A0A096MLG1_PAPAN Loading...

KIAA0040

AlphaFold DB (H9ZFR0), UniProt , Accession A0A096MLG1, Species PAPAN (Papio anubis, Olive baboon), Gene KIAA0040, Length 98 aa.

						>A0A096MLG1_PAPAN|A0A096MLG1|KIAA0040
MERISAFFSSIWDTILTKHQEGIYNTICLGVLLGLPLLVIITLLFMCCHCCWSPPGKRGQQPEKNKKKKKKKKKDEEDLWISAQPKLLQMEKRPSLPV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	60.9	Low	80.2	Confident	189 Å²	189	117.7 Å²	117.7	93%	0.931	60%	0.602	S	S	*	*				0	-52.1	0	-65.2	-57.7	-95.7	0	0	111.2	R3 I4 S5	M1-R3 VanDerWaalsContact C-N 3.31Å; M1-R3 PolarHBondContact O-N 3.35Å; M1-R3 VanDerWaalsContact O-N 3.1Å; M1-I4 WeakPolarHBondContact O-CB 3.28Å; M1-I4 PolarHBondContact O-N 3.17Å; M1-S5 PolarHBondContact O-N 2.95Å
2	E	78.2	Confident	80.3	Confident	153 Å²	153	119.9 Å²	119.9	72%	0.715	60%	0.597	S	S	*	*	H	α-helix	trans	-56.9	-36.2	-164.2	-55.1	116.7	114.2	0	0	115.5	I4 S5 A6	E2-I4 VanDerWaalsContact C-N 3.28Å; E2-I4 PolarHBondContact O-N 2.97Å; E2-S5 VanDerWaalsContact CA-OG 3.3Å; E2-S5 WeakPolarHBondContact CA-OG 3.28Å; E2-S5 PolarHBondContact O-N 2.67Å; E2-S5 PolarHBondContact O-OG 3.37Å; E2-A6 WeakPolarHBondContact O-CB 3.18Å; E2-A6 PolarHBondContact O-N 2.94Å
3	R	80.2	Confident	80.5	Confident	204 Å²	204	118.4 Å²	118.4	77%	0.77	59%	0.592	S	S	*	*	H	α-helix	trans	-57	-41.9	176.6	-61.8	-64.9	-179.3	169.1	-1.3	112	M1 A6 F7	M1-R3 VanDerWaalsContact C-N 3.31Å; M1-R3 PolarHBondContact O-N 3.35Å; M1-R3 VanDerWaalsContact O-N 3.1Å; R3-A6 PolarHBondContact O-N 3.49Å; R3-F7 HydrophobicContact CB-CE2 4.41Å; R3-F7 WeakPolarHBondContact O-CD2 3.36Å; R3-F7 PolarHBondContact O-N 3.32Å
4	I	81.1	Confident	80.5	Confident	100 Å²	100	115.6 Å²	115.6	51%	0.513	59%	0.585	S	S	.	*	H	α-helix	trans	-67.9	-46.5	-177.6	-58.3	171	0	0	0	109.8	M1 E2 A6 F7 F8	M1-I4 WeakPolarHBondContact O-CB 3.28Å; M1-I4 PolarHBondContact O-N 3.17Å; E2-I4 VanDerWaalsContact C-N 3.28Å; E2-I4 PolarHBondContact O-N 2.97Å; I4-A6 VanDerWaalsContact C-N 3.35Å; I4-A6 PolarHBondContact O-N 3.19Å; I4-F7 PolarHBondContact O-N 3.43Å; I4-F8 HydrophobicContact CG2-CD2 3.83Å; I4-F8 HydrophobicContact CG2-CE2 3.61Å; I4-F8 VanDerWaalsContact O-CD2 3.23Å; I4-F8 WeakPolarHBondContact O-CD2 3.48Å; I4-F8 PolarHBondContact O-N 3.39Å
5	S	80.3	Confident	80.4	Confident	65 Å²	65	110.1 Å²	110.1	46%	0.455	56%	0.557	S	S	.	*	H	α-helix	trans	-62.1	-39.8	174.4	40.4	0	0	0	0	112.4	M1 E2 F7 F8 S9	M1-S5 PolarHBondContact O-N 2.95Å; E2-S5 VanDerWaalsContact CA-OG 3.3Å; E2-S5 WeakPolarHBondContact CA-OG 3.28Å; E2-S5 PolarHBondContact O-N 2.67Å; E2-S5 PolarHBondContact O-OG 3.37Å; S5-F7 PolarHBondContact O-N 2.68Å; S5-F8 PolarHBondContact O-N 2.84Å; S5-S9 PolarHBondContact O-N 3.49Å; S5-S9 PolarHBondContact O-OG 3.19Å
6	A	83.8	Confident	80.2	Confident	53 Å²	53	108.3 Å²	108.3	44%	0.438	55%	0.549	S	S	.	.	H	α-helix	trans	-62.2	-43.8	176.9	0	0	0	0	0	112.1	E2 R3 I4 S9 S10	E2-A6 WeakPolarHBondContact O-CB 3.18Å; E2-A6 PolarHBondContact O-N 2.94Å; R3-A6 PolarHBondContact O-N 3.49Å; I4-A6 VanDerWaalsContact C-N 3.35Å; I4-A6 PolarHBondContact O-N 3.19Å; A6-S9 PolarHBondContact O-N 2.9Å; A6-S10 PolarHBondContact O-N 2.97Å; A6-S10 PolarHBondContact O-OG 3.47Å
7	F	84.6	Confident	80.1	Confident	142 Å²	142	105.6 Å²	105.6	62%	0.623	54%	0.539	S	S	*	.	H	α-helix	trans	-60.6	-45.2	173.4	-70.4	-57.5	0	0	0	112	R3 I4 S5 S9 S10 I11	R3-F7 HydrophobicContact CB-CE2 4.41Å; R3-F7 WeakPolarHBondContact O-CD2 3.36Å; R3-F7 PolarHBondContact O-N 3.32Å; I4-F7 PolarHBondContact O-N 3.43Å; S5-F7 PolarHBondContact O-N 2.68Å; F7-S9 PolarHBondContact O-N 3.2Å; F7-S10 PolarHBondContact O-N 3.36Å; F7-I11 WeakPolarHBondContact O-CB 3.34Å; F7-I11 WeakPolarHBondContact O-CD1 3.37Å; F7-I11 VanDerWaalsContact O-CG1 3.23Å; F7-I11 WeakPolarHBondContact O-CG1 3.38Å; F7-I11 PolarHBondContact O-N 2.9Å
8	F	82.8	Confident	79.7	Confident	141 Å²	141	103.9 Å²	103.9	62%	0.618	53%	0.527	S	S	*	.	H	α-helix	trans	-62.4	-39.7	176.3	-79.9	-62.8	0	0	0	112.7	I4 S5 I11 W12	I4-F8 HydrophobicContact CG2-CD2 3.83Å; I4-F8 HydrophobicContact CG2-CE2 3.61Å; I4-F8 VanDerWaalsContact O-CD2 3.23Å; I4-F8 WeakPolarHBondContact O-CD2 3.48Å; I4-F8 PolarHBondContact O-N 3.39Å; S5-F8 PolarHBondContact O-N 2.84Å; F8-I11 PolarHBondContact O-N 3.21Å; F8-W12 VanDerWaalsContact O-CB 3.26Å; F8-W12 WeakPolarHBondContact O-CB 3.26Å; F8-W12 PolarHBondContact O-N 3.11Å
9	S	82.6	Confident	79.3	Confident	79 Å²	79	101.5 Å²	101.5	55%	0.552	51%	0.514	S	S	*	.	H	α-helix	trans	-62.5	-45.9	174.3	-64.8	0	0	0	0	112.4	S5 A6 F7 I11 W12 D13	S5-S9 PolarHBondContact O-N 3.49Å; S5-S9 PolarHBondContact O-OG 3.19Å; A6-S9 PolarHBondContact O-N 2.9Å; F7-S9 PolarHBondContact O-N 3.2Å; S9-I11 PolarHBondContact O-N 2.85Å; S9-W12 PolarHBondContact O-N 3.07Å; S9-D13 WeakPolarHBondContact O-CB 3.44Å; S9-D13 PolarHBondContact O-N 2.83Å
