarHBondContact O-N 3.37Å; C15-L18 PolarHBondContact O-N 3.27Å; T16-L18 VanDerWaalsContact C-N 3.32Å; L18-N20 VanDerWaalsContact C-N 3.26Å; L18-N20 PolarHBondContact O-N 3.45Å
19	A	63.6	Low	72.6	Confident	83 Å²	83	103.2 Å²	103.2	69%	0.686	63%	0.626	S	S	*	*	H	α-helix	trans	-70.1	-23.1	178.3	0	0	0	0	0	113.2	C15 T16 P21	C15-A19 VanDerWaalsContact O-CB 3.31Å; C15-A19 WeakPolarHBondContact O-CB 3.43Å; C15-A19 PolarHBondContact O-N 3.33Å; T16-A19 PolarHBondContact O-N 2.72Å; A19-P21 WeakPolarHBondContact O-CD 3.47Å
20	N	60.5	Low	72.6	Confident	129 Å²	129	103.8 Å²	103.8	69%	0.69	64%	0.639	S	S	*	*	S	Bend	trans	-111.2	70.4	175	-152.5	-10.6	0	0	0	109.4	T16 L18 G22	T16-N20 PolarHBondContact O-N 3.44Å; L18-N20 VanDerWaalsContact C-N 3.26Å; L18-N20 PolarHBondContact O-N 3.45Å; N20-G22 PolarHBondContact O-N 3.37Å
21	P	56.2	Low	72.7	Confident	97 Å²	97	101.7 Å²	101.7	63%	0.63	64%	0.637	S	S	*	*			trans	-60.7	112.9	169.8	28.3	-30.4	0	0	0	104.9	A19 G23	A19-P21 WeakPolarHBondContact O-CD 3.47Å; P21-G23 PolarHBondContact O-N 3.25Å
22	G	62.8	Low	72.7	Confident	83 Å²	83	103.7 Å²	103.7	86%	0.856	66%	0.655	S	S	*	*			trans	-66.2	42	172.1	0	0	0	0	0	111.9	N20	N20-G22 PolarHBondContact O-N 3.37Å
23	G	60.9	Low	72.9	Confident	56 Å²	56	106.3 Å²	106.3	58%	0.577	67%	0.666	S	S	*	*			trans	-79.3	120.6	-178.5	0	0	0	0	0	109.1	P21 L25	P21-G23 PolarHBondContact O-N 3.25Å; G23-L25 PolarHBondContact O-N 2.99Å
24	I	64	Low	72.9	Confident	154 Å²	154	105.5 Å²	105.5	79%	0.79	66%	0.663	S	S	*	*			trans	-63.5	121.5	166.4	-60	169.4	0	0	0	106.9	V26	I24-V26 HydrophobicContact CG2-CG2 4.28Å; I24-V26 PolarHBondContact O-N 3.39Å
25	L	67.4	Low	72.7	Confident	173 Å²	173	105.6 Å²	105.6	91%	0.906	67%	0.665	S	S	*	*			trans	-68.1	101.9	174.1	-73.7	157	0	0	0	108.6	G23	G23-L25 PolarHBondContact O-N 2.99Å
26	V	70.7	Confident	72.4	Confident	91 Å²	91	109 Å²	109	55%	0.552	68%	0.678	S	S	*	*			trans	-96.3	104.5	174.6	-178	0	0	0	0	108.6	I24	I24-V26 HydrophobicContact CG2-CG2 4.28Å; I24-V26 PolarHBondContact O-N 3.39Å
27	M	75.1	Confident	72.2	Confident	187 Å²	187	108.9 Å²	108.9	92%	0.921	68%	0.681	S	S	*	*			trans	-65.5	140.5	171.8	-75.5	-169.7	170.8	0	0	110.7
28	K	79	Confident	72.2	Confident	104 Å²	104	107.6 Å²	107.6	45%	0.452	67%	0.67	S	S	.	*			trans	-131.1	129.8	178.5	-64	-178.3	177.3	70.6	0	109	N57 S59	K28-N57 WeakPolarHBondContact CD-O 3.48Å; K28-N57 WeakPolarHBondContact CE-O 3.31Å; K28-S59 WeakPolarHBondContact CE-OG 3.44Å; K28-S59 PolarHBondContact NZ-OG 3.48Å
29	S	80.9	Confident	72.2	Confident	100 Å²	100	105.8 Å²	105.8	70%	0.699	66%	0.664	S	S	*	*			trans	-145.3	162	176.5	55.5	0	0	0	0	110.1
30	C	84.3	Confident	72.5	Confident	129 Å²	129	103.5 Å²	103.5	87%	0.872	64%	0.643	S	S	*	*			trans	-97.6	130.5	166.3	-60.3	0	0	0	0	107.4