10	S	84.1	Confident	78.8	Confident	75 Å²	75	103.6 Å²	103.6	52%	0.524	52%	0.522	S	S	.	.	H	α-helix	trans	-65.3	-38	177.2	-60.4	0	0	0	0	112.9	A6 F7 T14	A6-S10 PolarHBondContact O-N 2.97Å; A6-S10 PolarHBondContact O-OG 3.47Å; F7-S10 PolarHBondContact O-N 3.36Å; S10-T14 WeakPolarHBondContact O-CB 3.23Å; S10-T14 PolarHBondContact O-N 3.27Å; S10-T14 PolarHBondContact O-OG1 2.96Å
11	I	83.7	Confident	78.6	Confident	94 Å²	94	103.7 Å²	103.7	48%	0.482	52%	0.52	S	S	.	.	H	α-helix	trans	-65.4	-42.9	174.2	-69.3	164	0	0	0	110.2	F7 F8 S9 T14 I15	F7-I11 WeakPolarHBondContact O-CB 3.34Å; F7-I11 WeakPolarHBondContact O-CD1 3.37Å; F7-I11 VanDerWaalsContact O-CG1 3.23Å; F7-I11 WeakPolarHBondContact O-CG1 3.38Å; F7-I11 PolarHBondContact O-N 2.9Å; F8-I11 PolarHBondContact O-N 3.21Å; S9-I11 PolarHBondContact O-N 2.85Å; I11-T14 PolarHBondContact O-N 3.4Å; I11-I15 HydrophobicContact CG2-CD1 3.91Å; I11-I15 VanDerWaalsContact O-CB 3.26Å; I11-I15 WeakPolarHBondContact O-CB 3.46Å; I11-I15 WeakPolarHBondContact O-CG1 3.19Å; I11-I15 PolarHBondContact O-N 3.28Å
12	W	81.2	Confident	78.9	Confident	144 Å²	144	97.6 Å²	97.6	55%	0.545	51%	0.506	S	S	.	.	H	α-helix	trans	-64.2	-41.9	177.9	-172.5	-88.5	0	0	0	112.8	F8 S9 I15 L16 L33	F8-W12 VanDerWaalsContact O-CB 3.26Å; F8-W12 WeakPolarHBondContact O-CB 3.26Å; F8-W12 PolarHBondContact O-N 3.11Å; S9-W12 PolarHBondContact O-N 3.07Å; W12-I15 WeakPolarHBondContact O-CB 3.39Å; W12-I15 PolarHBondContact O-N 3.48Å; W12-L16 WeakPolarHBondContact O-CB 3.4Å; W12-L16 PolarHBondContact O-N 2.99Å; W12-L33 HydrophobicContact CE3-CD1 4.36Å; W12-L33 HydrophobicContact CH2-CD1 4Å; W12-L33 HydrophobicContact CZ3-CD1 3.51Å; W12-L33 HydrophobicContact CZ3-CD2 4.23Å
13	D	83.1	Confident	78.2	Confident	100 Å²	100	95.2 Å²	95.2	54%	0.535	50%	0.497	S	S	.	.	H	α-helix	trans	-67.1	-42.3	177.5	-167.3	-96.2	0	0	0	111.8	S9 I15 L16 T17	S9-D13 WeakPolarHBondContact O-CB 3.44Å; S9-D13 PolarHBondContact O-N 2.83Å; D13-I15 VanDerWaalsContact C-N 3.29Å; D13-I15 PolarHBondContact O-N 2.94Å; D13-L16 PolarHBondContact O-N 3.28Å; D13-T17 WeakPolarHBondContact O-CG2 3.45Å; D13-T17 PolarHBondContact O-N 2.9Å; D13-T17 PolarHBondContact O-OG1 2.74Å
14	T	80.8	Confident	77.4	Confident	80 Å²	80	91.3 Å²	91.3	49%	0.491	48%	0.483	S	S	.	.	H	α-helix	trans	-60	-40.4	171.3	-53.8	0	0	0	0	111.4	S10 I11 T17 K18	S10-T14 WeakPolarHBondContact O-CB 3.23Å; S10-T14 PolarHBondContact O-N 3.27Å; S10-T14 PolarHBondContact O-OG1 2.96Å; I11-T14 PolarHBondContact O-N 3.4Å; T14-T17 WeakPolarHBondContact CA-OG1 3.4Å; T14-T17 PolarHBondContact O-OG1 3.03Å; T14-T17 VanDerWaalsContact O-OG1 3.07Å; T14-K18 WeakPolarHBondContact O-CB 3.42Å; T14-K18 WeakPolarHBondContact O-CG 3.41Å; T14-K18 PolarHBondContact O-N 3.3Å; T14-K18 VanDerWaalsContact O-N 3.11Å
15	I	78.3	Confident	76.9	Confident	32 Å²	32	91.5 Å²	91.5	16%	0.164	49%	0.485	C	S	.	.	H	α-helix	trans	-63.3	-45.4	175.1	-90.7	170.4	0	0	0	111.5	I11 W12 D13 H19 L29	I11-I15 HydrophobicContact CG2-CD1 3.91Å; I11-I15 VanDerWaalsContact O-CB 3.26Å; I11-I15 WeakPolarHBondContact O-CB 3.46Å; I11-I15 WeakPolarHBondContact O-CG1 3.19Å; I11-I15 PolarHBondContact O-N 3.28Å; W12-I15 WeakPolarHBondContact O-CB 3.39Å; W12-I15 PolarHBondContact O-N 3.48Å; D13-I15 VanDerWaalsContact C-N 3.29Å; D13-I15 PolarHBondContact O-N 2.94Å; I15-H19 WeakPolarHBondContact O-CB 3.28Å; I15-H19 PolarHBondContact O-N 3.06Å; I15-L29 HydrophobicContact CB-CD1 4.34Å; I15-L29 HydrophobicContact CD1-CD1 4.06Å; I15-L29 HydrophobicContact CG1-CD1 4.11Å; I15-L29 HydrophobicContact CG2-CD1 3.39Å; I15-L29 HydrophobicContact CG2-CD2 3.51Å; I15-L29 HydrophobicContact CG2-CG 4.06Å
16	L	78.3	Confident	76.4	Confident	82 Å²	82	92.3 Å²	92.3	43%	0.429	49%	0.487	S	S	.	.	H	α-helix	trans	-70.9	-42.7	-175.6	-176.3	62.3	0	0	0	111.3	W12 D13 H19 Q20	W12-L16 WeakPolarHBondContact O-CB 3.4Å; W12-L16 PolarHBondContact O-N 2.99Å; D13-L16 PolarHBondContact O-N 3.28Å; L16-H19 WeakPolarHBondContact O-CB 3.16Å; L16-H19 PolarHBondContact O-N 3.14Å; L16-Q20 WeakPolarHBondContact O-CG 3.44Å; L16-Q20 PolarHBondContact O-N 2.92Å
17	T	77	Confident	76	Confident	62 Å²	62	95.5 Å²	95.5	38%	0.38	50%	0.496	S	S	.	.	H	α-helix	trans	-62.5	-44.5	174.1	48.4	0	0	0	0	111.7	D13 T14 H19 Q20 E21	D13-T17 WeakPolarHBondContact O-CG2 3.45Å; D13-T17 PolarHBondContact O-N 2.9Å; D13-T17 PolarHBondContact O-OG1 2.74Å; T14-T17 WeakPolarHBondContact CA-OG1 3.4Å; T14-T17 PolarHBondContact O-OG1 3.03Å; T14-T17 VanDerWaalsContact O-OG1 3.07Å; T17-H19 VanDerWaalsContact C-N 3.28Å; T17-H19 PolarHBondContact O-N 3.42Å; T17-Q20 PolarHBondContact O-N 3.37Å; T17-E21 WeakPolarHBondContact O-CG 2.69Å; T17-E21 PolarHBondContact O-N 2.84Å