31	A	85.3	Confident	73.1	Confident	62 Å²	62	103.7 Å²	103.7	51%	0.512	66%	0.655	S	S	.	*			trans	-137	145.7	177.8	0	0	0	0	0	109.6	T33	A31-T33 VanDerWaalsContact CB-O 3.23Å; A31-T33 WeakPolarHBondContact CB-O 3.43Å; A31-T33 PolarHBondContact O-N 3.5Å
32	P	84.1	Confident	74.2	Confident	140 Å²	140	105.4 Å²	105.4	91%	0.909	66%	0.658	S	S	*	*	S	Bend	trans	-67.6	-25.2	177.4	28.2	-34.7	0	0	0	112.1
33	T	85.8	Confident	74.8	Confident	109 Å²	109	104.2 Å²	104.2	67%	0.669	65%	0.646	S	S	*	*	S	Bend	trans	-126	142.9	174.2	53.2	0	0	0	0	109.1	A31	A31-T33 VanDerWaalsContact CB-O 3.23Å; A31-T33 WeakPolarHBondContact CB-O 3.43Å; A31-T33 PolarHBondContact O-N 3.5Å
34	C	81.6	Confident	75.5	Confident	64 Å²	64	110.6 Å²	110.6	43%	0.432	65%	0.653	S	S	.	*			trans	-120.6	108.3	179.3	-159.5	0	0	0	0	109.4	C50	C34-C50 HydrophobicContact CB-CB 3.62Å; C34-C50 WeakPolarHBondContact CB-SG 3.43Å; C34-C50 WeakPolarHBondContact SG-CB 3.34Å; C34-C50 CovalentContact SG-SG 2Å; C34-C50 PolarHBondContact SG-SG 3.48Å
35	P	77.5	Confident	76	Confident	62 Å²	62	107.6 Å²	107.6	40%	0.403	65%	0.651	S	S	.	*			trans	-75.4	141.8	179.7	30.4	-34.7	0	0	0	110.7	S37 T38 V48	P35-S37 PolarHBondContact O-N 3.4Å; P35-S37 VanDerWaalsContact O-N 3.12Å; P35-T38 HydrophobicContact CG-CG2 3.71Å; P35-V48 WeakPolarHBondContact O-CB 3.47Å; P35-V48 WeakPolarHBondContact O-CG1 3.47Å
36	N	71.6	Confident	76.4	Confident	151 Å²	151	103.4 Å²	103.4	81%	0.807	63%	0.629	S	S	*	*	S	Bend	trans	-65.6	-11.6	175.3	-82.1	15	0	0	0	113.3
37	S	68.3	Low	76.8	Confident	88 Å²	88	105 Å²	105	62%	0.615	65%	0.645	S	S	*	*			trans	-153.7	130.5	-178.9	-46.4	0	0	0	0	109	P35	P35-S37 PolarHBondContact O-N 3.4Å; P35-S37 VanDerWaalsContact O-N 3.12Å
38	T	68.9	Low	77.1	Confident	55 Å²	55	98.1 Å²	98.1	34%	0.337	61%	0.613	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-114.6	144.6	164.6	43.3	0	0	0	0	109.1	P35 L46 V48	P35-T38 HydrophobicContact CG-CG2 3.71Å; T38-L46 PolarHBondContact O-N 3.37Å; T38-V48 HydrophobicContact CG2-CG2 3.89Å; T38-V48 WeakPolarHBondContact OG1-CG2 3.31Å
39	V	68.6	Low	77.3	Confident	105 Å²	105	98.6 Å²	98.6	64%	0.636	63%	0.629	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-101.2	124.3	172.7	-170.8	0	0	0	0	106.3
40	S	70.1	Confident	77.5	Confident	35 Å²	35	96.7 Å²	96.7	25%	0.245	62%	0.615	C	S	.	*			trans	-61.8	158.9	171.1	-166	0	0	0	0	109.5	D42 G43 R44	S40-D42 PolarHBondContact O-N 2.95Å; S40-D42 PolarHBondContact OG-OD2 3.01Å; S40-G43 PolarHBondContact O-N 2.87Å; S40-R44 PolarHBondContact N-O 3.01Å
41	S	73	Confident	77.6	Confident	133 Å²	133	93.7 Å²	93.7	93%	0.93	60%	0.595	S	S	*	*	T	Hydrogen-bonded Turn	trans	-52.8	-24.2	171.7	-59.6	0	0	0	0	113.1	G43	S41-G43 VanDerWaalsContact C-N 3.29Å; S41-G43 PolarHBondContact O-N 3.23Å
42	D	78.4	Confident	77.8	Confident	132 Å²	132	100.1 Å²	100.1	71%	0.706	62%	0.615	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83	7.3	176.1	-46.3	-62	0	0	0	114.6	S40 R44	S40-D42 PolarHBondContact O-N 2.95Å; S40-D42 PolarHBondContact OG-OD2 3.01Å; D42-R44 PolarHBondContact O-N 2.94Å