18	K	73	Confident	75.6	Confident	75 Å²	75	91.8 Å²	91.8	33%	0.326	49%	0.486	S	S	.	.	H	α-helix	trans	-71.2	-18.6	176.2	-62.2	-64.7	164.6	-152.2	0	114.6	T14 E21 I23 Y24	T14-K18 WeakPolarHBondContact O-CB 3.42Å; T14-K18 WeakPolarHBondContact O-CG 3.41Å; T14-K18 PolarHBondContact O-N 3.3Å; T14-K18 VanDerWaalsContact O-N 3.11Å; K18-E21 VanDerWaalsContact CD-OE2 3.28Å; K18-E21 WeakPolarHBondContact CD-OE2 3.14Å; K18-E21 IonicContact NZ-OE1 3.95Å; K18-E21 PolarHBondContact NZ-OE1 1.91Å; K18-E21 IonicContact NZ-OE2 2.68Å; K18-E21 PolarHBondContact NZ-OE2 2.87Å; K18-I23 HydrophobicContact CD-CD1 4.19Å; K18-I23 PolarHBondContact O-N 3.26Å; K18-Y24 HydrophobicContact CB-CD2 3.92Å; K18-Y24 HydrophobicContact CB-CE2 4Å
19	H	73.6	Confident	75.3	Confident	58 Å²	58	86.5 Å²	86.5	27%	0.269	46%	0.464	S	S	.	.	H	α-helix	trans	-75.3	-44	166.9	177	-94.7	0	0	0	111.6	I15 L16 T17 E21 G22 Y24 T26 L29	I15-H19 WeakPolarHBondContact O-CB 3.28Å; I15-H19 PolarHBondContact O-N 3.06Å; L16-H19 WeakPolarHBondContact O-CB 3.16Å; L16-H19 PolarHBondContact O-N 3.14Å; T17-H19 VanDerWaalsContact C-N 3.28Å; T17-H19 PolarHBondContact O-N 3.42Å; H19-E21 VanDerWaalsContact C-N 3.31Å; H19-E21 PolarHBondContact O-N 2.91Å; H19-G22 PolarHBondContact O-N 3.28Å; H19-Y24 PolarHBondContact CD2-O 3.49Å; H19-T26 WeakPolarHBondContact NE2-CA 3.43Å; H19-T26 WeakPolarHBondContact NE2-CB 3.34Å; H19-T26 WeakPolarHBondContact NE2-CG2 3.37Å; H19-T26 PolarHBondContact NE2-N 2.98Å; H19-T26 PolarHBondContact NE2-OG1 2.88Å; H19-L29 HydrophobicContact CB-CD2 4.39Å
20	Q	68.8	Low	75.1	Confident	144 Å²	144	84.8 Å²	84.8	67%	0.673	46%	0.46	S	S	*	.	H	α-helix	trans	-65.3	-31.1	175.3	-67.1	-61.8	-66.7	0	0	113.1	L16 T17 G22	L16-Q20 WeakPolarHBondContact O-CG 3.44Å; L16-Q20 PolarHBondContact O-N 2.92Å; T17-Q20 PolarHBondContact O-N 3.37Å; Q20-G22 PolarHBondContact O-N 3.06Å
21	E	73.3	Confident	75.1	Confident	106 Å²	106	85.4 Å²	85.4	50%	0.495	46%	0.46	S	S	.	.	T	Hydrogen-bonded Turn	trans	-68	-3.2	169.4	-72.7	175.4	-154.4	0	0	113.8	T17 K18 H19 I23	T17-E21 WeakPolarHBondContact O-CG 2.69Å; T17-E21 PolarHBondContact O-N 2.84Å; K18-E21 VanDerWaalsContact CD-OE2 3.28Å; K18-E21 WeakPolarHBondContact CD-OE2 3.14Å; K18-E21 IonicContact NZ-OE1 3.95Å; K18-E21 PolarHBondContact NZ-OE1 1.91Å; K18-E21 IonicContact NZ-OE2 2.68Å; K18-E21 PolarHBondContact NZ-OE2 2.87Å; H19-E21 VanDerWaalsContact C-N 3.31Å; H19-E21 PolarHBondContact O-N 2.91Å; E21-I23 HydrophobicContact CB-CD1 4.08Å; E21-I23 HydrophobicContact CB-CG1 4.09Å; E21-I23 PolarHBondContact O-N 3.45Å; E21-I23 VanDerWaalsContact O-N 3.17Å; E21-I23 VanDerWaalsContact OE2-CD1 3.28Å; E21-I23 WeakPolarHBondContact OE2-CD1 2.88Å
22	G	67.3	Low	75.1	Confident	60 Å²	60	86.5 Å²	86.5	62%	0.619	47%	0.466	S	S	*	.	T	Hydrogen-bonded Turn	trans	74.4	-1.9	177.7	0	0	0	0	0	115.4	H19 Q20 Y24	H19-G22 PolarHBondContact O-N 3.28Å; Q20-G22 PolarHBondContact O-N 3.06Å; G22-Y24 VanDerWaalsContact C-N 3.27Å; G22-Y24 PolarHBondContact O-N 2.93Å
23	I	65.3	Low	75.1	Confident	104 Å²	104	82.8 Å²	82.8	53%	0.533	46%	0.457	S	S	.	.	S	Bend	trans	-64.3	-33.2	-177.7	-60.1	175.1	0	0	0	111.3	K18 E21	K18-I23 HydrophobicContact CD-CD1 4.19Å; K18-I23 PolarHBondContact O-N 3.26Å; E21-I23 HydrophobicContact CB-CD1 4.08Å; E21-I23 HydrophobicContact CB-CG1 4.09Å; E21-I23 PolarHBondContact O-N 3.45Å; E21-I23 VanDerWaalsContact O-N 3.17Å; E21-I23 VanDerWaalsContact OE2-CD1 3.28Å; E21-I23 WeakPolarHBondContact OE2-CD1 2.88Å
24	Y	63.4	Low	75.2	Confident	122 Å²	122	79.4 Å²	79.4	48%	0.478	45%	0.446	S	S	.	.	S	Bend	trans	-117.4	115.7	176.1	-62.3	-80	0	0	0	110.9	K18 H19 G22 T26	K18-Y24 HydrophobicContact CB-CD2 3.92Å; K18-Y24 HydrophobicContact CB-CE2 4Å; H19-Y24 PolarHBondContact CD2-O 3.49Å; G22-Y24 VanDerWaalsContact C-N 3.27Å; G22-Y24 PolarHBondContact O-N 2.93Å; Y24-T26 PolarHBondContact O-N 3.46Å
25	N	69.7	Low	75.3	Confident	103 Å²	103	80.8 Å²	80.8	55%	0.551	45%	0.45	S	S	*	.			trans	-57	138.4	165	-178.4	-8	0	0	0	109.4	I27 C28 L29	N25-I27 PolarHBondContact O-N 3.31Å; N25-I27 PolarHBondContact OD1-N 3.34Å; N25-C28 WeakPolarHBondContact O-CB 3.26Å; N25-C28 PolarHBondContact O-N 3.24Å; N25-L29 PolarHBondContact O-N 2.99Å
26	T	69.9	Low	75.7	Confident	82 Å²	82	82.6 Å²	82.6	50%	0.503	46%	0.463	S	S	.	.	H	α-helix	trans	-47.9	-33.8	179.6	-34.4	0	0	0	0	113	H19 Y24 G30	H19-T26 WeakPolarHBondContact NE2-CA 3.43Å; H19-T26 WeakPolarHBondContact NE2-CB 3.34Å; H19-T26 WeakPolarHBondContact NE2-CG2 3.37Å; H19-T26 PolarHBondContact NE2-N 2.98Å; H19-T26 PolarHBondContact NE2-OG1 2.88Å; Y24-T26 PolarHBondContact O-N 3.46Å; T26-G30 PolarHBondContact O-N 3.33Å
27	I	76.3	Confident	76.2	Confident	121 Å²	121	83.7 Å²	83.7	62%	0.621	47%	0.469	S	S	*	.	H	α-helix	trans	-62.7	-44.9	176.1	-56.9	175.9	0	0	0	111.6	N25 L29 G30 V31	N25-I27 PolarHBondContact O-N 3.31Å; N25-I27 PolarHBondContact OD1-N 3.34Å; I27-L29 PolarHBondContact O-N 2.9Å; I27-G30 PolarHBondContact O-N 3.05Å; I27-V31 WeakPolarHBondContact O-CG2 3.43Å; I27-V31 PolarHBondContact O-N 3.38Å