43	G	74.9	Confident	77.8	Confident	58 Å²	58	96.1 Å²	96.1	60%	0.598	60%	0.599	S	S	*	*	S	Bend	trans	75.8	2.5	-177.9	0	0	0	0	0	114.9	S40 S41	S40-G43 PolarHBondContact O-N 2.87Å; S41-G43 VanDerWaalsContact C-N 3.29Å; S41-G43 PolarHBondContact O-N 3.23Å
44	R	75.9	Confident	77.7	Confident	191 Å²	191	96.2 Å²	96.2	72%	0.721	60%	0.604	S	S	*	*	P	Polyproline II helix	trans	-79.6	134.2	177.8	-65.9	-172.5	-179.8	-127.7	0.9	111.1	S40 D42 L46	S40-R44 PolarHBondContact N-O 3.01Å; D42-R44 PolarHBondContact O-N 2.94Å; R44-L46 PolarHBondContact O-N 3.25Å
45	A	74.6	Confident	77.8	Confident	91 Å²	91	98.9 Å²	98.9	75%	0.752	61%	0.61	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-67.4	122.1	170.2	0	0	0	0	0	109.9
46	L	76.5	Confident	78.1	Confident	84 Å²	84	98.5 Å²	98.5	44%	0.44	61%	0.608	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-99.1	134.5	174	-68.8	161.8	0	0	0	108.5	T38 R44 V48	T38-L46 PolarHBondContact O-N 3.37Å; R44-L46 PolarHBondContact O-N 3.25Å; L46-V48 PolarHBondContact O-N 3.31Å
47	S	77.9	Confident	78.6	Confident	126 Å²	126	94.3 Å²	94.3	88%	0.881	59%	0.586	S	S	*	*	P	Polyproline II helix	trans	-72.9	121.7	171.8	-178.4	0	0	0	0	109
48	V	81.8	Confident	78.9	Confident	42 Å²	42	99 Å²	99	26%	0.255	59%	0.59	S	S	.	*			trans	-105.8	129.3	176.5	-174.1	0	0	0	0	108.5	P35 T38 L46	P35-V48 WeakPolarHBondContact O-CB 3.47Å; P35-V48 WeakPolarHBondContact O-CG1 3.47Å; T38-V48 HydrophobicContact CG2-CG2 3.89Å; T38-V48 WeakPolarHBondContact OG1-CG2 3.31Å; L46-V48 PolarHBondContact O-N 3.31Å
49	S	83.5	Confident	78.8	Confident	114 Å²	114	98.6 Å²	98.6	80%	0.797	59%	0.589	S	S	*	*			trans	-118.1	126.3	172.2	-173.8	0	0	0	0	109.2
50	C	85.3	Confident	78.2	Confident	59 Å²	59	97.7 Å²	97.7	40%	0.399	59%	0.592	S	S	.	*			trans	-108.7	140.7	-175.6	-50.1	0	0	0	0	109.1	C34	C34-C50 HydrophobicContact CB-CB 3.62Å; C34-C50 WeakPolarHBondContact CB-SG 3.43Å; C34-C50 WeakPolarHBondContact SG-CB 3.34Å; C34-C50 CovalentContact SG-SG 2Å; C34-C50 PolarHBondContact SG-SG 3.48Å
51	C	86.5	Confident	77.5	Confident	67 Å²	67	99 Å²	99	45%	0.453	61%	0.606	S	S	.	*			trans	-143.8	154.3	172.9	61	0	0	0	0	109.2	C56 N57	C51-C56 HydrophobicContact CB-CB 3.59Å; C51-C56 WeakPolarHBondContact CB-SG 3.26Å; C51-C56 PolarHBondContact O-SG 3.02Å; C51-C56 WeakPolarHBondContact SG-CB 3.34Å; C51-C56 CovalentContact SG-SG 2.03Å; C51-C56 PolarHBondContact SG-SG 3.04Å; C51-N57 PolarHBondContact SG-N 3.37Å
52	Q	88.4	Confident	76.5	Confident	197 Å²	197	97.4 Å²	97.4	92%	0.921	59%	0.594	S	S	*	*			trans	-106.6	139.4	177.5	-166.3	172.9	12.5	0	0	109.7
53	G	84.5	Confident	75.3	Confident	56 Å²	56	93.5 Å²	93.5	58%	0.577	59%	0.586	S	S	*	*	S	Bend	trans	112	164.6	178.5	0	0	0	0	0	113.7	Q55 C56	G53-Q55 PolarHBondContact O-N 2.98Å; G53-C56 PolarHBondContact O-SG 3.32Å
54	S	84.8	Confident	74.3	Confident	110 Å²	110	96.2 Å²	96.2	77%	0.769	59%	0.586	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.6	132	178.6	58.2	0	0	0	0	110.8	C56	S54-C56 PolarHBondContact O-N 3.46Å; S54-C56 VanDerWaalsContact O-N 3.13Å
55	Q	83.2	Confident	73.4	Confident	120 Å²	120	92.4 Å²	92.4	56%	0.561	58%	0.584	S	S	*	*	T	Hydrogen-bonded Turn	trans	60.9	18.2	175.1	-51.1	177.9	79.6	0	0	114.9	G53 N57 R58	G53-Q55 PolarHBondContact O-N 2.98Å; Q55-N57 PolarHBondContact O-N 2.92Å; Q55-R58 HydrophobicContact CB-CG 4.39Å; Q55-R58 WeakPolarHBondContact O-CG 3.48Å; Q55-R58 PolarHBondContact O-N 3.4Å
56	C	83.3	Confident	72.6	Confident	54 Å²	54	90.2 Å²	90.2	37%	0.365	57%	0.57	S	S	.	*	T	Hydrogen-bonded Turn	trans	-66.2	-26.7	179.3	68.2	0	0	0	0	112.4	C51 G53 S54 R58	C51-C56 HydrophobicContact CB-CB 3.59Å; C51-C56 WeakPolarHBondContact CB-SG 3.26Å; C51-C56 PolarHBondContact O-SG 3.02Å; C51-C56 WeakPolarHBondContact SG-CB 3.34Å; C51-C56 CovalentContact SG-SG 2.03Å; C51-C56 PolarHBondContact SG-SG 3.04Å; G53-C56 PolarHBondContact O-SG 3.32Å; S54-C56 PolarHBondContact O-N 3.46Å; S54-C56 VanDerWaalsContact O-N 3.13Å; C56-R58 PolarHBondContact O-N 3.03Å
57	N	81.7	Confident	71.9	Confident	64 Å²	64	88.8 Å²	88.8	34%	0.342	57%	0.567	S	S	.	*	T	Hydrogen-bonded Turn	trans	-83.8	18.7	-179.7	68.5	-6.3	0	0	0	112.9	K28 C51 Q55 S59	K28-N57 WeakPolarHBondContact CD-O 3.48Å; K28-N57 WeakPolarHBondContact CE-O 3.31Å; C51-N57 PolarHBondContact SG-N 3.37Å; Q55-N57 PolarHBondContact O-N 2.92Å; N57-S59 PolarHBondContact O-N 3.27Å
58	R	75	Confident	71.5	Confident	187 Å²	187	87.6 Å²	87.6	71%	0.706	55%	0.551	S	S	*	*			trans	-66.3	107.7	171.6	-83.9	-164.2	-172	-167.8	5	109.2	Q55 C56 A60	Q55-R58 HydrophobicContact CB-CG 4.39Å; Q55-R58 WeakPolarHBondContact O-CG 3.48Å; Q55-R58 PolarHBondContact O-N 3.4Å; C56-R58 PolarHBondContact O-N 3.03Å; R58-A60 PolarHBondContact O-N 3.47Å
59	S	66.4	Low	70.9	Confident	45 Å²	45	87.7 Å²	87.7	32%	0.315	56%	0.56	S	S	.	*			trans	-65.2	120.2	167.5	-57.2	0	0	0	0	108.9	K28 N57 A61 S62	K28-S59 WeakPolarHBondContact CE-OG 3.44Å; K28-S59 PolarHBondContact NZ-OG 3.48Å; N57-S59 PolarHBondContact O-N 3.27Å; S59-A61 PolarHBondContact O-N 3.48Å; S59-S62 PolarHBondContact O-N 3.45Å
60	A	56.4	Low	70.4	Confident	86 Å²	86	85.1 Å²	85.1	71%	0.711	55%	0.545	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.2	-17.9	172	0	0	0	0	0	113	R58 S62 G63	R58-A60 PolarHBondContact O-N 3.47Å; A60-S62 PolarHBondContact O-N 3.09Å; A60-G63 PolarHBondContact O-N 2.99Å
61	A	54.6	Low	69.9	Low	63 Å²	63	87.4 Å²	87.4	52%	0.521	55%	0.552	S	S	.	*	H	α-helix	trans	-54.8	-32.2	177.8	0	0	0	0	0	113.7	S59 G63 L64 T65	S59-A61 PolarHBondContact O-N 3.48Å; A61-G63 PolarHBondContact O-N 3.38Å; A61-L64 PolarHBondContact O-N 3.01Å; A61-T65 PolarHBondContact O-N 3.31Å