28	C	75.4	Confident	76.7	Confident	63 Å²	63	85.8 Å²	85.8	43%	0.426	48%	0.477	S	S	.	.	H	α-helix	trans	-63.1	-43.7	-179.7	-174.4	0	0	0	0	111	N25 V31 L32	N25-C28 WeakPolarHBondContact O-CB 3.26Å; N25-C28 PolarHBondContact O-N 3.24Å; C28-V31 PolarHBondContact O-N 3.4Å; C28-L32 PolarHBondContact O-N 2.98Å
29	L	76.1	Confident	77.6	Confident	30 Å²	30	85.6 Å²	85.6	16%	0.157	48%	0.482	C	S	.	.	H	α-helix	trans	-65	-43	175.1	177.1	57.9	0	0	0	112.4	I15 H19 N25 I27 V31 L32 L33	I15-L29 HydrophobicContact CB-CD1 4.34Å; I15-L29 HydrophobicContact CD1-CD1 4.06Å; I15-L29 HydrophobicContact CG1-CD1 4.11Å; I15-L29 HydrophobicContact CG2-CD1 3.39Å; I15-L29 HydrophobicContact CG2-CD2 3.51Å; I15-L29 HydrophobicContact CG2-CG 4.06Å; H19-L29 HydrophobicContact CB-CD2 4.39Å; N25-L29 PolarHBondContact O-N 2.99Å; I27-L29 PolarHBondContact O-N 2.9Å; L29-V31 VanDerWaalsContact C-N 3.27Å; L29-V31 PolarHBondContact O-N 3.43Å; L29-L32 PolarHBondContact O-N 3.36Å; L29-L32 VanDerWaalsContact O-N 3.14Å; L29-L33 HydrophobicContact CD1-CD1 3.65Å; L29-L33 HydrophobicContact CD1-CG 4.07Å; L29-L33 HydrophobicContact CG-CD1 3.99Å; L29-L33 PolarHBondContact O-N 3.18Å
30	G	79.3	Confident	78.4	Confident	44 Å²	44	87.4 Å²	87.4	45%	0.454	49%	0.493	S	S	.	.	H	α-helix	trans	-59.2	-36.6	174.9	0	0	0	0	0	112.7	T26 I27 G34	T26-G30 PolarHBondContact O-N 3.33Å; I27-G30 PolarHBondContact O-N 3.05Å; G30-G34 VanDerWaalsContact O-CA 3.28Å; G30-G34 WeakPolarHBondContact O-CA 3.44Å; G30-G34 PolarHBondContact O-N 2.84Å
31	V	83.8	Confident	79.4	Confident	87 Å²	87	85.2 Å²	85.2	53%	0.527	49%	0.485	S	S	.	.	H	α-helix	trans	-68.9	-45.7	171.5	171.1	0	0	0	0	111.3	I27 C28 L29 L33 G34 L35	I27-V31 WeakPolarHBondContact O-CG2 3.43Å; I27-V31 PolarHBondContact O-N 3.38Å; C28-V31 PolarHBondContact O-N 3.4Å; L29-V31 VanDerWaalsContact C-N 3.27Å; L29-V31 PolarHBondContact O-N 3.43Å; V31-L33 VanDerWaalsContact C-N 3.28Å; V31-L33 PolarHBondContact O-N 3.5Å; V31-G34 PolarHBondContact O-N 3.4Å; V31-L35 WeakPolarHBondContact O-CB 2.98Å; V31-L35 PolarHBondContact O-N 3.47Å
32	L	82.9	Confident	80.1	Confident	118 Å²	118	83.3 Å²	83.3	62%	0.618	48%	0.481	S	S	*	.	H	α-helix	trans	-59.3	-37.4	-177.1	-148.1	83.6	0	0	0	113	C28 L29 P36	C28-L32 PolarHBondContact O-N 2.98Å; L29-L32 PolarHBondContact O-N 3.36Å; L29-L32 VanDerWaalsContact O-N 3.14Å; L32-P36 WeakPolarHBondContact O-CD 3.3Å; L32-P36 WeakPolarHBondContact O-CG 3.39Å
33	L	80.9	Confident	81	Confident	65 Å²	65	85.5 Å²	85.5	34%	0.34	48%	0.477	S	S	.	.	H	α-helix	trans	-89.8	-39.8	178.2	-67.1	165.7	0	0	0	112.7	W12 L29 V31 P36	W12-L33 HydrophobicContact CE3-CD1 4.36Å; W12-L33 HydrophobicContact CH2-CD1 4Å; W12-L33 HydrophobicContact CZ3-CD1 3.51Å; W12-L33 HydrophobicContact CZ3-CD2 4.23Å; L29-L33 HydrophobicContact CD1-CD1 3.65Å; L29-L33 HydrophobicContact CD1-CG 4.07Å; L29-L33 HydrophobicContact CG-CD1 3.99Å; L29-L33 PolarHBondContact O-N 3.18Å; V31-L33 VanDerWaalsContact C-N 3.28Å; V31-L33 PolarHBondContact O-N 3.5Å; L33-P36 WeakPolarHBondContact O-CD 3.44Å; L33-P36 WeakPolarHBondContact O-CG 3.21Å
34	G	85.8	Confident	82.1	Confident	30 Å²	30	85.5 Å²	85.5	31%	0.309	48%	0.478	S	S	.	.	H	α-helix	trans	-73.3	-34.9	-175.6	0	0	0	0	0	113.6	G30 V31 L37 L38	G30-G34 VanDerWaalsContact O-CA 3.28Å; G30-G34 WeakPolarHBondContact O-CA 3.44Å; G30-G34 PolarHBondContact O-N 2.84Å; V31-G34 PolarHBondContact O-N 3.4Å; G34-L37 PolarHBondContact O-N 2.82Å; G34-L38 WeakPolarHBondContact O-CB 3.23Å; G34-L38 PolarHBondContact O-N 3.49Å
35	L	82.6	Confident	83.1	Confident	109 Å²	109	86.3 Å²	86.3	57%	0.571	48%	0.484	S	S	*	.	H	α-helix	trans	-62	-52.4	179.7	-172.3	69.2	0	0	0	113.2	V31 L37 L38 V39	V31-L35 WeakPolarHBondContact O-CB 2.98Å; V31-L35 PolarHBondContact O-N 3.47Å; L35-L37 VanDerWaalsContact C-N 3.32Å; L35-L37 PolarHBondContact O-N 3.35Å; L35-L38 PolarHBondContact O-N 3.35Å; L35-V39 WeakPolarHBondContact O-CG2 3.3Å; L35-V39 PolarHBondContact O-N 3.1Å
36	P	87.9	Confident	83.7	Confident	69 Å²	69	87.1 Å²	87.1	45%	0.448	49%	0.486	S	S	.	.	H	α-helix	trans	-64.8	-35	176.2	25	-33.9	0	0	0	112.4	L32 L33 V39 I40	L32-P36 WeakPolarHBondContact O-CD 3.3Å; L32-P36 WeakPolarHBondContact O-CG 3.39Å; L33-P36 WeakPolarHBondContact O-CD 3.44Å; L33-P36 WeakPolarHBondContact O-CG 3.21Å; P36-V39 PolarHBondContact O-N 2.9Å; P36-I40 VanDerWaalsContact O-CG1 3.3Å; P36-I40 WeakPolarHBondContact O-CG1 3.41Å; P36-I40 PolarHBondContact O-N 2.89Å
37	L	87.6	Confident	84.2	Confident	106 Å²	106	86.9 Å²	86.9	56%	0.555	49%	0.487	S	S	*	.	H	α-helix	trans	-62.9	-45.2	175.4	-166.9	76.4	0	0	0	111.4	G34 L35 I40 I41	G34-L37 PolarHBondContact O-N 2.82Å; L35-L37 VanDerWaalsContact C-N 3.32Å; L35-L37 PolarHBondContact O-N 3.35Å; L37-I40 PolarHBondContact O-N 3.4Å; L37-I41 HydrophobicContact CD2-CD1 4.34Å; L37-I41 HydrophobicContact CG-CD1 3.99Å; L37-I41 VanDerWaalsContact O-CG1 3.29Å; L37-I41 WeakPolarHBondContact O-CG1 3.31Å; L37-I41 PolarHBondContact O-N 2.91Å
38	L	88.7	Confident	84.3	Confident	105 Å²	105	83.8 Å²	83.8	55%	0.55	48%	0.475	S	S	.	.	H	α-helix	trans	-64.7	-38.7	177.6	-173.2	152.3	0	0	0	111.7	G34 L35 I41 T42	G34-L38 WeakPolarHBondContact O-CB 3.23Å; G34-L38 PolarHBondContact O-N 3.49Å; L35-L38 PolarHBondContact O-N 3.35Å; L38-I41 PolarHBondContact O-N 2.96Å; L38-T42 VanDerWaalsContact O-CB 3.31Å; L38-T42 WeakPolarHBondContact O-CB 3.32Å; L38-T42 PolarHBondContact O-N 2.88Å; L38-T42 PolarHBondContact O-OG1 2.89Å
39	V	91.8	Very high	84.3	Confident	71 Å²	71	85.4 Å²	85.4	43%	0.43	48%	0.477	S	S	.	.	H	α-helix	trans	-60.9	-47.2	171.6	170.2	0	0	0	0	111	L35 P36 I41 T42 L43	L35-V39 WeakPolarHBondContact O-CG2 3.3Å; L35-V39 PolarHBondContact O-N 3.1Å; P36-V39 PolarHBondContact O-N 2.9Å; V39-I41 PolarHBondContact O-N 2.69Å; V39-T42 PolarHBondContact O-N 3.44Å; V39-L43 HydrophobicContact CG1-CD1 3.92Å; V39-L43 HydrophobicContact CG1-CG 4.44Å; V39-L43 WeakPolarHBondContact O-CB 3.33Å; V39-L43 VanDerWaalsContact O-CG 3.32Å; V39-L43 WeakPolarHBondContact O-CG 3.48Å; V39-L43 PolarHBondContact O-N 2.89Å
40	I	90.5	Very high	83.7	Confident	97 Å²	97	88.3 Å²	88.3	50%	0.497	50%	0.498	S	S	.	.	H	α-helix	trans	-61.4	-46	177.6	-68	162.8	0	0	0	111	P36 L37 T42 L43 L44	P36-I40 VanDerWaalsContact O-CG1 3.3Å; P36-I40 WeakPolarHBondContact O-CG1 3.41Å; P36-I40 PolarHBondContact O-N 2.89Å; L37-I40 PolarHBondContact O-N 3.4Å; I40-T42 VanDerWaalsContact C-N 3.33Å; I40-T42 PolarHBondContact O-N 3.27Å; I40-L43 PolarHBondContact O-N 3.24Å; I40-L44 HydrophobicContact CG2-CD1 4.01Å; I40-L44 HydrophobicContact CG2-CG 4.44Å; I40-L44 WeakPolarHBondContact O-CB 3.34Å; I40-L44 WeakPolarHBondContact O-CG 3.4Å; I40-L44 PolarHBondContact O-N 3.33Å
41	I	89	Confident	83.1	Confident	98 Å²	98	91.6 Å²	91.6	50%	0.503	51%	0.513	S	S	.	.	H	α-helix	trans	-61.2	-41.7	177.2	-69	164.6	0	0	0	111	L37 L38 V39 L44 F45	L37-I41 HydrophobicContact CD2-CD1 4.34Å; L37-I41 HydrophobicContact CG-CD1 3.99Å; L37-I41 VanDerWaalsContact O-CG1 3.29Å; L37-I41 WeakPolarHBondContact O-CG1 3.31Å; L37-I41 PolarHBondContact O-N 2.91Å; L38-I41 PolarHBondContact O-N 2.96Å; V39-I41 PolarHBondContact O-N 2.69Å; I41-L44 PolarHBondContact O-N 3.32Å; I41-F45 WeakPolarHBondContact O-CB 3.35Å; I41-F45 PolarHBondContact O-N 2.87Å
42	T	88.1	Confident	81.9	Confident	66 Å²	66	97.6 Å²	97.6	41%	0.405	53%	0.527	S	S	.	.	H	α-helix	trans	-66.5	-41.5	178.7	-55.4	0	0	0	0	111.5	L38 V39 I40 F45 M46	L38-T42 VanDerWaalsContact O-CB 3.31Å; L38-T42 WeakPolarHBondContact O-CB 3.32Å; L38-T42 PolarHBondContact O-N 2.88Å; L38-T42 PolarHBondContact O-OG1 2.89Å; V39-T42 PolarHBondContact O-N 3.44Å; I40-T42 VanDerWaalsContact C-N 3.33Å; I40-T42 PolarHBondContact O-N 3.27Å; T42-F45 PolarHBondContact O-N 3.46Å; T42-M46 WeakPolarHBondContact O-CB 3.49Å; T42-M46 WeakPolarHBondContact O-CG 3.4Å; T42-M46 PolarHBondContact O-N 3.49Å
43	L	86.5	Confident	80.6	Confident	105 Å²	105	94.2 Å²	94.2	55%	0.55	51%	0.512	S	S	.	.	H	α-helix	trans	-64.3	-44.2	174.7	-72	169.9	0	0	0	111.6	V39 I40 M46 C47	V39-L43 HydrophobicContact CG1-CD1 3.92Å; V39-L43 HydrophobicContact CG1-CG 4.44Å; V39-L43 WeakPolarHBondContact O-CB 3.33Å; V39-L43 VanDerWaalsContact O-CG 3.32Å; V39-L43 WeakPolarHBondContact O-CG 3.48Å; V39-L43 PolarHBondContact O-N 2.89Å; I40-L43 PolarHBondContact O-N 3.24Å; L43-M46 PolarHBondContact O-N 2.87Å; L43-C47 VanDerWaalsContact O-CB 3.29Å; L43-C47 WeakPolarHBondContact O-CB 3.29Å; L43-C47 PolarHBondContact O-N 2.87Å; L43-C47 PolarHBondContact O-SG 2.85Å
44	L	87.4	Confident	79.6	Confident	104 Å²	104	96.3 Å²	96.3	55%	0.545	53%	0.53	S	S	.	.	H	α-helix	trans	-61	-44.7	174.6	-72.3	172	0	0	0	111.4	I40 I41 C47 C48	I40-L44 HydrophobicContact CG2-CD1 4.01Å; I40-L44 HydrophobicContact CG2-CG 4.44Å; I40-L44 WeakPolarHBondContact O-CB 3.34Å; I40-L44 WeakPolarHBondContact O-CG 3.4Å; I40-L44 PolarHBondContact O-N 3.33Å; I41-L44 PolarHBondContact O-N 3.32Å; L44-C47 PolarHBondContact O-N 3.31Å; L44-C48 VanDerWaalsContact O-CB 3.23Å; L44-C48 WeakPolarHBondContact O-CB 3.29Å; L44-C48 PolarHBondContact O-N 3.27Å; L44-C48 PolarHBondContact O-SG 3.47Å
45	F	85.8	Confident	77.9	Confident	140 Å²	140	101.9 Å²	101.9	61%	0.614	56%	0.561	S	S	*	*	H	α-helix	trans	-63.9	-45	178.1	-170.9	-95.4	0	0	0	112.1	I41 T42 H49	I41-F45 WeakPolarHBondContact O-CB 3.35Å; I41-F45 PolarHBondContact O-N 2.87Å; T42-F45 PolarHBondContact O-N 3.46Å; F45-H49 VanDerWaalsContact O-CB 3.23Å; F45-H49 WeakPolarHBondContact O-CB 3.23Å; F45-H49 PolarHBondContact O-N 3.38Å