62	S	53.6	Low	69.5	Low	99 Å²	99	91 Å²	91	69%	0.692	56%	0.556	S	S	*	*	H	α-helix	trans	-61.1	-27.8	175.8	-56.2	0	0	0	0	112.7	S59 A60 G66	S59-S62 PolarHBondContact O-N 3.45Å; A60-S62 PolarHBondContact O-N 3.09Å; S62-G66 PolarHBondContact O-N 2.95Å
63	G	53	Low	68.9	Low	51 Å²	51	84 Å²	84	53%	0.526	53%	0.532	S	S	.	.	H	α-helix	trans	-74.6	-36.7	177.5	0	0	0	0	0	113.7	A60 A61 S67	A60-G63 PolarHBondContact O-N 2.99Å; A61-G63 PolarHBondContact O-N 3.38Å; G63-S67 PolarHBondContact O-N 3.44Å; G63-S67 VanDerWaalsContact O-N 3.13Å; G63-S67 PolarHBondContact O-OG 2.91Å
64	L	53.1	Low	68.6	Low	115 Å²	115	84.4 Å²	84.4	60%	0.602	53%	0.526	S	S	*	.	H	α-helix	trans	-71.9	-39.8	179.8	-90.8	87.7	0	0	0	112.5	A61 G66 S67 L68	A61-L64 PolarHBondContact O-N 3.01Å; L64-G66 VanDerWaalsContact C-N 3.31Å; L64-G66 PolarHBondContact O-N 3.27Å; L64-S67 PolarHBondContact O-N 3.42Å; L64-S67 PolarHBondContact O-OG 3Å; L64-L68 PolarHBondContact O-N 3.18Å; L64-L68 VanDerWaalsContact O-N 3.1Å
65	T	56.5	Low	68.5	Low	110 Å²	110	81.7 Å²	81.7	68%	0.675	51%	0.511	S	S	*	.	H	α-helix	trans	-65.9	-37.6	176.7	-54.3	0	0	0	0	111.2	A61 G69	A61-T65 PolarHBondContact O-N 3.31Å; T65-G69 PolarHBondContact O-N 2.94Å; T65-G69 VanDerWaalsContact O-N 3.09Å
66	G	58	Low	68.4	Low	45 Å²	45	78.7 Å²	78.7	46%	0.464	50%	0.503	S	S	.	.	H	α-helix	trans	-64.2	-42.8	175.9	0	0	0	0	0	113.2	S62 L64 G69 A70	S62-G66 PolarHBondContact O-N 2.95Å; L64-G66 VanDerWaalsContact C-N 3.31Å; L64-G66 PolarHBondContact O-N 3.27Å; G66-G69 PolarHBondContact O-N 3.41Å; G66-A70 WeakPolarHBondContact O-CB 3.4Å; G66-A70 PolarHBondContact O-N 3.36Å
67	S	63.1	Low	68.4	Low	55 Å²	55	81.4 Å²	81.4	39%	0.385	51%	0.513	S	S	.	.	H	α-helix	trans	-69.4	-40.9	179.6	65.5	0	0	0	0	112.5	G63 L64 G69 A70 I71	G63-S67 PolarHBondContact O-N 3.44Å; G63-S67 VanDerWaalsContact O-N 3.13Å; G63-S67 PolarHBondContact O-OG 2.91Å; L64-S67 PolarHBondContact O-N 3.42Å; L64-S67 PolarHBondContact O-OG 3Å; S67-G69 PolarHBondContact O-N 3.29Å; S67-A70 PolarHBondContact O-N 3.49Å; S67-I71 VanDerWaalsContact O-CG1 3.26Å; S67-I71 WeakPolarHBondContact O-CG1 3Å; S67-I71 PolarHBondContact O-N 3.47Å
68	L	68.9	Low	68.5	Low	101 Å²	101	82 Å²	82	53%	0.529	52%	0.522	S	S	.	.	H	α-helix	trans	-62.2	-42.8	175	-110.8	112.9	0	0	0	111.9	L64 A70 I71 W72	L64-L68 PolarHBondContact O-N 3.18Å; L64-L68 VanDerWaalsContact O-N 3.1Å; L68-A70 VanDerWaalsContact C-N 3.34Å; L68-A70 PolarHBondContact O-N 3.26Å; L68-I71 PolarHBondContact O-N 3.02Å; L68-W72 PolarHBondContact O-N 3.13Å
69	G	68.6	Low	68.9	Low	43 Å²	43	78.6 Å²	78.6	44%	0.443	52%	0.517	S	S	.	.	H	α-helix	trans	-60.6	-42.4	175.1	0	0	0	0	0	112.5	T65 G66 S67 W72 A73	T65-G69 PolarHBondContact O-N 2.94Å; T65-G69 VanDerWaalsContact O-N 3.09Å; G66-G69 PolarHBondContact O-N 3.41Å; S67-G69 PolarHBondContact O-N 3.29Å; G69-W72 PolarHBondContact O-N 2.68Å; G69-A73 WeakPolarHBondContact O-CB 3.02Å; G69-A73 PolarHBondContact O-N 3.1Å
70	A	72.7	Confident	69.6	Low	60 Å²	60	81.8 Å²	81.8	50%	0.496	53%	0.53	S	S	.	.	H	α-helix	trans	-65	-43	177.3	0	0	0	0	0	112.6	G66 S67 L68 A73 S74	G66-A70 WeakPolarHBondContact O-CB 3.4Å; G66-A70 PolarHBondContact O-N 3.36Å; S67-A70 PolarHBondContact O-N 3.49Å; L68-A70 VanDerWaalsContact C-N 3.34Å; L68-A70 PolarHBondContact O-N 3.26Å; A70-A73 PolarHBondContact O-N 3.43Å; A70-S74 PolarHBondContact O-N 3.34Å; A70-S74 PolarHBondContact O-OG 3.18Å
71	I	76.7	Confident	70.9	Confident	107 Å²	107	84.9 Å²	84.9	55%	0.549	52%	0.523	S	S	.	.	H	α-helix	trans	-61.7	-47.5	176.9	-66.6	163.8	0	0	0	109.9	S67 L68 A73 S74 A75	S67-I71 VanDerWaalsContact O-CG1 3.26Å; S67-I71 WeakPolarHBondContact O-CG1 3Å; S67-I71 PolarHBondContact O-N 3.47Å; L68-I71 PolarHBondContact O-N 3.02Å; I71-A73 PolarHBondContact O-N 3.49Å; I71-S74 PolarHBondContact O-N 3.33Å; I71-S74 PolarHBondContact O-OG 3.26Å; I71-A75 WeakPolarHBondContact O-CB 3.08Å; I71-A75 PolarHBondContact O-N 3.48Å
72	W	76.6	Confident	72.3	Confident	142 Å²	142	84.3 Å²	84.3	54%	0.538	52%	0.519	S	S	.	.	H	α-helix	trans	-60	-46.7	177.6	-93.7	84.4	0	0	0	112.4	V14 L68 G69 S74 A75 S76	V14-W72 HydrophobicContact CG1-CH2 4.22Å; V14-W72 HydrophobicContact CG1-CZ3 3.93Å; V14-W72 HydrophobicContact CG2-CH2 4.2Å; V14-W72 HydrophobicContact CG2-CZ3 4.41Å; L68-W72 PolarHBondContact O-N 3.13Å; G69-W72 PolarHBondContact O-N 2.68Å; W72-S74 VanDerWaalsContact C-N 3.31Å; W72-S74 PolarHBondContact O-N 3.03Å; W72-A75 PolarHBondContact O-N 3.21Å; W72-S76 WeakPolarHBondContact O-CB 3.43Å; W72-S76 PolarHBondContact O-N 2.94Å; W72-S76 PolarHBondContact O-OG 3.43Å
73	A	75.4	Confident	73.5	Confident	50 Å²	50	85 Å²	85	41%	0.413	52%	0.515	S	S	.	.	H	α-helix	trans	-57.9	-44.5	176.7	0	0	0	0	0	111.7	G69 A70 I71 A75 S76 I77	G69-A73 WeakPolarHBondContact O-CB 3.02Å; G69-A73 PolarHBondContact O-N 3.1Å; A70-A73 PolarHBondContact O-N 3.43Å; I71-A73 PolarHBondContact O-N 3.49Å; A73-A75 PolarHBondContact O-N 3.34Å; A73-S76 PolarHBondContact O-N 3.22Å; A73-I77 WeakPolarHBondContact O-CD1 3.01Å; A73-I77 VanDerWaalsContact O-CG1 3.24Å; A73-I77 WeakPolarHBondContact O-CG1 3.07Å; A73-I77 PolarHBondContact O-N 2.68Å
74	S	79.8	Confident	74.9	Confident	65 Å²	65	87 Å²	87	46%	0.455	51%	0.512	S	S	.	.	H	α-helix	trans	-64.9	-39.5	178.4	72.9	0	0	0	0	113	A70 I71 W72 S78	A70-S74 PolarHBondContact O-N 3.34Å; A70-S74 PolarHBondContact O-OG 3.18Å; I71-S74 PolarHBondContact O-N 3.33Å; I71-S74 PolarHBondContact O-OG 3.26Å; W72-S74 VanDerWaalsContact C-N 3.31Å; W72-S74 PolarHBondContact O-N 3.03Å; S74-S78 WeakPolarHBondContact O-CB 3.23Å; S74-S78 PolarHBondContact O-N 2.91Å; S74-S78 PolarHBondContact O-OG 3.49Å