46	M	82.3	Confident	76.5	Confident	119 Å²	119	99.5 Å²	99.5	59%	0.586	56%	0.562	S	S	*	*	H	α-helix	trans	-61.2	-49.2	175.3	-76.8	-67.7	-163.4	0	0	111.8	T42 L43 H49 C50	T42-M46 WeakPolarHBondContact O-CB 3.49Å; T42-M46 WeakPolarHBondContact O-CG 3.4Å; T42-M46 PolarHBondContact O-N 3.49Å; L43-M46 PolarHBondContact O-N 2.87Å; M46-H49 PolarHBondContact O-N 3.43Å; M46-C50 WeakPolarHBondContact O-CB 3.45Å; M46-C50 PolarHBondContact O-N 2.85Å; M46-C50 PolarHBondContact O-SG 2.86Å
47	C	79.1	Confident	74.7	Confident	78 Å²	78	106.4 Å²	106.4	53%	0.527	59%	0.585	S	S	.	*	H	α-helix	trans	-61.2	-47.4	177.8	-74	0	0	0	0	111.8	L43 L44 C50 C51	L43-C47 VanDerWaalsContact O-CB 3.29Å; L43-C47 WeakPolarHBondContact O-CB 3.29Å; L43-C47 PolarHBondContact O-N 2.87Å; L43-C47 PolarHBondContact O-SG 2.85Å; L44-C47 PolarHBondContact O-N 3.31Å; C47-C50 PolarHBondContact O-N 2.69Å; C47-C51 WeakPolarHBondContact O-CB 3.4Å; C47-C51 PolarHBondContact O-N 3.31Å; C47-C51 PolarHBondContact O-SG 3.5Å
48	C	78.1	Confident	72.8	Confident	55 Å²	55	112.3 Å²	112.3	37%	0.372	60%	0.6	S	S	.	*	H	α-helix	trans	-64	-41.2	177.7	-71.7	0	0	0	0	112.1	L44 C50 C51 W52	L44-C48 VanDerWaalsContact O-CB 3.23Å; L44-C48 WeakPolarHBondContact O-CB 3.29Å; L44-C48 PolarHBondContact O-N 3.27Å; L44-C48 PolarHBondContact O-SG 3.47Å; C48-C50 PolarHBondContact O-N 2.82Å; C48-C51 PolarHBondContact O-N 3.27Å; C48-W52 HydrophobicContact CB-CE3 4.02Å; C48-W52 HydrophobicContact CB-CZ3 4.03Å; C48-W52 WeakPolarHBondContact O-CB 3.23Å; C48-W52 PolarHBondContact O-N 3.06Å
49	H	75.9	Confident	70.8	Confident	98 Å²	98	110.9 Å²	110.9	45%	0.454	61%	0.611	S	S	.	*	H	α-helix	trans	-65.8	-36.9	175.2	-171.2	-57	0	0	0	111.9	F45 M46 S53	F45-H49 VanDerWaalsContact O-CB 3.23Å; F45-H49 WeakPolarHBondContact O-CB 3.23Å; F45-H49 PolarHBondContact O-N 3.38Å; M46-H49 PolarHBondContact O-N 3.43Å; H49-S53 WeakPolarHBondContact O-CB 3.39Å; H49-S53 PolarHBondContact O-N 3.4Å; H49-S53 PolarHBondContact O-OG 3.3Å
50	C	63.3	Low	68.4	Low	90 Å²	90	116.4 Å²	116.4	61%	0.608	63%	0.632	S	S	*	*	H	α-helix	trans	-67.7	-38.7	173.4	-75	0	0	0	0	112.3	M46 C47 C48	M46-C50 WeakPolarHBondContact O-CB 3.45Å; M46-C50 PolarHBondContact O-N 2.85Å; M46-C50 PolarHBondContact O-SG 2.86Å; C47-C50 PolarHBondContact O-N 2.69Å; C48-C50 PolarHBondContact O-N 2.82Å
51	C	67.7	Low	66.2	Low	114 Å²	114	120.5 Å²	120.5	77%	0.77	65%	0.649	S	S	*	*	H	α-helix	trans	-76.2	-32.1	178.4	-70.1	0	0	0	0	113.7	C47 C48	C47-C51 WeakPolarHBondContact O-CB 3.4Å; C47-C51 PolarHBondContact O-N 3.31Å; C47-C51 PolarHBondContact O-SG 3.5Å; C48-C51 PolarHBondContact O-N 3.27Å
52	W	58.2	Low	64.4	Low	213 Å²	213	120.7 Å²	120.7	81%	0.807	66%	0.657	S	S	*	*	H	α-helix	trans	-82	-14.4	173.2	-93.5	-51.3	0	0	0	113.8	C48 P54	C48-W52 HydrophobicContact CB-CE3 4.02Å; C48-W52 HydrophobicContact CB-CZ3 4.03Å; C48-W52 WeakPolarHBondContact O-CB 3.23Å; C48-W52 PolarHBondContact O-N 3.06Å; W52-P54 VanDerWaalsContact O-CD 3.23Å; W52-P54 WeakPolarHBondContact O-CD 3.23Å
53	S	56.5	Low	62.6	Low	46 Å²	46	124.2 Å²	124.2	32%	0.322	67%	0.669	S	S	.	*	S	Bend	trans	-63.9	116.8	169.9	-67.8	0	0	0	0	109.3	H49	H49-S53 WeakPolarHBondContact O-CB 3.39Å; H49-S53 PolarHBondContact O-N 3.4Å; H49-S53 PolarHBondContact O-OG 3.3Å
54	P	59.1	Low	60.6	Low	109 Å²	109	127.2 Å²	127.2	71%	0.708	68%	0.677	S	S	*	*			trans	-58.5	140.3	175.2	-21.7	33.8	0	0	0	109.5	W52 G56	W52-P54 VanDerWaalsContact O-CD 3.23Å; W52-P54 WeakPolarHBondContact O-CD 3.23Å; P54-G56 VanDerWaalsContact C-N 3.31Å; P54-G56 PolarHBondContact O-N 2.65Å
55	P	50.9	Low	58.5	Low	147 Å²	147	129.9 Å²	129.9	96%	0.955	69%	0.692	S	S	*	*	S	Bend	trans	-68.5	85.2	-173.3	25.8	-34.6	0	0	0	112
56	G	51.7	Low	56.5	Low	59 Å²	59	131.6 Å²	131.6	61%	0.608	70%	0.699	S	S	*	*			trans	-172.5	128.6	-179.2	0	0	0	0	0	112.7	P54	P54-G56 VanDerWaalsContact C-N 3.31Å; P54-G56 PolarHBondContact O-N 2.65Å
57	K	51.2	Low	54.8	Low	214 Å²	214	132.8 Å²	132.8	93%	0.93	70%	0.701	S	S	*	*	S	Bend	trans	79.1	42.5	171.4	-47	-179.3	-178	-179.8	0	118.2
58	R	47.2	Very low	53.3	Low	230 Å²	230	138.3 Å²	138.3	87%	0.868	72%	0.716	S	S	*	*	S	Bend	trans	-138.4	124.1	146.6	-61.6	-170.4	-162.3	-128.9	3.9	109.2
59	G	46.8	Very low	51.9	Low	75 Å²	75	144 Å²	144	77%	0.773	74%	0.735	S	S	*	*	S	Bend	trans	82.3	145.7	-178.3	0	0	0	0	0	116
60	Q	41	Very low	50.5	Low	188 Å²	188	147.4 Å²	147.4	88%	0.879	75%	0.748	S	S	*	*			trans	-77.6	163.9	163.7	-55.3	102.1	-32.7	0	0	110.3
61	Q	45.6	Very low	49.9	Very low	183 Å²	183	150.4 Å²	150.4	86%	0.855	75%	0.751	S	S	*	*			cis	-136	174.6	7	-124.9	-161.8	-129.3	0	0	109.8
62	P	50.8	Low	49.2	Very low	102 Å²	102	152 Å²	152	66%	0.662	75%	0.745	S	S	*	*			trans	-92.7	-171.3	-176.1	39.9	-36.6	0	0	0	113.9
63	E	48.9	Very low	49	Very low	139 Å²	139	147.8 Å²	147.8	65%	0.65	73%	0.732	S	S	*	*			trans	77.9	121.4	177.7	-157	163.8	161.4	0	0	113.5	K67	E63-K67 IonicContact OE1-NZ 2.74Å; E63-K67 PolarHBondContact OE1-NZ 2.72Å; E63-K67 IonicContact OE2-NZ 2.65Å
64	K	45.4	Very low	48.9	Very low	169 Å²	169	150.7 Å²	150.7	74%	0.735	74%	0.739	S	S	*	*	S	Bend	cis	-126.1	-19.5	46.9	-69.9	162.8	-178.6	173.4	0	116.8	K66	K64-K66 VanDerWaalsContact C-N 3.35Å; K64-K66 PolarHBondContact O-N 3.12Å; K64-K66 VanDerWaalsContact O-N 3.12Å
65	N	43	Very low	48.7	Very low	160 Å²	160	149.9 Å²	149.9	86%	0.856	73%	0.729	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.4	0.1	-163	-78.2	-19.3	0	0	0	117.9
66	K	44.4	Very low	49	Very low	176 Å²	176	148.6 Å²	148.6	77%	0.765	71%	0.71	S	S	*	*	H	α-helix	trans	-80.6	-20.8	175	-72.8	-173.8	176.4	178.2	0	114.2	K64 K68 K69 K70	K64-K66 VanDerWaalsContact C-N 3.35Å; K64-K66 PolarHBondContact O-N 3.12Å; K64-K66 VanDerWaalsContact O-N 3.12Å; K66-K68 PolarHBondContact O-N 3.24Å; K66-K69 PolarHBondContact O-N 3.39Å; K66-K70 PolarHBondContact O-N 3.35Å
67	K	46.4	Very low	49.1	Very low	144 Å²	144	150.5 Å²	150.5	63%	0.626	70%	0.703	S	S	*	*	H	α-helix	trans	-61.6	-40.8	-175.2	-77.3	173.4	172.8	168.6	0	113	E63 K71	E63-K67 IonicContact OE1-NZ 2.74Å; E63-K67 PolarHBondContact OE1-NZ 2.72Å; E63-K67 IonicContact OE2-NZ 2.65Å; K67-K71 PolarHBondContact O-N 3.04Å
68	K	47.2	Very low	49.2	Very low	193 Å²	193	143.7 Å²	143.7	84%	0.839	68%	0.677	S	S	*	*	H	α-helix	trans	-65.3	-47.3	176.3	-74.9	-171	175.7	-176.6	0	113.4	K66 K72	K66-K68 PolarHBondContact O-N 3.24Å; K68-K72 PolarHBondContact O-N 3.07Å
69	K	47.6	Very low	49.6	Very low	175 Å²	175	138.6 Å²	138.6	76%	0.761	67%	0.666	S	S	*	*	H	α-helix	trans	-74.7	-31.8	-175.7	-161.9	168.7	-174.7	174.6	0	113.3	K66 K73	K66-K69 PolarHBondContact O-N 3.39Å; K69-K73 PolarHBondContact O-N 3.15Å
70	K	47.8	Very low	50	Low	170 Å²	170	144.1 Å²	144.1	74%	0.739	66%	0.664	S	S	*	*	H	α-helix	trans	-73.2	-34.6	174.6	-157.3	-179.4	-176.9	-171.3	0	112.4	K66 K73 K74	K66-K70 PolarHBondContact O-N 3.35Å; K70-K73 PolarHBondContact O-N 3.41Å; K70-K74 PolarHBondContact O-N 3.45Å
71	K	51.1	Low	50.6	Low	152 Å²	152	140.6 Å²	140.6	66%	0.661	65%	0.65	S	S	*	*	H	α-helix	trans	-64	-45.3	175.4	-163.9	-179	-178.8	-171.1	0	112	K67 K73 K74 D75	K67-K71 PolarHBondContact O-N 3.04Å; K71-K73 VanDerWaalsContact C-N 3.33Å; K71-K73 PolarHBondContact O-N 3.48Å; K71-K74 PolarHBondContact O-N 2.74Å; K71-K74 VanDerWaalsContact O-N 3.15Å; K71-D75 PolarHBondContact O-N 2.75Å
72	K	52.3	Low	51	Low	149 Å²	149	137 Å²	137	65%	0.648	65%	0.645	S	S	*	*	H	α-helix	trans	-60.5	-40.2	178.7	-170.8	176.6	178.8	-174.9	0	112.7	K68 D75 E76	K68-K72 PolarHBondContact O-N 3.07Å; K72-D75 WeakPolarHBondContact O-CB 3.36Å; K72-E76 WeakPolarHBondContact O-CB 3.41Å; K72-E76 PolarHBondContact O-N 3.33Å
73	K	53.2	Low	51.2	Low	123 Å²	123	135.5 Å²	135.5	54%	0.535	64%	0.641	S	S	.	*	H	α-helix	trans	-63.5	-46.3	173	-92.7	-170.6	160.6	-70.3	0	112.2	K69 K70 K71 D75 E76 E77	K69-K73 PolarHBondContact O-N 3.15Å; K70-K73 PolarHBondContact O-N 3.41Å; K71-K73 VanDerWaalsContact C-N 3.33Å; K71-K73 PolarHBondContact O-N 3.48Å; K73-D75 VanDerWaalsContact C-N 3.27Å; K73-D75 PolarHBondContact O-N 3.1Å; K73-E76 WeakPolarHBondContact O-CB 3.4Å; K73-E76 PolarHBondContact O-N 3.37Å; K73-E76 VanDerWaalsContact O-N 3.09Å; K73-E77 VanDerWaalsContact C-OE1 3.29Å; K73-E77 WeakPolarHBondContact O-CG 3.48Å; K73-E77 PolarHBondContact O-N 3.46Å; K73-E77 VanDerWaalsContact O-OE1 3.08Å
74	K	54.8	Low	51	Low	107 Å²	107	137.2 Å²	137.2	47%	0.465	65%	0.649	S	S	.	*	H	α-helix	trans	-59.6	-37.8	179.5	-150.7	-161.7	176.1	-62	0	113	K70 K71 E77 D78	K70-K74 PolarHBondContact O-N 3.45Å; K71-K74 PolarHBondContact O-N 2.74Å; K71-K74 VanDerWaalsContact O-N 3.15Å; K74-E77 HydrophobicContact CG-CG 4.43Å; K74-E77 CarbonylContact O-C 3.51Å; K74-E77 PolarHBondContact O-N 2.91Å; K74-D78 IonicContact NZ-OD1 2.62Å; K74-D78 PolarHBondContact NZ-OD1 3.19Å; K74-D78 IonicContact NZ-OD2 2.67Å; K74-D78 PolarHBondContact NZ-OD2 2.62Å; K74-D78 WeakPolarHBondContact O-CB 3.45Å; K74-D78 VanDerWaalsContact O-CG 3.31Å; K74-D78 PolarHBondContact O-N 3.01Å
75	D	55.5	Low	51	Low	92 Å²	92	134.2 Å²	134.2	49%	0.492	65%	0.647	S	S	.	*	H	α-helix	trans	-57.3	-53.5	172.5	-125.6	70.2	0	0	0	111.1	K71 K72 K73 E77 D78 L79	K71-D75 PolarHBondContact O-N 2.75Å; K72-D75 WeakPolarHBondContact O-CB 3.36Å; K73-D75 VanDerWaalsContact C-N 3.27Å; K73-D75 PolarHBondContact O-N 3.1Å; D75-E77 VanDerWaalsContact C-N 3.29Å; D75-E77 PolarHBondContact O-N 3.08Å; D75-D78 PolarHBondContact O-N 3.09Å; D75-D78 VanDerWaalsContact O-N 3.1Å; D75-L79 WeakPolarHBondContact O-CD1 3.2Å; D75-L79 PolarHBondContact O-N 2.94Å; D75-L79 VanDerWaalsContact O-N 3.08Å
76	E	57	Low	51.4	Low	120 Å²	120	136.8 Å²	136.8	56%	0.561	65%	0.651	S	S	*	*	H	α-helix	trans	-61.1	-34.6	-179.1	-153.4	168.5	88.6	0	0	112.2	K72 K73	K72-E76 WeakPolarHBondContact O-CB 3.41Å; K72-E76 PolarHBondContact O-N 3.33Å; K73-E76 WeakPolarHBondContact O-CB 3.4Å; K73-E76 PolarHBondContact O-N 3.37Å; K73-E76 VanDerWaalsContact O-N 3.09Å