75	A	81.8	Confident	76.4	Confident	53 Å²	53	89.7 Å²	89.7	44%	0.438	52%	0.515	S	S	.	.	H	α-helix	trans	-67.2	-43.2	176.5	0	0	0	0	0	111.2	I71 W72 A73 S78 L79	I71-A75 WeakPolarHBondContact O-CB 3.08Å; I71-A75 PolarHBondContact O-N 3.48Å; W72-A75 PolarHBondContact O-N 3.21Å; A73-A75 PolarHBondContact O-N 3.34Å; A75-S78 PolarHBondContact O-N 3.13Å; A75-L79 WeakPolarHBondContact O-CB 2.96Å; A75-L79 PolarHBondContact O-N 3.32Å
76	S	82.2	Confident	77.4	Confident	58 Å²	58	88.6 Å²	88.6	41%	0.406	52%	0.516	S	S	.	.	H	α-helix	trans	-61.5	-46.5	176.5	-60.6	0	0	0	0	111.7	W72 A73 S78 L79 L80	W72-S76 WeakPolarHBondContact O-CB 3.43Å; W72-S76 PolarHBondContact O-N 2.94Å; W72-S76 PolarHBondContact O-OG 3.43Å; A73-S76 PolarHBondContact O-N 3.22Å; S76-S78 VanDerWaalsContact C-N 3.34Å; S76-S78 PolarHBondContact O-N 3.31Å; S76-L79 PolarHBondContact O-N 3.32Å; S76-L80 WeakPolarHBondContact O-CB 3.41Å; S76-L80 PolarHBondContact O-N 2.03Å
77	I	83.5	Confident	78.2	Confident	110 Å²	110	90.5 Å²	90.5	56%	0.564	53%	0.528	S	S	*	.	H	α-helix	trans	-60.7	-45.4	176.7	-69	163.4	0	0	0	110.6	A73 L79 L80 W81	A73-I77 WeakPolarHBondContact O-CD1 3.01Å; A73-I77 VanDerWaalsContact O-CG1 3.24Å; A73-I77 WeakPolarHBondContact O-CG1 3.07Å; A73-I77 PolarHBondContact O-N 2.68Å; I77-L79 VanDerWaalsContact C-N 3.33Å; I77-L79 PolarHBondContact O-N 3.29Å; I77-L80 PolarHBondContact O-N 3.22Å; I77-W81 WeakPolarHBondContact O-CB 3.36Å; I77-W81 PolarHBondContact O-N 3.26Å
78	S	83.7	Confident	77.9	Confident	76 Å²	76	100.9 Å²	100.9	53%	0.531	56%	0.559	S	S	.	*	H	α-helix	trans	-62.1	-41	178.7	-59.9	0	0	0	0	112	S74 A75 S76 W81 A82	S74-S78 WeakPolarHBondContact O-CB 3.23Å; S74-S78 PolarHBondContact O-N 2.91Å; S74-S78 PolarHBondContact O-OG 3.49Å; A75-S78 PolarHBondContact O-N 3.13Å; S76-S78 VanDerWaalsContact C-N 3.34Å; S76-S78 PolarHBondContact O-N 3.31Å; S78-W81 PolarHBondContact O-N 2.97Å; S78-A82 WeakPolarHBondContact O-CB 3.41Å; S78-A82 PolarHBondContact O-N 3.39Å
79	L	82	Confident	78.3	Confident	117 Å²	117	100.9 Å²	100.9	61%	0.613	56%	0.56	S	S	*	*	H	α-helix	trans	-68.3	-43.4	177.9	-156.9	110.9	0	0	0	111.6	A75 S76 I77 W81 A82 L83	A75-L79 WeakPolarHBondContact O-CB 2.96Å; A75-L79 PolarHBondContact O-N 3.32Å; S76-L79 PolarHBondContact O-N 3.32Å; I77-L79 VanDerWaalsContact C-N 3.33Å; I77-L79 PolarHBondContact O-N 3.29Å; L79-W81 VanDerWaalsContact C-N 3.3Å; L79-W81 PolarHBondContact O-N 3.04Å; L79-A82 PolarHBondContact O-N 3.41Å; L79-L83 HydrophobicContact CD2-CD1 4.07Å; L79-L83 WeakPolarHBondContact O-CG 2.94Å; L79-L83 PolarHBondContact O-N 2.98Å
80	L	82.1	Confident	78.8	Confident	112 Å²	112	103.9 Å²	103.9	59%	0.586	57%	0.566	S	S	*	*	H	α-helix	trans	-59.8	-43.2	175	-123.5	135.1	0	0	0	111	S76 I77 L83 L84	S76-L80 WeakPolarHBondContact O-CB 3.41Å; S76-L80 PolarHBondContact O-N 2.03Å; I77-L80 PolarHBondContact O-N 3.22Å; L80-L83 PolarHBondContact O-N 3.07Å; L80-L84 HydrophobicContact CD2-CD1 4.37Å; L80-L84 WeakPolarHBondContact O-CG 2.97Å; L80-L84 PolarHBondContact O-N 3.21Å
81	W	83.4	Confident	79.2	Confident	150 Å²	150	106.3 Å²	106.3	57%	0.568	57%	0.57	S	S	*	*	H	α-helix	trans	-66.2	-39.5	177.4	-165.1	-71.8	0	0	0	112.4	I77 S78 L79 L84 R85	I77-W81 WeakPolarHBondContact O-CB 3.36Å; I77-W81 PolarHBondContact O-N 3.26Å; S78-W81 PolarHBondContact O-N 2.97Å; L79-W81 VanDerWaalsContact C-N 3.3Å; L79-W81 PolarHBondContact O-N 3.04Å; W81-L84 PolarHBondContact O-N 3.4Å; W81-R85 VanDerWaalsContact NE1-NH1 3.19Å; W81-R85 PolarHBondContact O-N 2.86Å
82	A	83.3	Confident	79.3	Confident	52 Å²	52	106.3 Å²	106.3	43%	0.43	57%	0.572	S	S	.	*	H	α-helix	trans	-64.9	-40.8	174.7	0	0	0	0	0	112.1	S78 L79 R85 A86	S78-A82 WeakPolarHBondContact O-CB 3.41Å; S78-A82 PolarHBondContact O-N 3.39Å; L79-A82 PolarHBondContact O-N 3.41Å; A82-R85 PolarHBondContact O-N 3.26Å; A82-A86 PolarHBondContact O-N 2.86Å
83	L	80.1	Confident	79.5	Confident	114 Å²	114	104.1 Å²	104.1	60%	0.597	57%	0.574	S	S	*	*	H	α-helix	trans	-65.7	-41.4	176.2	-73.4	169.7	0	0	0	112.2	L79 L80 A86 A87	L79-L83 HydrophobicContact CD2-CD1 4.07Å; L79-L83 WeakPolarHBondContact O-CG 2.94Å; L79-L83 PolarHBondContact O-N 2.98Å; L80-L83 PolarHBondContact O-N 3.07Å; L83-A86 PolarHBondContact O-N 2Å; L83-A87 PolarHBondContact O-N 3.12Å
84	L	81.6	Confident	79.7	Confident	92 Å²	92	107.7 Å²	107.7	48%	0.482	58%	0.584	S	S	.	*	H	α-helix	trans	-60.1	-49.9	172.5	-75.3	165	0	0	0	110	L80 W81 A86 A87 W88	L80-L84 HydrophobicContact CD2-CD1 4.37Å; L80-L84 WeakPolarHBondContact O-CG 2.97Å; L80-L84 PolarHBondContact O-N 3.21Å; W81-L84 PolarHBondContact O-N 3.4Å; L84-A86 PolarHBondContact O-N 3.35Å; L84-A87 PolarHBondContact O-N 2.84Å; L84-W88 PolarHBondContact O-N 3.42Å
85	R	84.6	Confident	79.7	Confident	172 Å²	172	110.7 Å²	110.7	65%	0.649	59%	0.594	S	S	*	*	H	α-helix	trans	-61.4	-25.6	177.7	-80.3	-164.1	-76.5	-132.3	-3.1	115.2	W81 A82	W81-R85 VanDerWaalsContact NE1-NH1 3.19Å; W81-R85 PolarHBondContact O-N 2.86Å; A82-R85 PolarHBondContact O-N 3.26Å
86	A	76.5	Confident	79.6	Confident	86 Å²	86	115.2 Å²	115.2	71%	0.711	61%	0.606	S	S	*	*	H	α-helix	trans	-84.6	-14.9	177.5	0	0	0	0	0	113.3	A82 L83 L84	A82-A86 PolarHBondContact O-N 2.86Å; L83-A86 PolarHBondContact O-N 2Å; L84-A86 PolarHBondContact O-N 3.35Å
87	A	74.8	Confident	79.4	Confident	85 Å²	85	119.9 Å²	119.9	70%	0.702	62%	0.622	S	S	*	*	H	α-helix	trans	-94.4	-12.9	-179.9	0	0	0	0	0	113.5	L83 L84	L83-A87 PolarHBondContact O-N 3.12Å; L84-A87 PolarHBondContact O-N 2.84Å
88	W	56.8	Low	79	Confident	273 Å²	273	120.8 Å²	120.8	100%	1.034	63%	0.628	S	S	*	*			trans	-106.5	0	173.5	-67.6	71.9	0	0	0	109.5	L84	L84-W88 PolarHBondContact O-N 3.42Å

Retrieved 88 of 88 residues in 13.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).