77	E	53.6	Low	51.1	Low	99 Å²	99	135.7 Å²	135.7	46%	0.463	65%	0.652	S	S	.	*	T	Hydrogen-bonded Turn	trans	-95	6.3	176.6	78.8	-152.3	46.1	0	0	114.5	K73 K74 D75 W80	K73-E77 VanDerWaalsContact C-OE1 3.29Å; K73-E77 WeakPolarHBondContact O-CG 3.48Å; K73-E77 PolarHBondContact O-N 3.46Å; K73-E77 VanDerWaalsContact O-OE1 3.08Å; K74-E77 HydrophobicContact CG-CG 4.43Å; K74-E77 CarbonylContact O-C 3.51Å; K74-E77 PolarHBondContact O-N 2.91Å; D75-E77 VanDerWaalsContact C-N 3.29Å; D75-E77 PolarHBondContact O-N 3.08Å; E77-W80 VanDerWaalsContact O-CD1 3.31Å; E77-W80 PolarHBondContact O-NE1 3.28Å
78	D	54.3	Low	50.9	Low	72 Å²	72	136 Å²	136	39%	0.385	66%	0.66	S	S	.	*	T	Hydrogen-bonded Turn	trans	-101.6	-28.5	163.8	-78.7	-37	0	0	0	111.3	K74 D75 W80 I81	K74-D78 IonicContact NZ-OD1 2.62Å; K74-D78 PolarHBondContact NZ-OD1 3.19Å; K74-D78 IonicContact NZ-OD2 2.67Å; K74-D78 PolarHBondContact NZ-OD2 2.62Å; K74-D78 WeakPolarHBondContact O-CB 3.45Å; K74-D78 VanDerWaalsContact O-CG 3.31Å; K74-D78 PolarHBondContact O-N 3.01Å; D75-D78 PolarHBondContact O-N 3.09Å; D75-D78 VanDerWaalsContact O-N 3.1Å; D78-W80 VanDerWaalsContact C-N 3.29Å; D78-W80 PolarHBondContact O-N 3.21Å; D78-I81 PolarHBondContact O-N 3.09Å; D78-I81 VanDerWaalsContact O-N 3.09Å
79	L	54.8	Low	50.9	Low	123 Å²	123	134.9 Å²	134.9	64%	0.644	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.6	-35.7	-176.7	-109.8	76.5	0	0	0	114.5	D75 I81	D75-L79 WeakPolarHBondContact O-CD1 3.2Å; D75-L79 PolarHBondContact O-N 2.94Å; D75-L79 VanDerWaalsContact O-N 3.08Å; L79-I81 VanDerWaalsContact C-N 3.32Å; L79-I81 PolarHBondContact O-N 3.23Å
80	W	55.1	Low	50.2	Low	190 Å²	190	134.9 Å²	134.9	72%	0.72	66%	0.663	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.3	-14.7	-178.4	66.8	-70.9	0	0	0	114	E77 D78	E77-W80 VanDerWaalsContact O-CD1 3.31Å; E77-W80 PolarHBondContact O-NE1 3.28Å; D78-W80 VanDerWaalsContact C-N 3.29Å; D78-W80 PolarHBondContact O-N 3.21Å
81	I	52.7	Low	49.7	Very low	115 Å²	115	134.8 Å²	134.8	59%	0.59	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.4	-21.3	179.7	-57.5	178.3	0	0	0	111	D78 L79 A83	D78-I81 PolarHBondContact O-N 3.09Å; D78-I81 VanDerWaalsContact O-N 3.09Å; L79-I81 VanDerWaalsContact C-N 3.32Å; L79-I81 PolarHBondContact O-N 3.23Å; I81-A83 VanDerWaalsContact C-N 3.26Å; I81-A83 PolarHBondContact O-N 3.49Å
82	S	55.6	Low	49.1	Very low	106 Å²	106	136.5 Å²	136.5	74%	0.741	67%	0.672	S	S	*	*	S	Bend	trans	-79.9	7.2	-176.2	-167.7	0	0	0	0	115.2
83	A	54.1	Low	48.4	Very low	72 Å²	72	139.8 Å²	139.8	60%	0.595	68%	0.681	S	S	*	*			trans	-121.9	42.3	-158.2	0	0	0	0	0	116.6	I81	I81-A83 VanDerWaalsContact C-N 3.26Å; I81-A83 PolarHBondContact O-N 3.49Å
84	Q	45.2	Very low	48	Very low	175 Å²	175	139.1 Å²	139.1	82%	0.818	69%	0.689	S	S	*	*	S	Bend	trans	-157.9	158.2	158.9	-93	-59.5	-48.8	0	0	107.2
85	P	45.1	Very low	47.5	Very low	106 Å²	106	138.8 Å²	138.8	69%	0.688	70%	0.7	S	S	*	*				-126.8	179.1	-117	36.2	-18.1	0	0	0	115.6	L87	P85-L87 PolarHBondContact O-N 3.42Å
86	K	51.4	Low	46.6	Very low	213 Å²	213	141.3 Å²	141.3	93%	0.926	71%	0.713	S	S	*	*			trans	-58.6	126.4	170.6	-65	175.5	177.6	176	0	111.7
87	L	39.2	Very low	45.8	Very low	153 Å²	153	141.5 Å²	141.5	80%	0.801	72%	0.724	S	S	*	*			trans	-155.3	143.9	154.8	-126.1	170.2	0	0	0	109.2	P85	P85-L87 PolarHBondContact O-N 3.42Å
88	L	41.2	Very low	45	Very low	150 Å²	150	146.4 Å²	146.4	79%	0.785	76%	0.761	S	S	*	*			trans	63.1	104.1	-177.1	-46.4	179.6	0	0	0	112.2
89	Q	46.4	Very low	44.5	Very low	170 Å²	170	150.2 Å²	150.2	79%	0.794	78%	0.78	S	S	*	*			cis	54	125.6	49.4	-68.5	-155.9	-0.7	0	0	114.9
90	M	34.8	Very low	44	Very low	176 Å²	176	151.6 Å²	151.6	87%	0.867	79%	0.787	S	S	*	*			trans	65.4	149.4	178.4	-62.7	168.5	170.1	0	0	113.5
91	E	37	Very low	43.4	Very low	168 Å²	168	149.4 Å²	149.4	79%	0.785	79%	0.79	S	S	*	*			cis	-143.6	150.4	15.1	-172.3	149.1	68.9	0	0	114.5
92	K	36.8	Very low	42.8	Very low	188 Å²	188	151.5 Å²	151.5	82%	0.817	80%	0.802	S	S	*	*			trans	5.3	138.9	157.3	-102.4	160.6	173.5	172.1	0	122
93	R	39.6	Very low	42	Very low	217 Å²	217	154.3 Å²	154.3	82%	0.819	81%	0.806	S	S	*	*			trans	-53.2	145.6	144.8	-80.8	-81.5	-157.9	152	1.6	110.7
94	P	43.8	Very low	41.2	Very low	109 Å²	109	159.8 Å²	159.8	71%	0.708	82%	0.82	S	S	*	*				-98.7	-143	67	-14.6	35.1	0	0	0	114.6
95	S	43.5	Very low	40.9	Very low	100 Å²	100	158.7 Å²	158.7	70%	0.699	82%	0.82	S	S	*	*			cis	-152.9	176.8	13.8	-47.3	0	0	0	0	112.2
96	L	37.4	Very low	40.6	Very low	146 Å²	146	162.8 Å²	162.8	76%	0.764	83%	0.83	S	S	*	*			trans	-121.6	157.2	156.1	-110.7	165.2	0	0	0	106.2
97	P	40.4	Very low	39.7	Very low	123 Å²	123	158.6 Å²	158.6	80%	0.799	82%	0.822	S	S	*	*				-146.5	141.1	67.3	38.1	-19.3	0	0	0	117.3
98	V	36.3	Very low	39.7	Very low	203 Å²	203	159.1 Å²	159.1	100%	1.23	82%	0.824	S	S	*	*				-168.1	0	121.5	145.7	0	0	0	0	106.8

Retrieved 98 of 98 residues in 122.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).